HomeMy WebLinkAboutSuWa80Alaska Resources Library & Information Services
Susitna-Watana Hydroelectric Project Document
ARLIS Uniform Cover Page
Title:
Appendix 4, Consultation documentation for informal consultation, July-
November 2012
SuWa 80
Author(s) – Personal:
Author(s) – Corporate:
Alaska Energy Authority
AEA-identified category, if specified:
Revised Study Plan
AEA-identified series, if specified:
Series (ARLIS-assigned report number):
Susitna-Watana Hydroelectric Project document number 80
Existing numbers on document:
Published by:
[Anchorage, Alaska : Alaska Energy Authority, 2012]
Date published:
December 2012
Published for:
Date or date range of report:
Volume and/or Part numbers:
Final or Draft status, as indicated:
Document type:
Pagination:
513 p. in various pagings
Related work(s):
Appendix 4 to:
Alaska Energy Authority. Revised study plan (SuWa 76)
Pages added/changed by ARLIS:
Notes:
All reports in the Susitna-Watana Hydroelectric Project Document series include an ARLIS-
produced cover page and an ARLIS-assigned number for uniformity and citability. All reports
are posted online at http://www.arlis.org/resources/susitna-watana/
Revised Study Plan
Susitna-Watana Hydroelectric Project
FERC No. 14241
Appendix 4
Consultation Documentation for Informal Consultation,
July - November 2012
December 2012
APPENDIX 4
INFORMAL CONSULTATION DOCUMENTATION
TECHNICAL WORKGROUP
MEETING NOTES
Revised Study Plan
Susitna-Watana Hydroelectric Project Appendix 4 Alaska Energy Authority
FERC Project No. 14241 December 2012
TECHNICAL WORKGROUP AND AGENCY CONSULTATION MEETING
DOCUMENTATION (See Table 1-1 of RSP)
1) August 8, 2012 Social Sciences Meeting Notes
2) August 9, 2012 Terrestrial Resources Meeting Notes
3) August 15, 2012 Aquatic Resources Meeting Notes
4) August 16, 2012 Instream Flow and Groundwater Meeting Notes
5) August 17, 2012 Geomorphology and Water Quality Meeting Notes
6) September 6, 2012 Landbird and Shorebirds Meeting Notes
7) September 7, 2012 Cultural Resources Meeting Notes
8) September 13, 2012 Fish Distribution and Abundance Meeting Notes (ADF&G)
9) September 13, 2012 Fish Distribution and Abundance Meeting Notes (USFWS)
10) September 13, 2012 Wildlife Resources Meeting Notes
11) September 14, 2012 Instream Flow and Geomorphology/Ice Meeting Notes
12) September 18, 2012 Wetlands Meeting Notes
13) September 19, 2012 Cook Inlet Beluga Whale Meeting Notes
14) September 20, 2012 Recreation and Social Sciences Meeting Notes
15) September 24, 2012 Cultural Resources Meeting Notes
16) September 25, 2012 Salmon Escapement Meeting Notes
17) September 27, 2012 Fish and Aquatic Study Plans Meeting Notes
18) September 27, 2012 River Productivity Meeting Notes
19) October 1, 2012 Instream Flow-Riparian Meeting Notes
20) October 2, 2012 Instream Flow and Modeling Meeting Notes
21) October 3, 2012 Recreation and Social Sciences Meeting Notes
22) October 4, 2012 Instream Flow and Aquatics Field Meeting Debrief Notes
23) October 4, 2012 Waterbirds Meeting Notes
24) October 16, 2012 Terrestrial Resources Meeting Notes
25) October 17, 2012 Recreation and Social Sciences Meeting Notes
26) October 23, 2012 Geomorphology, Water Quality Meeting Notes
27) October 24, 2012 Instream Flow and Groundwater Meeting Notes
28) October 25, 2012 Aquatic Resources, Geology and Soils Meeting Notes
29) November 2, 2012 Cook Inlet Beluga Whale Meeting Notes
Meeting Summary
Susitna-Watana Hydroelectric Project Licensing
AEA Project Offices, First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
ILP Formal Study Plan Meeting for Social Sciences
August 8, 2012, 8:30 am – 4:00 pm
Attendees:
Organization Name
ADF&G Mark Fink
ADF&G Davin Holen
ADF&G Stormy Haught
ADNR-OPMP Marie Steele
AEA Bryan Carey
AEA Wayne Dyok
AEA Betsy McGregor
AEA Bruce Tiedeman
AGO Brian Bjorkquist
AHTNA Joe Bovee
ANLC – UAF James Kari
Aquatic Restoration and Research Institute David May
BLM John Jangala
Charles M. Mobley & Associates Chuck Mobley
Chickaloon Village Lisa Wade
DHSS Paul Anderson
DOWL HKM Kristen Hansen
DOWL HKM Maryellen Tuttle
EPA Jennifer Curtis
EPA - Intern Lisa McLaughlin
FERC David Turner
FERC Frank Winchell
FERC Ken Wilcox
FERC Kim Nguyen
HDR Tracie Krauthoefer
Long View Associates Steve Padula
The Louis Berger Group Lisa McDonald
McDowell Group Bob Koenitzer
MSB Fran Seager-Boss
MWH Sarah Callaway
MWH Kirby Gilbert
MWH John Haapala (by Phone)
MWH Brian Sadden (by phone)
Meeting Summary Page 2 of 8
Susitna-Watana Hydroelectric Project
August 8, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Organization Name
National Heritage Institute/ HRI Jan Konigsberg
Northern Economics Pat Burden
Northern Economics Don Schoden
NLUR Peter Bowers
NPS Cassie Thomas
NPS Harry Williamson (by phone)
OHA/ SHPO Shina DuVall
Stephen R. Braund & Associates Stephen Braund
Stephen R. Braund & Associates Paul Lawrence
URS Bill Simeone
URS Taylor Brelsford
URS Bridget Easley
USFWS Jenny Spegon
URS Amy Rosenthal
URS Louise Kling
ERM John Gangemi
Introduction and Meeting Overview – Kirby Gilbert (MWH)
Cassie Thomas (NPS) noted she and Harry Williamson provided some initial comments to AEA
yesterday. Cassie asked how AEA will incorporate information from 2012 reconnaissance by
October agency comment deadline along with any winter 2012 reconnaissance. For the formal
studies Cassie is wondering how to integrate outputs from some studies that are necessary inputs
for other studies, within the timeframe of a two-year study window. David Turner (FERC)
responded that if needed there are provisions within the ILP process for updates to the approved
study plans, “with good cause.” Wayne Dyok (AEA) indicated that AEA will provide a
schematic with dates of how the studies interconnect to the group before the October 15
comment deadline.
Action Items
1. Distribute schedule showing interconnections between studies before October 15th
comment deadline.
Regional Economics & Socioeconomics – Pat Burden (Northern Economics)
Regional Economic Evaluation Study – power related benefits/effects of the Project,
focuses on Railbelt
o There was a general request to define in the PSP how the “knowledgeable
persons” to interview for input into the model will be chosen. Pat noted that the
categories of persons and types of interview questions will be added to the study
plan.
o Jan Konigsberg (National Heritage Institute) indicated that the retail rate for
power would be important to include in modeling. He also requested if there was
going to be comparison on opportunity costs regarding power alternatives, such as
Meeting Summary Page 3 of 8
Susitna-Watana Hydroelectric Project
August 8, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
analyzing the costs of other power alternatives that might be foregone by pursing
a large hydropower project. In terms of using surveys to obtain information, Jan
agreed it would be good to have any draft survey instrument in the study plan if
we know we are going to do interviews.
Social Conditions and Public Goods and Services Study – Includes Project effects on
the economies of affected communities, including: Municipality of Anchorage,
Fairbanks North Star Borough, Valdez-Cordova Census Area, Kenai Peninsula Borough,
Y-K Census Area, Mat-Su Borough, Denali Borough.
o Lisa McDonald (The Louis Berger Group) indicated that there is new information
in the field of sociology to provide guidance to identifying objective questions for
surveys and how to extract the information using a survey instrument. She asked
what methods would be used to estimate any economic values associated with
subsistence and recreation use of the region. Pat Burden (Northern Economics)
indicated that existing data will be used to the extent available. Decision to use
travel cost versus random utility model will be made soon in terms of trying to put
some economic values on these uses.
o Cassie Thomas (NPS) expressed concerns about whether the recreation study and
the socioeconomics study plans are going to sample the “adventure tourist”
population of recreationists (in state and out of state tourists), which she
speculated may be more significant to this Project area than commercial tourism.
Cassie noted that commercial service providers (e.g. Mahay’s, Princess Lodge,
etc.), are not really the primary users of the Project area, particularly in the winter.
Many people get to the Project area without the use of commercial service
providers. She asked how non-consumptive users (someone who is not there to
hunt/fish) would be sampled?
o Bridget Easley (URS) indicated that creating a description of recreational uses of
the Project area is not going to be strictly statistical in nature and that many data
collection efforts will be made
o Jenny Spegon (USFWS) expressed concern that local communities will feel left
out if not involved in the surveys. The surveys might appear to be to a selective
audience, rather than a random audience. They may feel like they are part of the
affected group, but were not surveyed for their input, particularly with respect to
quality of life issues.
o Jan Konigsberg (National Heritage Institute) suggested online surveys. The group
agreed that online surveys could introduce statistical bias, but could be valuable
from a qualitative standpoint or capturing certain types of users.
o Cassie Thomas (NPS) mentioned that phone surveys could also introduce bias;
many residents have only cell phones, and no land lines.
o Jan Konigsberg (National Heritage Institute) commented on the exclusion of the
national valuation component to the study, In his mind, it is a difference of
opinion on interpretation of the Federal Power Act. However, he is not opposed to
the current studies, but feels that there should be a national component as well. He
agreed to disagree on that aspect, but is supportive of moving forward with the
existing studies.
Meeting Summary Page 4 of 8
Susitna-Watana Hydroelectric Project
August 8, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Action Items
1. Identify typical survey questions and categories of who will be surveyed. Check recent
literature regarding use and methods for improving informal surveys. Participate in
follow up meetings on surveys methods and instruments to help ensure quality of life and
recreation questions are included in the surveys.
Transportation & Air Quality – Kristen Hansen (DOWL HKM)
Transportation Resources Study – Includes all routes and modes, primarily in the Mat-
Su and Denali boroughs, and also port and rail activity. There will not be a specific
transportation survey; transportation usage will be gathered from existing information
and by inclusion on other resource surveys (i.e. recreation).
o Cassie Thomas (NPS) indicated that this study highlights the need to include
transportation questions on other surveys. Not only on recreation survey, because
people use the river for other purposes than just recreation.
o Jenny Spegon (USFWS) inquired how will people who own land but are only
there seasonally be reached to survey. Bridget Easley (URS) indicated that
residents are interested in many things besides just recreation (i.e. quality of life,
power availability, etc.).
Action Items
1. Consider use of survey questions in other disciplines to help get at understanding of river
and overland transportation uses along the River downstream of Watana dam.
Air Quality Study – the goal is to determine potential for violating any air quality
regulations, primarily within the Project vicinity (direct/indirect impacts), and also assess
Railbelt emissions.
o Other studies are going to be utilizing results from traffic and air quality studies.
So it will be important to front-load 2013 activities to keep those studies moving
forward.
Health Impact Assessment (HIA) – Dr. Paul Anderson (DHHS)
Not a FERC requirement, but AEA is electing to go complete an HIA for the Project
o HIA technical guidance available at: www.epi.alaska.gov
o Lisa Wade (Chickaloon Village) inquired what type of HIA, comprehensive
versus rapid would be used. Dr. Anderson (DHHS) replied Comprehensive.
o Lisa Wade (Chickaloon Village) indicated that the data on subsistence use,
particularly as it pertains to Mat-Su Borough, is lacking, and asked if there will be
a way of getting at that information.
Tracy Krauthoefer (HDR) indicated that Traditional and local knowledge
interviews will be conducted in this area.
Lisa Wade (Chickaloon Village) indicated that this is a traditional use
area, and suggested speaking with Knik tribe, or Richard Porter, on
subsistence issues as well. Chickaloon would appreciate continued
involvement. Dr. Anderson indicated that Newfields would be the
contractor conducting the HIA.
Meeting Summary Page 5 of 8
Susitna-Watana Hydroelectric Project
August 8, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
o Marie Steele (ADNR-OPMP) highlighted the need for close resource
coordination, particularly with regard to the critical path schedule since the HIA
will utilize results from many resource studies.
o Pat Burden (Northern Economics) indicated there would be some coordination
with social conditions study results as well
Project Safety: Probable Maximum Flood & Seismic Studies – Bryan Carey (AEA)
Probable Maximum Flood
o Marie Steele (ADNR-OPMP) asked if any of the studies will evaluate an
unintentional release from the reservoir. Bryan Carey (AEA) responded that an
unintentional release from the reservoir would not result in the entire reservoir
suddenly emptying. The dam structure would still be in place, and an
unintentional release would likely come in the form of a leak or crack in the dam..
Site Specific Seismic Hazards Evaluation – Bryan Carey (AEA)
o Brian Sadden (MWH) explained that every dam under FERC jurisdiction
undergoes periodic dam break modeling. An emergency action plan is developed
based on this flood condition/ event, and is activated in tabletop drill scenarios.
This will be developed in early design and construction.
o Kirby Gilbert (MWH) added that there will be temporary emergency action plans
for construction activities (for use of cofferdams to reroute flows, etc).
o Marie Steele (ADNR-OPMP) encouraged a robust community planning aspect for
emergency response, as this Project moves forward, using lessons learned from
Louisiana and gulf oil spill. David Turner (FERC) indicated that these issues will
be addressed in the dam safety plan, rather than during NEPA assessment. Brian
Carey (AEA) added that the Board of Consultants will be involved very early in
theProject development, which typically occurs much later.
o Kim Nguyen (FERC) requested that AEA contact Doug Johnson at FERC at
Portland Regional Office regarding any further comments to the study plan.
Action Items
1. Contact Doug Johnson at FERC Portland Regional Office to obtain any comments on the
study plans.
Recreation, River Flow, and Aesthetic Studies – Bridget Easley (URS)
There will be several different types of surveys and interviews. Much of it will be qualitative,
some statistical. More development is needed in these areas. Other than sightseeing along the
Parks Highway, recreation is varied and sparse (e.g. hunting) – interception surveys will be
difficult. A multi-disciplinary survey may be necessary to avoid reaching out to the same people
multiple times.
Harry Williamson (NPS) indicated the importance of seeing a preliminary version of the survey
instrument as soon as possible. Bridget Easley (URS) indicated that a survey instrument could be
ready to be released by mid-September or so and a review/discussion meeting could be held.
Recreation Resources Study
Meeting Summary Page 6 of 8
Susitna-Watana Hydroelectric Project
August 8, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
o Cassie Thomas (NPS) would like to see a survey instrument that specifically
addresses recreation winter use and travel.
o Bob Koenitzer (McDowell) cautioned about survey creep; perhaps it is necessary to
send out smaller surveys to targeted groups (snow machiners, etc.).
Aesthetics Resources Study (includes sound)
o Jim Kari (ANLC-UAF) mentioned that nomenclature from Alaska Native groups,
specifically Ahtna, could be included in naming sites.
o Bridget Easley (URS) requested to meet with NPS and others on methodology for the
sound study. Cassie would like to be consulted on site selection; she is unavailable
August 9-27. Mark (ADF&G) would also lie to be included. Sound (and visual) sites
can be discussed further at a meeting in September.
Recreational Boating/ River Access Study (likely to be renamed Recreation Flow Study)
o Ken Wilcox (FERC) inquired how users of the upper reach (from Project area up to
the Denali Highway) would be affected once they reach the Project area. John
Gangemi (ERM) responded that this is an area that will be targeted; is important for
egress from the river as well.
Harry Williamson (NPS) indicated the need to understand how all the surveys and data
gathered from other studies are going to be interrelated. He inquired when/what preliminary
information from the 2012 recreation study would be available before the October 15
comment dead line. Betsy McGregor (AEA) indicated that the 2012 recreation data was basic
reconnaissance-level information.
Cassie Thomas (NPS) – We understand that it is preliminary data, and likely will change, but
it will at least provide some baseline information.
Harry Williamson (NPS) would like to see the revised study plans include appendices of the
actual survey instruments.
Ken Wilcox (FERC) indicated that the Revised Study Plan should include a list of potential
locations identified for intercept surveys and initial Key Observation Points (KOPs) should
be identified in the study plans if possible.
Action Items
1. Hold workshop or meeting to go over survey instrument, survey plan, and initial selection
of KOPs.
2. Conduct consultation prior to distribution of the preliminary survey instrument. Include
Cassie Thomas (NPS).
3. Set up meeting between URS and NPS regarding sound study methodology and site
selection.
4. Include survey instruments as appendices in Revised Study Plans.
5. Add a list of potential locations identified for intercept surveys and initial KOPs.
Cultural & Paleontological Resources Studies – Chuck Mobley (Charles M. Mobley &
Associates)
Cultural Resource Inventory and Evaluation
Ethnogeographic and Traditional Cultural Properties (TCPs) Inventory and
Evaluation
Meeting Summary Page 7 of 8
Susitna-Watana Hydroelectric Project
August 8, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Paleontological Resource Inventory
2012 Survey Data and Applications
Frank Winchell (FERC) indicated that the definition of the Area of Potential Effect (APE) is
the primary issue to be resolved. He suggested starting out with APE map that shows area of
direct effect, area of indirect effects, land ownership and previously-surveyed areas and
distributing it to the cultural resources workgroup for a meeting later in August or so. Shina
DuVall (OHA-SHPO) indicated that it is acceptable to refine the APE as the Project
components become clearer and unknowns are eliminated.
Pete Bowers (NLUR) confirmed that transportation and recreation studies will be considered
in refinement of the APE, particularly the indirect effects.
Shina DuVall (OHA-SHPO) indicated that distinguishing between direct/indirect APE is less
important to SHPO, but is usually helpful for project planners. APE should include all
alternatives, and when they are eliminated, then the APE can be refined.
Chuck Mobley (Charles M. Mobley & Associates) inquired if the entire list of native entities
identified in the PSP should be invited to the APE meeting. Shina DuVall (OHA-SHPO)
indicated that it would be better to cast a wider net, and allow the various groups the
opportunity to participate. However, just sending a letter and not receiving a response is not
necessarily enough; a good faith effort to follow up with groups and give them an
opportunity to respond and participate would need to be made.
Frank Winchell (FERC) suggested consulting with the Advisory Council on Historic
Preservation concerning the APE discussions.
Pete Bowers (NLUR) mentioned the need to identify culturally-modified trees, such as
intertwined trees or trailmarkers.
Frank Winchell (FERC) inquired if a tribal representative/monitor would participate during
field studies.
Wayne Dyok (AEA) suggested including the Mat-Su Borough (Fran Seager-Boss) in the
discussions.
Action Items
1. Develop a map/maps showing draft direct/indirect APEs and land ownership and provide
to workgroup.
2. Set up a workgroup meeting for later in August or September to develop APE rationale
and initial APE.
Subsistence Study – Paul Lawrence (Stephen R. Braund & Associates)
Paul Lawrence (Stephen R. Braund & Associates) confirmed that preliminary information
would be available within a relatively quick timeframe for other resources to utilize in their
analyses.
Steve Braund (Stephen R. Braund & Associates) stated that cultural and subsistence studies
should be coordinated to identify the “overlap” between the two resources.
Davin Holen (ADF&G) confirmed that the ADF&G interviews will help to identify the
people in the communities that will be good to interview.
Meeting Summary Page 8 of 8
Susitna-Watana Hydroelectric Project
August 8, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Ken Wilcox (FERC) indicated that it would be nice to have clarification between the users
that are living off the grid (a subsistence lifestyle) versus those utilizing areas for recreation.
David Turner (FERC) inquired how off-the-grid residents would be captured.
Marie Steele (ADNR-OPMP) inquired if a comprehensive data document of all survey
results could be produced after all work is completed.
Steve Braund (Stephen R. Braund & Associates) suggested that following the recreation
survey workshop meeting, a list of desired survey questions be sent to them to determine how
they can be accommodated in their survey.
Kirby Gilbert (MWH) requested the survey instrument be included in the Study Plan..
Action Items
1. Davin Holen (ADF&G) to send Steve Braund (Stephen R. Braund & Associates) a list of
communities to be studied.
2. Davin Holen (ADF&G) to provide a copy of the survey instrument, for work that will be
conducted in January 2013.
3. Steve Braund (Stephen R. Braund & Associates) to provide survey instrument for the
remaining communities.
Meeting Summary
Susitna-Watana Hydroelectric Project Licensing
ILP Formal Study Plan Meeting for Terrestrial Resources
August 9, 2012, 8:30 a.m. – 4:00 p.m.
AEA Project Offices, First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Attendees:
Organization Name
ADF&G Wildlife Conservation Mark Burch
ADF&G Wildlife Conservation Kimberly King
Aquatic Restoration and Research Institute (ARRI) Gay Davis
BLM-Glennallen Field Office Sarah Bullock (by phone)
BLM-Glennallen Field Office Ben Seifert (joined later by phone)
Office of Project Management and Permitting Marie Steele
Natural Heritage Institute (NHI) Jan Konigsberg
USFWS Catherine Berg
USFWS Jennifer Spegon (by phone)
USFWS Bob Henszey (by phone)
USFWS Maureen de Zeeuw
FERC David Turner
AEA Betsy McGregor
AEA Wayne Dyok
ABR, Inc. Brian Lawhead
ABR, Inc. Terry Schick
LVA Steve Padula (by phone)
MWH Kirby Gilbert
Solstice AK Robin Reich
Presentations
Kirby Gilbert (MWH)
Overview of AEA Proposed Study Plan
Brian Lawhead (ABR, Inc.)
Wildlife Proposed Study Plans
Surveys of Eagles and Other Raptors
Waterbird Migration, Breeding, and Habitat Use
Breeding Surveys of Landbirds and Shorebirds
Wood Frog Distribution and Habitat Use
Moose Distribution, Abundance, Movements, Productivity, and Survival
Caribou Distribution, Abundance, Movements, and Productivity
Distribution, Abundance, and Habitat Use of Large Carnivores
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 2 of 29
Dall’s Sheep Distribution, Abundance, and Habitat Use
Wolverine Distribution and Abundance
Terrestrial Furbearer Abundance and Habitat Use
Aquatic Furbearer Abundance and Habitat Use
Population Ecology of Willow Ptarmigan in Game Management Unit 13
Evaluation of Wildlife Habitat Use
Wildlife Harvest Analysis
Little Brown Bat Distribution and Habitat Use
Small Mammal Species Composition and Habitat Use
Terry Schick (ABR, Inc.):
Botanical Proposed Study Plans
Vegetation and Wildlife Habitat Mapping
Wetland Mapping Study
Riparian Study
Rare Plant Study
Invasive Plant Study
Introduction/Overview of AEA Proposed Study Plan
After introductions, Kirby Gilbert (MWH) gave an overview of the Proposed Study Plan (PSP).
He said that there are 16 study plans to cover wildlife resources and 5 study plans to cover
botanical resources. There will be topical meetings through next week to present all the plans
in the PSP. These meetings are the formal PSP meetings in the Federal Energy Regulatory
Commission (FERC) Integrated Licensing Process (ILP) process. The PSP is about 1,300 pages
long and includes 58 separate study plans. The PSP was filed with FERC on July 16, 2012.
Kirby said that Sections 1 and 2 of the PSP are the introduction. He said that Section 3 of the
PSP discusses studies not proposed. The PSP’s Sections 4 through 14 include study plans
organized by 11 resource areas. Each section has appendices that record consultation with
agencies.
Kirby said that there are 2012 field studies currently occurring which will inform the 2013/14
study plan development. Some of the 2012 studies will continue in 2013/14.
Kirby said that the Alaska Energy Authority (AEA) and/or FERC received 52 formal study
requests and 150 comments on the PAD that helped develop the PSP. A few studies proposed
in the PSP did not have a study request. He said that FERC issued the Scoping Document II,
which is being used to input the study planning process. The Study Plan should be finalized by
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 3 of 29
November 14, 2012. Comments on the PSP are due by October 15, 2012. Kirby said that FERC
will make the study plan determination about one month after the study plan is submitted.
Kirby said that the goal of this terrestrial working group meeting is to develop a plan to gather
agency comments, so that AEA can address them. This meeting should help to coordinate
smaller group meetings. He said that today each terrestrial study would be presented and
questions and comments would be gathered and discussed. He said that ABR would also report
on the 2012 fieldwork. He said that if follow-up is needed, the Team will try to determine dates
for additional topical meetings. He said that the group should focus on action items and areas
of concern.
Jenny Spegon (USFWS) asked when and where the notes from this meeting would be posted.
Kirby said that the notes would be posted on the Project website within a week or so. Betsy
McGregor (AEA) said that the notes and presentations would be posted on the page where the
meeting is advertised (http://www.susitna-watanahydro.org/meetings/).
Catherine Berg (USFWS) said that the U.S. Fish and Wildlife Service (USFWS) team has started
going through the PSP; however, these meetings are a bit premature. Catherine said that the
USFWS will not be able to get all their comments in during these meetings. She said that she
hoped that this meeting is the start of a process. Kirby said that he agreed and that this
meeting was more of a clearinghouse effort. He said that written comments should be sent to
Wayne Dyok at AEA when they are ready. Wayne said that the Team is listening to comments
today, but that this is an ongoing process.
David Turner (FERC) said that agencies need to be cognizant of the FERC timeline. He said that
we need to get moving on gathering comments on the PSP so that the Revised Study Plan
addresses all the issues when it is submitted November 2012.
Wildlife Proposed Study Plans
Brian Lawhead (ABR) said that his presentation would give an overview of the wildlife study
plans. He said that the Team was interested in agency feedback to identify areas needing more
attention.
Survey of Eagles and Other Raptors
Brian summarized the eagle and other raptor study objectives. He said that the survey of
eagles and raptors is important because of the concern with eagle nest take under the Bald and
Golden Eagle Protection Act. He said that there could be eagle and raptor issues with
transmission lines. He said that eagle nest aerial surveys were occurring in 2012 and would
continue in future years. These surveys would also record other raptors. He said that aerial
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 4 of 29
surveys were also gathering data on nesting eagles, falcons, and other raptors, as well as fall
and winter concentration areas (communal roosts and foraging sites).
Brian said that the proposed study area for the eagle and other raptor survey is a 3-mile buffer
around the transportation and intertie corridors and a 10-mile buffer around the impoundment
area, as requested by USFWS.
Mark Burch (ADF&G) asked which transportation corridors where being proposed and which
were not being considered. Brian said that there are three corridors under investigation. Kirby
said that the corridors shown on the map are still under study and it hasn’t been determined
which corridors would be carried forward for further study. Wayne said that AEA would like to
look at two transmission corridors, which would include one corridor co-located with the
intertie and the other transportation corridor separate from the intertie corridor. Wayne said
that the Alaska Department of Transportation and Public Facilities (ADOT&PF) completed a
high-level analysis of the access corridors. Comments on the corridor document are due by the
end of August 2012. He said that the ADOT&PF document is non-decisional and gives an
overview, schedule, and costs of corridor alternatives. Betsy confirmed that the corridors to
the northeast of the reservoir have been dismissed and are not being studied. Wayne said that
the corridor selection is a process depending on avoidance measures. Betsy said that the
transmission and access corridors bifurcate at times due to wetlands avoidance for the access
route and icing issues for the transmission lines.
Brian said that the 10-mile buffer will be a much larger area than was surveyed in 2012 and
there are concerns about whether the entire area can be covered during the nesting period
because it is so big.
Brian summarized the eagle and raptor survey study methods used in 2012 and proposed for
continuation in the PSP. He said that additional work may be needed to better estimate what
might be missed on the nesting surveys (sightability assessment). He said that the Team may
need more discussion with USFWS regarding small raptor species and cavity-nesting owls
because they are difficult to study. He said that one component of the raptor study would be
to review information on food habits and diets for use in the mercury bioaccumulation study.
Brian summarized the expected results of the eagle and raptor study. He said that migratory
flight activity and potential for collision risk would be estimated from the information collected.
He said that the Team would need time to examine habitats to figure out nest detectability in
the study area.
Brian summarized the relationship of the eagle and raptor study to other studies. He said that
the Team may propose sampling unhatched eggs and feathers to provide baseline data on
mercury levels before project development.
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 5 of 29
Brian summarized the results of the 2012 study. He said that many nests were found. He said
that not all of the nests found were occupied and not all occupied nests were successful.
Catherine asked whether the surveys were only conducted in the 10-mile buffer. Brian said
that they surveyed a 2-mile buffer around the Project area in 2012.
Betsy added that ABR also surveyed the river corridor downstream all the way to Gold Creek.
Brian said that it is difficult to compare the results of the 2012 survey with previous studies
because the search area in the 1980s surveys was not clearly defined in the reports. He said
that there were significantly more Peregrine Falcons, which shows that they are continuing to
recover. He said that no large owl nests or raven nests were observed.
Brian summarized the eagle and raptor discussion points. He said that the design of the eagle
and raptor study methods was based on conversations with USFWS and in consideration of
eagle take. He said that the study area will be expanded around the proposed reservoir
impoundment. He said that the Team understands that more discussion regarding the survey
area and survey methods for other species of raptors is needed.
Brian said that suitable habitat mapping would be done within a very large area (5-mile buffer
around the Project area) and would be drawn from wildlife surveys and vegetation mapping.
He said that mapping suitable cliff habitat must be done in the field because a GIS modeling
effort cannot reliably identify all potential nesting habitats. He said surveys of small raptors,
including cavity-nesting owls, involve logistics and safety concerns that need to be discussed
further with USFWS. He said that BLM also had concerns about transmission corridors
becoming nesting and perching sites, which might have effects on raptor prey species. Brian
said that the project design would employ Best Management Practices (BMP) to help avoid
raptor electrocution. He said that towers would need to be designed to keep them from
becoming nesting or perching sites for ravens and raptors.
Maureen de Zeeuw (USFWS) asked when the results of the 2012 survey would be available.
Brian said that a technical memorandum summarizing the information would be completed by
the end of August 2012. Maureen said that there was good information provided on this in the
PSP, but that there are other species that need to be discussed and that a nest productivity
assessment and mapping needs to be discussed. Brian and Maureen will plan a meeting,
hopefully by early September, with Jordan Muir, who issues USFWS eagle take permits.
Maureen confirmed that the items that Brian presented were the primary issues. Brian said
that a second helicopter survey group may need to be added to survey the entire 2013/14
study area. Betsy said that the enlarged survey area (10-mile buffer around the reservoir) is
just for the eagles. Brian said that the team could pick up other large stick nesters even though
the large survey area is for eagles. Brian said that in the Lake Louise flats there are more bald
eagles. Mark Burch said that ADF&G is interested in all species and may have more comments
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 6 of 29
on the raptor survey methods. Mark said that he would like to be aware of the discussion.
Sarah Bullock (BLM) said that BLM was interested in hearing the outcome of the eagle and
raptor meetings. Catherine asked whether there was a small raptor or owl expert at ADF&G,
and Mark said not really.
Brian said that there are some practical considerations that need to be considered with study
methodology. He said that winter night ground surveys would be needed to find owl cavity
nesters, which would be difficult. Maureen said that there are many oddball birds that can’t be
studied by typical survey methods. She asked what analysis would best to get a handle on
those species. Brian said that the best way to determine their locations would be good wildlife
habitat maps.
Maureen said that she was confused about the habitat mapping effort and how it would be
done. She said that there are other factors that should be considered when mapping habitat
but the study plan doesn’t provide enough details. Brian said that the maps would recognize
the vegetation, landscape position, and soils, which are factors that might affect habitat use by
bird species.
Maureen and Catherine confirmed that the USFWS would be able to review the PSP before
meeting with Brian and the ABR Team.
Brian said that there are 50 to 55 species of birds in the project area that are of concern in the
USFWS/FERC Memorandum of Understanding (MOU) and methods for study differ among
species.
Waterbird Migration, Breeding, and Habitat Use
Brian summarized the objectives of the waterbird study, which included determining breeding
and migration locations, especially related to the locations of project components. He said that
the waterbird study would review data on food habits and diets, which will also inform the
mercury study.
Brian summarized the waterbird study area. He said that the study area is a 3-mile buffer that
would be expanded in some areas to incorporate additional waterbodies, as needed. He said
that more discussion is needed with USFWS regarding the study area size. Brian said that the
study area corresponds with 1980s study area. He said that because of elevation and ice, there
are areas that would not be as heavily used in spring as in fall, and these areas would not be
highly used as a migration corridor.
Brian summarized the waterbird study methods.
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 7 of 29
Catherine asked the reason for doing 4 surveys instead of 8 surveys as requested by USFWS.
Brian said that this needs to be discussed. He said that there is a lot of ice in the spring that
could limit survey numbers.
Catherine asked why the survey spacing in the study plan is 800 meters while the requested
study methodology has 400 meters spacing. Brian said that the protocols could be modified.
Catherine said that the spacing should be closer in lowland lake areas. Brian said that generally
transects don’t work in this type of variable terrain. He said that spacing needs to be looked at
and discussed in more detail.
Brian said that Harlequin Ducks are a species of concern and need to be looked at in more
detail. He said that night migration is not detectable without using methods such as radar. He
said that we need to agree on how to study these species because the methods are difficult and
the terrain may limit radar study effectiveness.
Brian summarized the expected results. He said that brood surveys will help determine how
successful species are over the season.
Brian summarized the discussion points. He said that the main difference between USFWS
requests and the PSP is survey timing based on what is thought to be appropriate. He said that
the USFWS requested a 15-mile radius around the project components, and the PSP proposes a
smaller buffer. He said that the Team has questions about how the USFWS buffer was derived
and whether it was needed, considering the project nexus. David Turner said that FERC wants
to understand the relevance of the 15-mile buffer. Maureen said that the recommended 15-
mile buffer came from the 1980s studies, and there is room to discuss the distance.
Brian said that the 800-meter transect spacing that USFWS requested versus the 400-meter
transect spacing proposed in the PSP needs to be worked out.
Brian said that ADF&G’s request for a helicopter survey of seaduck broods needs to be
discussed, since ground surveys of waterbird broods are proposed, which should provide
equivalent information. He said that the 1980s study concluded that the project area was not a
major migration corridor. He said that the Team needs to figure out study methods and
suitability of study methods. He said that BMPs to avoid impacts, for example moving the
intertie corridor toward topographic features that would discourage crossings by migrating
birds, may help to avoid collisions.
David Turner asked whether there are any prohibitions on using radar because the Air Force
uses the area. Brian said that there is no real concern because the radars work on different
frequencies.
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 8 of 29
Maureen said that USFWS was interested in density information, which wasn’t included in the
PSP. She said that it was not clear how that information would be determined. She said that it
is important to the USFWS to get actual numbers of individuals. She said that they were
interested in breeding species in the suitable habitat in the Project area. Maureen said that she
was also interested in estimation of long-term effects of the Project on waterbird productivity.
She said that the buffer area was requested so that it could be compared to the 1980s findings.
She said that the buffer might only be relevant in a few areas; however, it needs further
discussion. She said that the intensity of the migration survey needs further discussion to make
sure the study is not missing migration peaks. She said that the transect spacing distance needs
to be discussed further.
Maureen said that the migration surveys to determine strike risks are most important in
specific areas and that the USFWS doesn’t expect migration surveys to be conducted in all
areas. She said that even though the 1980s data didn’t show a big migration corridor, it doesn’t
mean it isn’t important. She said that the 1980s study may have been looking at use not birds
flying over, which is a different question. Maureen said that if the project didn’t include lighting
of facilities that attracts birds, then expensive studies would not be needed. She said that the
Project needs an operational plan, but on other projects she has seen BMPs proposed that
weren’t implemented. She said that further discussion of radar surveys is needed to figure out
where the Project risk to birds might be the greatest. She said that waterfowl experts could be
involved in the meetings, but they are out in the field in August.
Kirby said that we will need a series of several meetings and that it would be good to schedule
them as soon as possible.
Catherine said that the reporting and deliverables outlined in the PSP need to be more detailed
so that USFWS can understand what will be in a study report. She said the USFWS needs the
requested information so that they can determine project impacts.
David Turner asked whether the information requested by ADF&G for seaduck species was
different than for other waterbird species. Catherine said that ADF&G comments may have
been related to migration timing. She said that dabbling ducks migrate at different times than
diving ducks and may require a different study period. Catherine said that seaducks should be
covered by the study timing presented in the PSP.
Breeding Surveys of Landbirds and Shorebirds
Brian summarized the objectives of the landbird and shorebird breeding survey. He said that
not all the species would be detected by the point-count methodology, which would be the
primary method used. He said that the study would focus on areas of high interest, including
the inundation area.
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 9 of 29
Brian summarized the study area for landbirds and shorebirds. He said that the area includes a
5-mile buffer around the Project area, which corresponds to the wildlife habitat mapping area.
He said the study area is proposed to understand the relative abundance and locations of rare,
high-value habitats. He said that the area has been mapped in the past, but would be much
more specific this time. He said that the work would be tied to the wildlife habitat evaluation
study.
Brian summarized the landbird and shorebird study methods. He said that they would conduct
stratified sampling depending on habitat abundance. Maureen asked whether the study would
provide density estimates. Brian said that the intent would be to determine density by
correlating information from the point-count data. Maureen said that the project needs to
determine landbird and shorebird densities, even though it is difficult to do.
Brian said that additional point counts would be done apart from the habitat-based sites in
areas that are important for nesting of fluvial and riverine species, for example, clear water
habitats in tributaries. Catherine asked how the sites would be selected without bias. Brian
said that site selection needs to be discussed further because it may be biased because fluvial
habitats would be selected specifically to address USFWS concerns for those species.
Brian said that the Team is proposing to do surveys over broad area. Maureen said that the
methodology wasn’t clear about the number of plots, transects, or whether there would be
plots with several points. She said it is not clear how plots would be distributed. Brian said that
the study would generally try to cluster plots so that they would not have to do a lot of
helicopter flying. He said that the number of plots depends on what the crew can accomplish
and the number of habitats that can be reached by clustered points. Maureen said that the
methodology needs to be explained more fully.
Maureen asked whether habitat data would be collected at the same time as point counts. She
said that trying to do both simultaneously is not an effective way to do this type of study. She
said that the study would have to have extremely simply habitat parameters, which is not
recommended. Brian said that when the bird surveys start, the wildlife habitat map would not
yet be done to determine which points to examine, so the 1980s vegetation mapping would
need to be used. Maureen said that focusing on birds and collecting habitat data at the same
time is a difficult effort and could make a huge difference to the study.
Maureen said that she understands that, at some point, they need to look at the big picture and
concentrate on some species more than others. Brian said that this would be a valuable
discussion.
Brian summarized the landbird and shorebird study discussion points. He said that the study-
area buffer size needs to be discussed. He said that the USFWS rationale for locating “study
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 10 of 29
plots” in Denali National Park and the Copper River Basin needs to be discussed in detail. He
inferred that those study plots may be aimed at trying to figure out rare species detectability.
Maureen said that this might be a more cost-effective way to get answers, but that it would
need more discussion.
Brian said there needs to be a discussion about surveys of “overwintering” birds and spring
surveys of resident breeding species. He asked whether “overwintering” birds means resident
species. He said that the Team needs to determine how to study these species, acknowledging
that some overwintering birds are hard to detect and that winter survey methods are difficult.
Brian said that the request for mist netting should be discussed, because it is a big effort with
risks to birds. Maureen agreed that mist netting should be discussed.
Maureen said that we need to figure out how to study landbird light attraction and the
potential for collisions. She said that USFWS is concerned about facility lighting and its impact
on migrating birds. She said that during low visibility or at night the Project facilities could pose
a collision risk. Maureen asked whether the dam would be lit on top. Wayne said that it hasn’t
been determined, but that safety is paramount. Maureen said that there are numerous reports
of disoriented birds circling and being attracted by lighting. She said that she understood that
the lighting plan is important for human and bird safety.
David asked whether the lit area of the Project would be within the migration corridor. He
asked whether the radar study would help to determine the migration corridor. Maureen said
that USFWS was not proposing to sample the entire corridor. She said that topography and
Project components would help to determine the survey location. Wayne said that the project
airstrip would have lights. Maureen said that it would be good to find out where the Project
risks to birds would be located.
Maureen said that random plots across prominent habitat types are a good idea. She said that
kingfisher and dipper methods need to be discussed because they are only mentioned within
the PSP as an additional set of point-count surveys. She said that point-count surveys along the
river might not work because of water flow noise. She said that density estimates are
important but the estimates can’t just be done based on habitat use. She said that basing the
study on habitat use information from the Lower ’48 is not a good idea, but it might be the only
way since we don’t have good data for Alaska. She asked how we can figure out specific habitat
being used by the birds and collect the habitat information at the same time. She said that
mapping methods, including how many categories of habitats would be mapped and what
parameters would be used, need to be discussed in more detail.
Maureen said that understanding the Project’s l ikelihood to injury to birds would help with
study design. She said that Table 8-98 in the PSP indicating abundance isn’t enough to
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 11 of 29
understand the number of birds that might be impacted by the Project and more details are
needed there. She asked what approximately 400 point-count samples meant and whether it
was points or clusters. She asked how many habitat types would be represented under this
methodology. Maureen said that first-light protocol should be related to the local sunrise.
Maureen said that Page 8-95 of the PSP states that density estimates are not proposed. She
said that the USFWS doesn’t accept this because we don’t know what species would be using
each habitat type. She said that she would like to bring Dave Tessler at ADF&G into the small
group meetings.
Maureen said that they would like to discuss what classifications would be used for habitat
mapping and to what scale.
David said that, unless we related the study to the management area or to the population as a
whole, it will be difficult to figure out the significance of effects. Maureen guessed as much as
30,000 to 40,000 pairs of landbirds could be lost by the impoundment zone. Brian said that not
all would be dead and that they may move elsewhere. Maureen said that the USFWS would
need something to show that they would go elsewhere. She said that the bird season is short
and that the displaced birds would not have enough time to find another location to nest. She
said that a very low percentage of birds would go somewhere else to nest.
Wayne said that it would take two to three years to fill the reservoir. Kirby said that there are
some strategies to help minimize damage to birds. David said that he wanted to know how the
data would be used in the impacts analysis. Maureen said that the relative abundance would
not give you the information needed. She said that they need to figure out the significance of
impacts. Betsy said that impacts could be mitigated and added that not all birds would be lost
and that many would be displaced. Betsy asked if the USFWS expected AEA to recreate the
same amount of territories that would be lost due to the Project.
Maureen said that she was not prepared to discuss mitigation. Kirby said that lost habitat could
be replaced by other habitat types. Maureen said it would not be replaced if it is water. She
said that we need the right data to figure out mitigation.
Terry Schick (ABR) said that, based on comments from ADF&G and the recent literature they
cited, that density estimates from point count data are likely to be quite variable. He said
widely variable distance estimates to birds detected only by songs and calls can result in
unreliable density estimates. Maureen agreed with Terry Schick in saying that using range
finders does not solve the problem of getting accurate distance estimates to birds detected
only by sound. Terry said the study team would collect the data needed to do the distance
analyses, and then the decision would be whether or not to conduct those analyses. He said
that that distance analyses might give better density estimates for common species (with larger
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 12 of 29
sample sizes) and less reliable density estimates for less common species (which often are the
species of most concern). Maureen said that this is a bigger issue than can be discussed today.
Terry said that if enough plots were surveyed and enough habitats were sampled, density
measurements could be determined, but those densities still would have large error margins
surrounding them (i.e., the estimates of the number of birds affected by the Project would be
widely variable). Maureen said that they could use ranges of numbers affected.
Maureen said that she wanted to reiterate that virtually the entire population of one
subspecies of Rock Sandpipers overwinter in upper Cook Inlet and feeds primarily on Macoma
balthica, a small clam that lives in intertidal sediments. She said that the clam is a critical
resource for Rock Sandpipers in upper Cook Inlet, including the area around the mouth of the
Susitna River. She said that the presence of the clam and Rock Sandpipers is understood, but
how the operations of the Project could affect Macoma is not understood. She said that they
do not need more study of the sandpipers, but instead need to know how their food resource
would be affected. Betsy said that the river productivity study team looked into the issue and
determined that Macoma is a strictly marine species. Betsy said that the study team will look
into how clams could be impacted through potential Project-induced changes to their
environment through sediment modeling, water quality modeling, and geomorphology studies.
Maureen said that a connection needs to be made between clams and sandpipers. Wayne said
that the river study team was looking at the issue through the water quality, modeling, and
sediment-transport studies. He said that AEA would have to think about how to address the
topic in the RSP. Maureen said that they have looked at this issue on the Columbia River.
Wood Frog Distribution and Habitat Use
Brian said that the Susitna Hydroelectric Project Studies didn’t survey for frogs in the past.
Brian summarized the frog study area, which includes the area that could be affected directly
by the Project footprint, including the reservoir impoundment.
Brian summarized the study methods and the expected results. He said that detectability
estimates using an occupancy survey protocol are proposed. He said that the timing of calling
males would be assessed from other studies to try to schedule the surveys during the peak
calling period. He said that they would survey suitable habitats including waterbodies and
wetlands where frogs are likely to breed. Habitats where frogs move after breeding would be
evaluated in the habitat evaluation study.
Brian summarized the wood frog discussion points. He said that the study team would evaluate
the chytrid fungus concern and the possibility of collecting frogs/tissue for bioassays in
conjunction with the survey; however, the study team would need more information on how to
properly collect samples. He said that there are standard methods for assaying for the fungus
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 13 of 29
but that there were questions about whether there was a realistic relationship between the
proposed Project activities and the spread of the fungus. He said that it was not clear how
widespread the fungus is or whether it could be related to Project activities.
Catherine said that there may be effects on frog breeding ponds due to the Project’s gravel
roads and dust. She said that USFWS would evaluate the frog work on the Kenai. She said that
there are results from the Kenai area for the last few years. She said that impacts to frogs have
to do with dust, temperatures, contaminants, and predator interactions from the road. She
said that a gravel roadway is more of an issue than a paved roadway.
Betsy said that the study area would need to be assessed also. She said that it might not make
sense to study the transmission line corridors because there would be no gravel roads or pads
in those areas. Wayne said that the air quality study could provide information on how far dust
would travel.
Wildlife Resources Studies
Brian summarized the objectives of the moose study. He said that the moose study focuses on
numbers and movements of animals in the Project area. He said that the study would help to
develop mitigation measures for the Project.
Kimberly (Kim) King (ADF&G) said that ADF&G was hoping to do work this November (2012)
and looked at logistics and ran some numbers. She said that surveying the areas below and
above the dam at the same time would be preferable to looking at them at different times. The
data would be collected for application of ADF&G’s geospatial population estimator (GSPE)
method, which uses intensive sampling of smaller quadrat areas. She said that they could input
numbers into the system and get moose estimates below and above the dam. She said that
they would need the weather to cooperate for seven consecutive days. She said that the
moose population composition surveys would be going on at the same time, so they may have
difficulty getting enough pilots and airplanes to conduct this survey. She said that they would
do fixed-wing surveys of random plots, dividing the area up into 6-square-kilometer sample
units. She said that they would be looking at 200 sample units.
Brian summarized the caribou study objectives. He said that ADF&G would be recollaring
animals known to use the Project area. He said that they would also use individuals that are
already marked.
Brian summarized the objectives of the large carnivore study (bears and wolves). He said that,
according to ADF&G, not a lot of new field work would be needed. He said that the study
would rely largely on existing information. He said that the bear study would look at bear use
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 14 of 29
of anadromous fish spawning streams in the Susitna drainage below the proposed dam to
understand changes in use of the streams.
Brian summarized the moose study area. He said that it was based on moose management
subunits. He said that the purple areas on east (see slide) are where long-term trend counts
have been done, located both south and north of the Project reservoir.
Brian summarized the caribou study area. He said that the study area is designed to look at
specific movements of the Delta and Nelchina herds and where they overlap. He said that it is
divided up into game management units. He said that the study area is complicated because
two caribou herds and several subherds potentially occur in the study area. He said that herds
are defined on the basis of their fidelity to calving grounds. He said that the Nelchina Herd uses
the area in the eastern Talkeetna foothills in Game Management Unit 13A. He said that the
Delta Herd calves in an area off the map, north of the Alaska Range.
Brian summarized the large carnivore study area. He said that they would do an analysis of
existing data. He said that they needed to revise the study area map (see slide in presentation)
because not all areas were shown.
Brian summarized the moose and caribou study methods. He said that a combination of the
monitoring of GPS/satellite and VHF radio collars would give good information on movements
in relation to the Project area.
Brian summarized the large carnivore study methods.
Brian summarized the expected results of the moose, caribou, and large carnivore studies.
Brian summarized the 2012 study activity. He said that the late-winter moose survey was
completed in 2012 because of the high snowfall. He said that wolf and wolverine telemetry
data from the 1980s studies were not available. Betsy said that the data might be in Juneau.
David asked whether the existing wolf and bear data would be good enough for the agencies,
and Brian confirmed that it was.
Mark said that ADF&G put out satellite GPS collars on bull moose.
Brian summarized the moose, caribou, and large carnivore discussion points. He said that BLM
asked whether there were plans to validate the moose carrying-capacity study done in the
1980s. He said that the work wasn’t planned because the current studies of moose browse
removal would use a different method and model. Sarah said that this is acceptable to BLM.
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 15 of 29
Kim said that ADF&G had started doing telemetry on 170 caribou with satellite and VHF on
collared bulls. She said that it was taking longer to track all of the animals than they originally
thought it would. She said that they flew the study area last week. She said that the half of the
study area (the northern and western portions) took 8 hours to fly on Sunday and 6 hours to fly
on Monday. She said that the valleys make it hard to cycle through all the collar frequencies.
She said that their goal is to survey all frequencies and to locate all of the collared animals every
time they fly. She said that because it takes so long, they are going to fly every two weeks
instead of flying the study area weekly. She said that ADF&G thinks that this sampling period
would be good enough because they also have satellite data. She said that in November 2012
ADF&G would be putting satellite collars on some cows. She said that they could use the VHF
transmitters on the satellite collars to find the animals even if the satellite transmitters had
problems. Kim said that she did not remember how often the satellite data were collected, but
that the ARGOS data provided on CD is taken half as often to save battery life. She said that
until collars are removed they are unable get GPS data, which is stored on board the collars for
downloading after retrieval.
Kim said that right now ADF&G was only planning on biweekly flights. Mark said that in
September 2012 they would increase to weekly survey flights during migration periods.
Jan Konigsberg (NHI) asked what the problems were with relying on satellites instead of flying.
Kim said that VHF collars have a longer battery life and cost 3 to 4 times less that satellite
collars. Jan asked whether GPS data could be stored on the collar. Brian said that it depends
on the collar’s duty cycle. He said that the most complete data is collected on the GPS collars.
Brian said that there is a new technology that might be able to be used to kick up the frequency
of data collection when collared animals come near a specifically defined geographic area.
Mark said that BLM had comments related to putting collars on the right caribou during the
right season. He said that the Nelchina Herd is important. He said that there are few times
when they can effectively collar because of weather, climate, and the hunting season timing.
He said that ADF&G does have success on identifying and distributing collars on various herds.
Sarah said that BLM just needed to understand this better and that the agency accepted the
information that was being provided. Kim said that October is the best time to figure out
whether individual moose are resident or moving through and that is why ADF&G selected
October to sample. She said that once the data are returned, ADF&G will adjust the collared
caribou if they figure out that one group is oversampled.
Sarah said that in the 1980 studies caribou were captured during calving. She said that the
Project needs to figure out who would be going across the inundation zone. Mark said that
ADF&G would be putting more collars on the Nelchina Herd to understand this. He said that
the Delta Herd isn’t expected to cross the inundation zone. He said that they have 10 satellite
collars on Nelchina bulls and will deploy 10 more in November 2012. The have 5 satellite
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 16 of 29
collars on Delta bulls and will deploy 5 more in October 2012. He said that they have 80
Nelchina females collared and 40 Delta females collared. He said that the numbers are in the
newest version of the PSP and should address BLM’s comments.
Mark said that ADF&G has been issuing more hunting permits for the Nelchina herd because
ADF&G is concerned about the population getting too large.
Kim said that they started marking bulls with collars equipped with orange color and numbers.
She encouraged other field crews to report back if they are seeing collared moose.
Mark said that he had talked with the ADF&G biometrician and he thinks that they may be able
to use bear transect data to estimate population size using a new model just developed. He
said that this would be worth discussing more with Earl Becker (ADF&G) to figure out what the
existing data can do for the Project. He said that there may be other density modeling by
habitat type that could be done using the existing transect data and reanalyzing the data.
Sarah said that she had not looked over the updated study plan, but most of BLM’s questions
were related to study details and transparency. She said that she would not mind going over
BLM’s questions with ADF&G. She said that she would like to look over the PSP before planning
a meeting. Mark said that the methods have changed a bit. Sarah said that overall she did not
have any big issues.
Wayne said that the adjustments to the study plans sound sensible and that the Project Team
would try to pass this information on so that it is understood. David said that the ILP addresses
changes to study plans. He said that the risk is that agencies might not agree with the changes;
however, the end of year reports could reconcile differences.
Brian asked whether there were questions or concerns on the DNA and stable isotope study for
bears downstream. Mark said that he thought that ADF&G and AEA were on the same page on
the study methods.
Jan asked whether the surveys of bear population downstream would go up the tributaries.
Brian said that the intent is to go upstream to look for bears in all stream drainages that are
known to be anadromous fish spawning streams.
Dall’s Sheep Distribution, Abundance, and Habitat Use
Brian summarized the objectives for the Dall’s sheep study. He said that the primary concern
was acquiring adequate information on sheep numbers and summer range use north and south
of the reservoir. He said that there was no indication that sheep are crossing the river in the
area of the proposed inundation zone, but that the potential effects of the Project on mineral
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 17 of 29
lick use by sheep and increases in human harvest would be issues. There are mineral licks near
Jay Creek (just above the proposed reservoir level) and upper Watana Creek (away from the
reservoir zone). He said that the potential for increased predation by coyotes may become
another issue affecting the sheep population, which is one area of focus for the terrestrial
furbearer study.
Brian summarized the study area. He said that the map in the PSP needs to be revised to not go
as far south and to include areas near access corridors north of the Susitna. Mark said that it
makes sense to include the access corridors. Kim said that ADF&G does not survey for sheep,
but that they could.
Brian summarized the Dall’s sheep study methods. He said that there was a newer survey
method that the National Park Service uses, but there are flight safety issues with that method,
so the aerial survey method traditionally used by ADF&G will be used.
Brian summarized the expected results of the Dall’s sheep study and the activities that would
be completed in 2012, which include analysis of existing data from ADF&G and a site visit to the
mineral licks to inform study planning for 2013/14.
Brian summarized the Dall’s sheep discussion points. David asked whether ADF&G was
satisfied with the methods. Mark said that ADF&G wants to look at the study plan more
closely. Brian said that the study area map needs to be updated.
Wolverine Distribution and Abundance/Terrestrial Furbearer Abundance and Habitat Use/
Aquatic Furbearer Abundance and Habitat Use
Brian summarized the wolverine study methods. He said that the wolverine, terrestrial
furbearer, and aquatic furbearer studies all rely on track surveys in the winter to various
extents.
Brian summarized the terrestrial furbearer study objectives. He said that the study would be
conducted on the ground using DNA sampling of scats and hair samples and capture-mark-
recapture methods.
Brian summarized the aquatic furbearers study objectives. He said that beavers are important
to understand because of their impacts on riparian, lacustrine, and fish habitats. He said that
surveys would be conducted downstream to Talkeetna to determine use of the middle and
upper river reaches. He said that they might be able to gather river otter information during
the winter from low-altitude helicopter surveys. He said that they would be comparing
furbearer populations in the Susitna mainstem to the tributaries to provide background
information for the study of potential bioaccumulation of mercury in fish. He said that review
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 18 of 29
of information on the food habits and diets of aquatic furbearers would inform the mercury
study.
Brian summarized the wolverine study area. He said that quadrats would be sampled to look
for tracks as part of the sample-unit probability estimator (SUPE) survey technique.
Brian summarized the terrestrial furbearers study area as a 6.2 mile buffer around the Project
area.
Brian summarized the aquatic furbearers study area. He said that it would target streams and
waterbodies in Project area footprint, as well as riparian areas downstream.
Brian summarized the methods, expected results, and study interrelationships of the wolverine
and terrestrial and aquatic furbearer studies.
Brian summarized the discussion points of the wolverine and terrestrial and aquatic furbearer
studies. He said that the SUPE survey approach was dropped for wolves but would be used for
the wolverine survey. He said that the ADF&G comments were addressed. He said that the
most discussion is needed on the aquatic furbearer study plan because USFWS requested the
study.
Mark said that he talked with Howard Golden at ADF&G about aquatic furbearers. He said that
they were concerned with how muskrats and mink would be surveyed. He described a survey
method (used by Herrington, Herrington, and McDonald) that employs floating structures on
water to record tracks of mink. He said that this might be a better method for surveying
aquatic furbearers. Mark said that he would forward the scientific journal article to Brian.
Mark said that Howard Golden has spent a lot of time studying river otters. He said that just
surveying latrine sites (also called spraints) should give a good indication of the number of
otters in the area. Mark said that the Team would need to select the creek and then survey
latrine sites. He said that hair snares employing roughened wire cables and DNA analysis would
give the Project a way to estimate the baseline population without collecting animals.
David asked whether there was a need to do the mercury analysis (which is the subject of
another study to be discussed separately on Friday, August 17). Mark said that ADF&G
understands USFWS’s concerns about mercury. He said ADF&G had not thought about it in the
beginning, but now they agree with conducting a risk assessment for mercury bioaccumulation.
Mark said that ADF&G is also interested in abundance information to determine impacts. Brian
said that they previously discussed where surveys should be conducted. Brian asked whether
they needed a population estimate. Mark said it might not be needed.
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 19 of 29
Mark said that ADF&G had comments on the wolverine study. He said that the Region 4
biologist consulted with Howard Golden and Todd Rinaldi to determine how the study could
address the winter distribution of wolverines. He said that ADF&G questioned whether the
study would be able to determine winter habitat without more survey work. He said that just
because an animal is passing through an area doesn’t mean it is winter habitat. Mark asked
whether determining winter habitat was needed.
Mark said that the study plan says sampling would be done in 25 square mile blocks, but it
should be 25 square kilometers instead. He said that there might not be wolverines in the
mountainous area in the winter. He said each of the blocks should be 25 square kilometers and
that the Team might want to change the study area boundaries to reduce the potential error
from boundary effects caused by wolverines moving out of survey blocks and entering others.
He said that some areas should be added to square up the study area. Mark said that the Team
might want to talk with Earl Becker (ADF&G biometrician) to figure out how to deal with
animals leaving and entering the study area. He said that ADF&G would be willing to consult on
this in more detail.
David said that he thought there were more comments related to terrestrial furbearers. Mark
said that ADF&G had not been able to get back into it and that it may still have issues. Brian
said that they would talk with ADF&G about additional comments.
David said that BLM requested additional spring surveys of beavers to assess overwinter
survival. Brian said that the study plan accommodated BLM’s comments, but that clacuating
exact population estimates would not be possible. Mark said that Howard Golden did not think
that you could figure out exact population numbers for survival estimates, but that the survival
of individual colony locations could be assessed.
Population Ecology of Willow Ptarmigan
Brian summarized the objectives of the Willow Ptarmigan study. He said that ptarmigan were
the primary small game bird in the Project area and surrounding region.
Brian summarized the ptarmigan study area and described the capture sites and alternative
capture sites that have been proposed by ADF&G.
Brian summarized the ptarmigan study methods, expected results, and the 2012 study
activities.
Brian summarized the Willow Ptarmigan discussion points. He said that most comments on the
study were from BLM, and some generic Department of Interior comments were received. He
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 20 of 29
said that BLM comments were on the study request. Terry said that the Migratory Bird Treaty
Act applies to resident and migratory birds but not to invasives.
In response to BLM questions on the study request, Mark said that ADF&G would determine
age and sex of the animals captured. He said that they did start an effort in 2011 and have192
wings from birds taken in Game Management Unit 13. He said the question is whether the
Project area is serving as a refugium for ptarmigan and whether increased access would affect
the bird population by improving hunter access. He said that right now the Project is looking at
3 capture sites north and 3 capture sites south of the impoundment zone. He said that
deploying additional radio transmitters to increase sample size could be a problem because of
the number of radio transmitters already operating on the frequencies that would need to be
used. He said that the question of using different pulse patterns to differentiate radio-tag
frequencies is difficult because it has never been done with ptarmigan and could be risky for
getting the study done. He said that they would have to shorten the life cycle of the collars if
sample sizes were increased further. He said that if BLM has questions on the analytical models
proposed for use, then perhaps Mark Lindberg at UAF could discuss those in more detail. Kirby
said that we need to get with ADF&G to determine whether study area changes are needed and
with BLM to see whether their comments have been addressed. Mark said that there is doubt
that there is ptarmigan habitat in some of the access corridors. He said that ADF&G has a lot of
management interest in ptarmigan.
Brian said that this is a remote area and that there could be secondary effects with increased
access to the Project area. Wayne said that this is a State issue to be worked out with DOT&PF,
ADF&G, and other State entities.
Wildlife Habitat Evaluation Study
Brian summarized the goals of the wildlife habitat-evaluation study. He said that AEA would be
collecting information on habitat use for all the wildlife species observed. He said it is likely,
based on other work in Alaska, that there would be at least two dozen habitat types. He said
that a matrix would be generated indicating the categorical rankings for each wildlife species or
group and each mapped habitat type. He said that they might not have project-specific
information for every species (e.g., some mammals are rarely observed), but the study would
use the best available data. The protocol would be to use project-specific habitat-use data first
and then seek habitat-use information in the scientific literature (published and unpublished)
for those species for which there are few observations. He said then they would use the
wildlife habitat mapping to depict geographically the high-value habitats for various species in
different seasons in the Project area. He said that the habitat evaluation study would facilitate
a determination of which habitats would be affected by the Project and how many acres of
each would be affected.
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 21 of 29
Brian indicated that the study area for the wildlife habitat evaluation was a 5-mile buffer
around the Project area. This is the same study area to be used in the wildlife habitat mapping
study (see below).
Brian summarized the methods that would be used to evaluate wildlife habitat use. He said
that they would select for analysis: bird species of conservation concern (based on the MOU
between FERC and USFWS), birds and mammals that are of concern for subsistence and sport
hunting in Alaska, species of management concern in the state, and species that play important
ecological roles.
Brian summarized the expected results of the wildlife habitat evaluation study.
Brian summarized the 2012 activities for wildlife surveys (which would serve as data sources for
the habitat evaluation study). He said that the historical (1980s) vegetation mapping had been
acquired from ADF&G and had been pulled into GIS. This mapping would be used to help
allocate study plots for some wildlife studies by habitat type. He said some fieldwork had been
initiated (e.g., raptor surveys).
Brian summarized the discussion points for the wildlife habitat evaluation. He said, following
up on comments by ADF&G, that the study team would investigate the Alaska Gap Analysis
Project (GAP) as a source of data on habitat use for the Project area.
David said that quantifying impacts on a habitat basis could help with understanding the
significance of the Project impacts in a regional context. He said that the GAP data might be
able to help. Terry said it is likely they study team could use the Alaska GAP data to do assess
affects at a regional or statewide scale, but probably would have to rely on finer scale local
mapping from the vegetation and wildlife habitat mapping study (see below) to assess local-
scale impacts. David asked about the State’s management concern. Terry said that it varies by
species.
Catherine asked why the Project was waiting until 2013 for determine which species to analyze
in the evaluation. Terry said that it was likely just scheduled to coincide with the point at which
the study team would have a fair amount of habitat mapping completed. He said that the
species could be selected before 2013. Catherine said that USFWS would like the species
selection completed early enough to understand what habitat types are important to map. She
said species should be selected soon and identified in the study plan so that something isn’t
missed. Mark said that game species were left out because they are managed separately.
Brian said that they needed to determine which species have bag limits. Catherine said that if
species could not be identified, it would be good to understand what group of species would be
analyzed. Brian said that the FERC/USFWS MOU for birds would provide some direction. Mark
said that ADF&G would need to come up with priority species.
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 22 of 29
Wildlife Harvest Analysis
Brian summarized the objectives of the wildlife harvest analysis. He said that the work would
be based on information provided to the State by hunters and trappers in harvest reports;
however, there are big holes in the data. He said that there are concerns about the
completeness of the data. He said that the data would be fed into the recreation study and
potentially into the subsistence study for the Project. He said that analysis of harvest data will
help to identify potential changes in harvest after construction.
Brian summarized the study area. He said that it was primarily Game Management Area 13E
but also includes surrounding management units. Jan asked whether the data shows where the
animal was harvested. Brian said that it isn’t always reported.
Brian summarized the expected results of the wildlife harvest analysis. Catherine asked
whether information on ptarmigan was provided. Mark said that there isn’t much information
on ptarmigan harvest. He said that there is some from the last season, but not many details.
Brian said that information is related to the species harvested, the level of hunting effort, and
the success of the effort.
Brian summarized the discussion points of the Wildlife Harvest Analysis.
Little Brown Bat Distribution and Habitat Use and Small Mammal Species Composition and
Habitat Use
Brian summarized the objectives of the little brown bat study and the small mammals study.
He said that studying the bat was of interest because of white-nose syndrome, a fungal
infection that has affected the little brown bat population in the northeastern United States.
He said that the study would generally look at forested areas because the bat isn’t a tundra
species. He said that they can roost in caves and rock crevices. He said that the cultural
resource survey might help to determine roosting areas in human dwellings.
Brian summarized the bat and small mammal study area, which would include the reservoir
zone and Project infrastructure area.
Brian summarized the bat study methodology, which can detect other bat species if they are
present in the study area. He said that the area would be surveyed between May and October.
He said that they would attempt to locate hibernacula, but they might have to infer this
because these areas have not been found in Alaska. He said that, in addition to the more
common species of rodents and shrews, the small mammal survey would be looking for the
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 23 of 29
Alaska tiny shrew, which is a species of concern for BLM, to get a better handle on whether this
species would be directly impacted by the Project.
Brian summarized the expected results of the bat and small mammal studies.
Brian summarized the 2012 activities, which are limited to estimation of snowshoe hare and
vole population indices, beginning in August 2012 for the terrestrial furbearer study.
Brian summarized the bat and small mammal studies discussion points. He said that the Project
team needed to consult with Dave Tessler at ADF&G to make sure that he is comfortable with
methods.
Brian said that they had tried to address BLM comments regarding the access and transmission
corridors by proposing to study those areas, but that the collision risk for bats at transmission
lines is slight. Sarah said that she would get back with Brian to make sure that BLM’s issues
were addressed.
Botanical Proposed Study Plans
Vegetation and Wildlife Habitat Mapping
Terry summarized the vegetation and wildlife habitat mapping goals and objectives. He said
that the mapping data will facilitate quantitative assessments of impacts on vegetation and
habitats for a set of bird and mammal species of concern.
Catherine asked whether operational impacts would be addressed. Terry said that operational
impacts would be addressed through analyses of potential habitat alterations in areas adjacent
to project infrastructure, but that most of the operational impacts would occur downstream of
the dam, and those impacts would be addressed in the riparian successional vegetation study.
He said that it would be difficult to use the 1980s vegetation map polygons in the current
mapping of vegetation and habitats (because the 1980s map polygons are based on old
imagery), but the study team would try to determine the usefulness of the previous mapping in
facilitating the current mapping study.
Terry summarized the vegetation and wildlife habitat mapping methods. He said that the study
team would identify the aerial photo signatures on current high-resolution imagery by
collecting ground reference data for each photosignature. He said that variability in
photosigntures would be addressed by collecting field data at multiple plots in each
photosignature type and by collecting field data throughout the mapping area.
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 24 of 29
David asked whether the work would consider age and percent cover. Terry said that they
would first map everything to Veireck level IV vegetation type, which entails collecting data on
percent cover. Data on forest age would be obtained in the timber volume work, which is likely
to be a separate study (see below).
Bob Henszey (USFWS) asked whether soils and hydrology information would be collected at
each site. Terry said that soils and hydrology information would be collected at each field
ground-reference plot because the field effort the wetlands mapping study (which requires
field data on soils and hydrology) is being combined with the field effort for the vegetation and
habitat mapping study.
Terry summarized the study area. He said that it would be a 5 mile buffer around the proposed
Project components. He said that this is a big area that goes way beyond the Project effects.
Kirby asked whether the study area needed to be that large. Wayne said that this is typical for
FERC Projects. David said that he could not remember seeing a mapping study area this large.
David said that it was good, however, because there would be comparable data to use for all
wildlife topics. Wayne said that AEA wants to do the right thing and use common sense and
that the study area could change as more information is collected in the field. Terry said that
the larger study area would help in placing the impacts to vegetation and wildlife habitats in a
regional context.
Terry summarized the 2012 activities. He said that approximately 250 ground-reference plots
had been surveyed and some additional vegetation verification plots as well. He said that some
mapping would be completed this fall and winter.
Terry summarized the discussion points for the vegetation and wildlife habitat mapping study
plan. He said that the timber volume determination (for areas to be cleared of vegetation
during construction) was not included in the proposed study plan and may need to be a
separate study. Wayne asked who and why there was interest in a timber volume assessment.
Terry said that it was a Department of Interior and BLM study plan comment. Betsy said that
there is a big area of BLM land in the inundation zone. Sarah said that she would provide more
information.
Ben Seifert (BLM) said that BLM requires a timber volume assessment to determine
compensation to BLM for timber take on their lands. Wayne asked whether a separate study
was needed. Terry said it is likely that a study of timber volume would need to be separate
from the study of vegetation and wildlife habitats because a timber volume study would
require intensive field data to be collected only in forested habitats. In contrast, the field
studies for vegetation and habitat mapping are focused on surveying all habitat types, forested
or not, and that collecting detailed data in forest habitats would slow down the study of
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 25 of 29
vegetation and habitats. Ben said that he would like to be involved in the discussion of the
forest volume study plan.
Terry said that the USFWS requested a comparative analysis of changes in vegetation (1980s to
current). He said that it could be done, but the scale of the analysis would need to be changed
(likely made broader with more generalized vegetation types) to make valid comparison to the
1980s mapping, and there would be comparison concerns given the differences in the
vegetation classifications used. He said that there needs to be more discussion with USFWS to
determine whether a change analysis is feasible and to determine the rationale for that
analysis. Bob said that he thought that the analysis was requested to determine the rate of
change in plant communities. Bob said that he would look at the comment because it wasn’t
meant to be burdensome.
Jan asked how is AEA was going to make a decision about whether the inundation zone would
be cleared, inundated, or both without doing studies. Wayne said that AEA was not sure that
timber harvesting would be economical. He said that AEA would need to do a cost-benefit
analysis as well as a study of the effect of decay in the inundation zone to determine what
would be done. He said that there would be more discussion about the inundation zone. Jan
asked whether there would there be a separate study to make the decision. Wayne said that
AEA would use information from a variety of studies. Wayne said that the engineers don’t think
that they need to clear the reservoir area, but AEA would be looking at other projects in
northern areas to determine the best method.
David asked about USFWS’s comment regarding minimum mapping sizes. Bob said that he
didn’t remember that detail, but he thought that waterbodies were to be mapped to 0.5 acres
and other vegetation types to 1.0 acre. [The numbers in the study plan are 0.25 acres for
waterbodies and 1.0 acre for other vegetation types.] Terry said that they typically map
wetlands at a finer scale in areas where there would be direct impacts (e.g., in the inundation
zone and areas where fill or physical disturbance would occur).
Wetland Mapping Study
Terry summarized the wetland mapping study’s goals and object ives. He said that in the area
downstream of the proposed dam, wetlands would be mapped (in the riparian study, see
below), but that wetlands determinations would not be completed. He said this approach was
agreed to in meetings with ABR, AEA, USFWS, Environmental Protection Agency (EPA), and U.S.
Army Corps of Engineers (USACE). He noted that a series of meetings with these agencies had
been conducted to determine the wetlands mapping and functional assessment methods to be
used for the Project.
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 26 of 29
Terry said that they would be using a method that combines several wetland assessment
elements including the Cook Inlet basin wetland methodology. He said that the wetland
functions to be assessed would be specific to the region and the remote and relatively
undisturbed environment.
Terry summarized the wetland study area, which would be a two-mile buffer around the
Project components. Catherine asked whether the study area would be two miles outside the
100-year flood limits. Terry said that the study area buffer for wetlands would be around the
Project components including the inundation zone. Terry said not all areas to be mapped were
within the active floodplain. The 100-year flood limit applies to the riparian study area (see
below).
Jan asked why the wetland mapping ended at Gold Creek. Terry said that there was overlap
between the wetlands mapping effort and the riparian vegetation mapping effort. Wetlands
would be mapped (in the riparian study, see below) downstream of Gold Creek, but the
wetland mapping study is focused on those wetlands that would be affected by fill, disturbance,
or inundation by the reservoir. He said that the USACE stated that they only need to see
wetlands mapped in the area where direct fill is proposed.
Terry summarized the 2012 wetland mapping activities, which involved both field surveys and
GIS work in the office. As noted above, Terry said that approximately 250 ground-reference
plots had been surveyed (field data for vegetation, wildlife habitats, and wetlands are collected
simultaneously) and some additional vegetation verification plots were surveyed as well. He
said that some wetlands mapping would be completed this fall and winter.
Terry summarized the wetland mapping discussion topics. David said that FERC would like to
see all the issues that are listed addressed in the final Revised Study Plan. Specifically, a final
decision must be made on the wetland functions to be assessed.
Riparian Vegetation Study
Terry summarized the goals and objectives of the riparian vegetation study. He said that data
on riparian vegetation and wildlife habitats downstream of the dam site would be collected in
the field. He said that the study team would first map riparian ecotypes, wetlands, and wildlife
habitats, and then determine possible changes in these resources with changes in stream flow,
ice processes, and fluvial geomorphology.
Mark said that ADF&G had some questions related to aquatic furbearers and changes water
flow. Mark said spring flooding could result in suitable habitat. He said that if furbearers lose
that habitat because of project operations (reduced spring flows), the species could be affected
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 27 of 29
and those potential impacts would need to be understood. Brian said that the instream flow
study and the riparian habitat study would help answer the aquatic furbearer habitat question.
Bob asked how much overlap there would be between the riparian vegetation data collection
and the instream flow study. He said that he wanted to make sure that the two teams worked
together to collect all the needed information. Terry said that the instream flow and riparian
vegetation team leads were in the field together this year (sampling simultaneously), and that
they have been coordinating closely throughout the study plan phase, so the needed data
should be acquired for both studies.
Terry summarized the riparian study’s relationship to other studies.
Terry summarized the riparian mapping methods. He said that the proposed methods were
similar to the wildlife habitats mapping methods. He said that successional vegetation
information would be collected to determine riparian ecotypes at a finer scale than would be
used for the mapping of wildlife habitats.
Terry summarized the riparian study area. He said that they estimate that mapping will be
completed downstream of the dam to mouth of the Susitna River; however, the study area
length depends on the findings of the instream flow study. He said that they needed to work
with the instream flow researchers to make a determination of where flow effects of the
Project would be overridden by the tides or flow from other tributaries.
Terry summarized the riparian study’s 2012 activities, which involved both field surveys and GIS
work in the office.
Terry summarized the riparian study’s discussion points. He said that the width of the riparian
study was originally proposed as the 100-year flood limit plus a buffer. He said that buffer size
had not been determined and the issue should be discussed. Bob suggested an elevational
distance in some areas, particularly in the canyon areas. Terry said an elevational buffer could
be used and that made more sense than a horizontal distance buffer. He noted that the other
issue to solve is whether to use the 100-year or 50-year flood limits. Bob said that it might be
better to look in the field to determine the area. David said that the geomorphology
information could help determine the study area. Betsy added that the ice processes should be
considered. Terry said that AEA knows this is a big issue and that they selected the 100-year
limit because it would provide the widest study area in which flooding can occur currently (the
Project would result in reduced flooding with concomitant changes in riparian vegetation).
Wayne said that there was a flood on Gold Creek in 2012 that could help to determine the
study area.
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 28 of 29
David asked when the length of the study area downstream would be determined. Terry said
that the riparian vegetation team and the botanical lead need to meet with the instream flow
and fluvial geomorphology teams to determine the appropriate length for the riparian study
area using data collected in 2012.
Betsy said that the study area might be changed after the 2013 field effort. David said that a
phased approach could be used to determine the study area. He said that the phased approach
or path would just need to be defined and documented in the study plan for FERC to accept it.
Wayne said that AEA would be doing a climate change study to the dam site as a part of the
agreement that they have with DGGS and UAF. He strongly discouraged using climate change
as a driver (e.g., there might be larger 100-year floods with climate warming) to determine the
study area size for the riparian study. He said that the climate change study would be
independent study.
Rare Plant Study
Terry summarized the goals and objectives of the rare plant study. He said that the study team
would be looking for species tracked by the Alaska Natural Heritage Program. He said that the
surveys would be focused in areas that would be directly affected by the Project (e.g., fill for
roads and pads, disturbance in areas adjacent to Project infrastructure, and the reservoir area).
Terry summarized the rare plant study area, methods, and expected results.
Invasive Plant Study
Terry summarized the goal and objectives of the invasive plant study. He said that the study
team would survey disturbed sites within the Project area and would survey also along
highways and other disturbed sites near the Project area, which could serve as sources of
invasive plant seeds or propagules.
Terry summarized invasive plant study methods and expected results. Bob said that the study
team should not discount the lack of comments on the invasive species study because USFWS is
very interested in the invasive plant study. He said that he thought that the study covers
USFWS’s interest well, and that AEA and USFWS are close to agreement there.
Bob said that other nonnative species (which may not be invasive) should also be recorded in
the study. Terry said that the study team planned to record all nonnative species, whether
invasive or not.
Follow-up and Study Plan Revisions
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 29 of 29
Terry said that the key element to coming to agreement on the wildlife and botanical study
plans is to schedule additional small-group meetings in September 2012 to resolve the set of
concerns that need further discussion. He said that focused meetings with key people from key
agencies will be important and that with small groups the meetings can be more productive.
Betsy said that they might need to Doodle-poll key agency staff to determine availability, and
then announce the meeting time to everyone that might want to participate so as to not leave
any licensing participants out of the process.
David said that FERC wants to get all the wildlife and botanical issues resolved soon so that
there would not be a need for any additional comments on the RSP in October 2012.
Action Items
1. Eagles and Raptors Study needs further discussion with USFWS regarding small raptor
species and cavity-nesting owls regarding the survey area and survey methods for other
species of raptors is needed; Brian and Maureen to plan a meeting, hopefully by early
September, with Jordan Muir, who issues USFWS eagle take permits.
2. Waterbird study needs further discussion with USFWS regarding spacing of transects
and the 15 mile buffer recommendation, along with intensity of the migration survey
(and timing for seaducks) needs further discussion to make sure the study is not missing
migration peaks
3. Landbird and Shorebirds study needs further discussion regarding rationale for locating
“study plots” in Denali National Park and the Copper River Basi n needs to be discussed
in detail along with overwintering bird methods and appropriateness of mist netting.
4. Caribou study needs further discussion with Earl Becker (ADF&G) to figure out what the
existing data can do for the Project, there may be other density modeling techniques to
use.
5. Dahl Sheep study map needs updating.
6. For aquatic furbearer study follow up with Mark Burch on idea of using floating
structures on water to record tracks of mink.
7. Wolverine study needs follow up with Earl Becker (ADF&G biometrician) to figure out
how to deal with animals leaving and entering the study area.
8. For little brown bat and small mammal studies, follow up with Dave Tessler at ADF&G to
make sure that he is comfortable with methods.
9. Wetlands Mapping Study needs follow up consultation to make a final decision on the
wetland functions to be assessed.
Meeting Summary: ILP Formal Study Plan Meeting for Terrestrial Resources
Susitna-Watana Hydroelectric Project
August 9, 2012 8:30 a.m. – 4:00 p.m.
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 30 of 29
10. Riparian study needs to outline any phased approaches with regard to expanding the
study area in the future.
1
Meeting Summary
Susitna-Watana Hydroelectric Project Licensing
Technical Workgroup Meetings
August 15-17, 2012
AEA Project Offices, First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
ILP Formal Study Plan Meeting for Fisheries and Beluga Whale
Resources, August 15, 2012, 8:30 am – 4:00 pm
Attendees:
Organization Name
AEA Betsy McGregor
AEA Wayne Dyok
USFWS Mike Buntjer
USFWS Betsy McCracken
USFWS Jennifer Spegun (by phone)
USFWS Bob Henszey (by phone)
ADNR Kim Sager
ADNR OPMP Marie Steele
NMFS Eric Rothwell
NMFS Mandi Migura (by phone)
NMFS Kate Wynne
EPA Jennifer Curtis (by phone)
ADF&G Richard Yanusz
ADF&G Joe Klein
ADF&G Mark Burtch
ADF&G Kim King
ADF&G Bob Small
ADF&G Stormy Haught
NMFS Ed Meyer (by phone)
FERC David Turner (by phone)
FERC Matt Cutlip
LBG/FERC Contractor Fred Winchell
Natural Heritage Institute/Hydropower Reform Coalition Jan Konigsburg
Long View Associates Steve Padula
Long View Associates Cory Warnock
Van Ness Feldman Matt Love
MWH Kirby Gilbert (by phone)
HDR James Brady
HDR Michael Barclay (by phone)
R2 Resource Consultants Dani Evenson
R2 Resource Consultants MaryLouise Keefe
R2 Resource Consultants Phil Hilgert
2
Organization Name
Tetra Tech Bill Fullerton
R2 Resource Consultants Tim Nightingale
GW Scientific Michael Lilly
Stillwater Sciences Dirk Pedersen
Stillwater Sciences Jay Stallman
LGL Michael Link
ARRI Jeff Davis
Alaska Ratepayers Scott Crowther
R2 Resource Consultants Alan Olson (by phone)
Introduction
Steve Padula opened the meeting and explained that the intent of this meeting was to discuss the
fisheries and beluga whale studies that have been proposed and to have substantive discussions
related to any remaining misunderstandings or inconsistencies. Steve went through a few slides
reminding everyone about the formal study planning process, current status, and associated
deadlines. He noted that another set of TWG meetings is scheduled after the October 15 due
date for filing comments on the Proposed Study Plan (PSP) to address any remaining issues.
Action Item. Steve stated that the agenda, meeting minutes and all presentations given during
the day would be made available on the AEA website. Introductions were held.
Jeff Davis (ARRI) requested clarification as to whether technical work groups had been set-up
and if so, who the representatives were. Steve clarified that the members of this meeting were
the TWG and depending on the outstanding technical issues, there was potential for smaller
groups to meet at a later date. Jeff inquired as to how the smaller groups would be selected.
Steve stated smaller discussions would be convened based on specific subject matter that would
be identified in the agendas so that appropriate individuals could participate. Wayne Dyok
(AEA) added that he wants to see an open and honest discussion to resolve issues and that it was
AEA’s desire to develop a good study plan to support development of a license application for
FERC.
Jeff stated that the study plans were vague and inquired if additional detail would be added and
whether another review period would take place. Steve stated that the Revised Study Plan (RSP)
is due on November 14th after which, the stakeholders will have 15 days to review and make
additional comments. FERC will then review the RSP and comments on the PSP/RSP and issue
its study plan determination. Steve added that it was AEA’s intent to continue to have
collaborative discussions throughout the duration of the study period. Wayne added that the next
three days of meetings are important to identify and hopefully resolve any outstanding issues.
Jeff asked whether there would be a QA/QC plan. Matt Cutlip (FERC) stated that there was
another stakeholder comment period of two weeks in late November prior to the study plan
determination being issued. David Turner (FERC) stated that it was important to use the next
three days to identify any differences so that by October 15th, the number of issues remaining is
3
as minimal as possible. That is FERC’s goal. Wayne reiterated AEA’s desire to make this a
collaborative process.
Eric Rothwell (NMFS) noted that the ILP timeline is inconsistent with AEA’s agreement to help
bring on a consulting team to assist the agencies.
Presentations
Steve went through a few slides reminding everyone about the formal study planning
process, current status, and associated deadlines.
STUDY PLAN PRESENTATIONS AND DISCUSSIONS
Mary Lou Keefe (R2 Resource Consultants) stated that there were a number of collaborators on
these studies and multiple people would be giving presentations. Time constraints on
presentations and the relative order were also discussed.
Characterization of Aquatic Habitats with Potential to be Affected by the Project
Mary Lou Keefe gave the Characterization of Aquatic Habitats with Potential to be Affected by
the Project presentation. Areas discussed included goals and objectives, study area, methods and
expected results.
Eric Rothwell asked how sampling structure detail would be determined, (substrate, channel
type, etc.). Mary Lou stated that multiple studies would be collecting this type of data. Eric
asked where all of the data would be collected for habitat typing. Mary Lou stated that habitat
typing was not one of the goals of this study but to the extent that supplemental habitat data
could be used, it would be. Phil Hilgert (R2 Resource Consultants) elaborated that it was a
matter of scale and that all of the habitat studies were linked.
Jeff Davis asked why the USFS methodology for the Tongass National Forest was selected for
this study. Mary Lou stated that through a series of TWG meetings, AEA had decided on this
methodology and that the protocol for this study is to look at riffles, runs and glides in
tributaries. She continued that this method is accepted widely and was previously agreed to. Jeff
asked if there was going to be a meeting in September to go over the methods. Phil stated that
AEA planned an internal meeting to verify that all the studies were appropriately coordinated.
Jeff asked what level of classification would be used on the videography work. Mary Lou stated
that there would be three different scales depending on the area of the river being analyzed. The
upper river would be classified by looking at variables to include riffle, run or glide along with
substrate and large wood debris. The lower river would include six or seven main habitat types
and the middle river would be a hybrid of the upper and lower river. Jeff asked if a Tier III
analysis would only be done on the tributaries. Mary Lou confirmed this and said some Tier III
work may be done on the upper river as well.
4
Jeff added that details related to methods for channel typing, substrate, sinuosity, etc. needed to
be more detailed. Mary Lou stated that some details are in the plans and that others are detailed
in the referenced methods. Jeff inquired specifically about channel typing methodology and
Mary Lou stated that finalizing this method would require further discussions with the
geomorphology folks after their field visits this summer. Matt Cutlip asked when that detail
would be provided. Mary Lou stated that that level of detail wouldn’t be available until after the
RSP. Wayne Dyok added that all questions related to detailed methods may not be able to be
addressed during these three days of meetings. Jeff stated that time was running out relative to
the ILP timeline and decisions and discussions need to happen. Eric Rothwell added that the
objectives of the studies were good but the actual details of some stakeholder requests were not
addressed in the plans.
Matt Cutlip stated that the level of detail being discussed was necessary for the RSP. Betsy
McGregor (AEA) stated that the geomorphology crew wants to do its fieldwork at a low flow in
September. Matt stated that that should be documented in the study plan and a schedule
discussing when habitat types will be final should be included as well.
Betsy McCracken stated that she has concerns about the Tier III methodology and shared
concerns regarding the lack of detail in the plans. She additionally wondered if some form of
hierarchical mapping method would occur. Mary Lou stated that the mapping will be done at a
reach level and that Bill Fullerton’s (Tetra Tech) work and 1980’s data will assist in determining
meso-habitat characteristics in the tributaries. Mary Lou asked the group to bring forth any other
suggested methods if they had them.
Joe Klein (ADFG) stated that additional detail was needed but that Tier III methodology was
appropriate and that it had been used in SE Alaska before. Jeff Davis stated that the habitat types
currently proposed don’t exist in the Susitna tributaries. Wayne stated that alternative
suggestions for methodology are encouraged. Mary Lou added that final habitat typing couldn’t
be detailed until reach breaks were established.
Mary Lou continued with the presentation noting that an additional habitat type had been
identified. “Pocket waters” was added to the classification system for tributaries to the upper
Susitna River. She stated that these were boulder gardens unique to this area. Eric Rothwell
asked if this new habitat type was due primarily to the nature of the substrate. James Brady
(HDR) and Mary Lou stated that this was correct. Joe Klein asked where this habitat type was
primarily located. James used Kosina Creek as an example.
Fish Distribution and Abundance in Upper, Middle and Lower Susitna River
Mary Lou and James Brady gave the Fish Distribution and Abundance in Upper, Middle and
Lower Susitna River presentation. Areas discussed included goals and objectives, study area,
methods and expected results.
A question was asked regarding the specific life stages being evaluated as part of this study.
Mary Lou stated that telemetry and tagging were going to be used to get movement data on
multiple life stages.
5
Mike Buntjer (USFWS) asked how much accessible habitat was available in the tributaries.
James displayed a slide showing the amount of accessible habitat in yellow.
A question was asked as to whether the entire eighteen miles of Kosina Creek was evaluated
during each survey. James confirmed this and stated that all of the fish were observed spawning
in a 1 ½ mile stretch of the creek. Betsy McCracken asked where radio tagged fish had been
found. Michael Link (LGL) stated that the table presented by James was consistent with their
findings.
Eric Rothwell asked about estimates for the Chinook run in the Susitna in 2012 relative to a
“normal” year. James stated that the 1980’s data indicated no fish in Kosina Creek. Mary Lou
added that you can’t say with any certainty that higher counts will occur in the tributary during
better Chinook years. Betsy McGregor pointed out that there were three impediments to passage
in Devils Canyon and Devils Creek was downstream of the 3rd impediment.
Richard Yanusz stated that escapement goals for the Susitna were defined over a twenty year
average and the 2012 run year was quite low. Michael Link stated that the run was about 25% to
50% of normal for the Susitna.
A general discussion related to James’s presentation was had relative to 60 mm juvenile
salmonids, their relative age and if juveniles of this size were going to be tagged. James stated
that they were not but site specific data related to their length and habitat utilization would be
taken. It will be stratified sampling on the meso-habitat level.
Jeff Davis asked if fish sampling efficiency was low in certain habitat types. James stated that it
was. Mary Lou then continued with the presentation.
Mike Buntjer inquired about the metrics that would be used to evaluate fish densities, sample
size and design. He added that general methods were lacking and he was unclear as to what the
actual sampling effort entailed. He stated that the winter timeframe is critical and little effort
appears to be placed during this time. Mike stated that it appeared nothing was being done for
the early life history of the fish (egg deposition to emergence). Mike stated that he didn’t see a
way to get from the existing baseline to defining conditions during load following operations
without this information.
Mary Lou stated that in general, she is hearing that the level of detail in the study plan isn’t
meeting stakeholder expectations.
Mary Lou stated that certain winter components will be addressed within the instream flow
study. Eric Rothwell stated that that was not discussed in the instream flow study plan. Mike
Buntjer asked if movement from tributaries to sloughs would be addressed. Mary Lou stated that
juvenile movement would be addressed via PIT tagging. Mike reiterated that 60 mm size fish
and smaller were the most critical life stage to assess for load following operations and that no
tag would work. Phil Hilgert stated that the instream flow study was looking at stranding and
trapping and that the model would also document egg incubation. Eric stated his concern that
the biological information needed to support that model isn’t going to be collected under the
current plan.
6
Mary Lou stated that monitoring 30 mm-60 mm fish is challenging and requested suggestions
from the stakeholders. Jeff Davis suggested sampling habitat multiple times. Mary Lou stated
that seasonal sampling was currently in the plan. Mike Buntjer stated that seasonal sampling was
not proposed in the winter. Mary Lou agreed that the stratification system needed to be made
clearer.
Mike inquired as to why winter work was limited to open leads. Mary Lou stated that a decision
was made based primarily on safety concerns. Mike stated that you can’t compare data from this
proposed approach with the 1980’s work and added that the current winter work proposed won’t
give you the juvenile information you need. He suggested placing minnow traps below the ice.
Jeff Davis agreed and stated that you can safely place minnow traps below the ice. Mary Lou
restated that safety was a primary concern. Matt Cutlip stated that if a suggestion is made by the
stakeholders that AEA chooses not to adopt, a justification must be given in the RSP.
Wayne Dyok confirmed that if an agreement on a certain issue isn’t reached, it will be included
in the RSP. He added that safety was a key issue on the mainstem but there was room to discuss
other methods in the sloughs. Wayne acknowledged that additional detail and discussion were
needed to address the winter work. Mike restated his concern regarding only sampling open
leads. Mary Lou stated that she understood additional detail was needed.
Jan Konigsberg (NHI/HRC) asked what would be done if winter baseline information couldn’t
be acquired and whether that would be specified in the RSP. Mary Lou stated that sampling is
limited and that fish presence tells you fish are there but lack of fish does not necessarily mean
they are not present. Mike Buntjer reiterated the importance of evaluating egg deposition to
emergence. Mary Lou stated that in June, it seemed the stakeholders were in agreement that
dealing with that life stage as part of the instream flow study was acceptable and now it appears
that isn’t the case. Mike stated that the instream flow plan was not clear as to how the juvenile
life state was being addressed. Action Item. Mary Lou suggested that the topic be revisited after
the instream flow presentation tomorrow.
Joe Klein stated that detail related to methods for shocking, specifically the inclusion of block
nets, needed to be added. Jeff Davis inquired about issues related to catch per unit effort,
whether data collection was repeatable and measure of error. He also inquired about mesh size
and types of nets to be used.
Mary Lou expressed some concern related to the time constraints of the meeting and whether all
topics could be discussed today. Wayne Dyok added that AEA wanted to hear all of these
comments and wants to work hard to address as many issues as possible by November 14.
Betsy McCracken asked whether the terrestrial study would evaluate the nutrients available to
bears. Betsy McGregor confirmed this. Mike Buntjer asked why, if you were collecting food
availability data, why you wouldn’t collect food use data. Mary Lou stated that it was being
addressed in the productivity study.
7
Salmon Escapement
Michael Link (LGL) gave the Salmon Escapement presentation. Areas discussed included goals
and objectives, study area, methods and expected results.
Eric Rothwell clarified that the median year lines associated with a hydrology figure in
Michael’s presentation could have significant daily fluctuations. Michael concurred.
Betsy McCracken inquired about the types of tags used on non-salmonids. Michael stated that
no non-salmonids were tagged.
Joe Klein asked if any netting was done as part of the 2012 work. Michael stated that it would
be discussed later in the presentation.
Jan Konigsberg asked why there was variation in catch when comparing the right and left banks.
Michael stated that analysis was ongoing and conclusions have not been reached yet.
An inquiry was made as to the flows in the Susitna when Chinook travelled upstream of Devils
Canyon. Michael stated that 12 fish moved above the third impediment between the morning of
the 17th and the 20th. Another group of 12 fish made it to the third impediment not long after but
fell back and never passed. The 12 fish that got upstream moved quickly and spent time in
various tributaries. Michael went on to say that he was unsure if the passage of the impediment
was flow dependent or simply a “push through” mentality but the flows at the time of passage
were onl y 1000 cfs above the record low median flow for that period. A question was asked if
there was any mainstem channel spawning observed. Michael stated that none was documented.
Eric asked what the spawning time period was for the middle and upper river. Michael stated
that it was almost over now but that there were still a few fish coming through that may spawn
later.
Jan Konigsberg asked if any tissue samples had been collected. Michael stated they none were
collected at the fish wheels. Some tissue samples were taken in the tributaries but sample
collection is hindered by the scarcity of fish. Betsy McCracken asked how old the existing
genetic data from the drainage was and where the fish were from. Michael stated that most of
the data was from the last decade and a majority of the fish were from Indian and Portage creeks.
Betsy McGregor stated that ADF&G has specific sampling goals for tributaries and the AEA
data would supplement that. Rich Yanusz stated that ADF&G had a grant to document the
systems and that numbers were currently insufficient to have a suitable sample size in 6 or 7
tributaries. Sample size is currently acceptable in 8 tributaries.
Jeff Davis inquired if Coho numbers were being underestimated by not assessing certain areas.
Michael stated that based on 1980’s data, Curry was chosen as the best capture site. Jeff asked if
receiver sites were evaluated for detection efficiency. Michael confirmed that they were. Jeff
asked how far tags could be picked up. Michael stated approximately ½ mile upstream and
8
downstream of the receiver and all the way across the river width. Betsy McCracken asked
whether assessments of areas downstream of Curry would be done as part of another study.
Mike Buntjer asked if habitat availability would be addressed. Phil Hilgert stated that it would
be addressed in the instream flow model.
Eulachon Distribution and Abundance
Mary Lou gave the Eulachon Distribution and Abundance presentation. Areas discussed
included goals and objectives, study area, methods and expected results.
Betsy McCracken asked if Didson work and target verification would be done at the same time.
James Brady stated that acoustics would be supplemented with netting, electrofishing, etc.
Density information will be collected. Wayne Dyok asked if Betsy was comfortable with the
direction of the study. Betsy said she might provide some follow-up at a later date.
Cook Inlet Beluga Whale
Mary Lou gave the Cook Inlet Beluga Whale presentation. Areas discussed included goals and
objectives, study area, methods and expected results. See the presentation on the AEA website.
Mandi Migura (NMFS) raised three issues that she felt hadn’t been addressed:
1. Are there any plans for assessing beluga presence during the over-winter months? She
presented passive acoustics as an option.
2. She stated that there was nothing currently in the study plan regarding use of the area by
reproducing females or calves. She stated that it is difficult to distinguish life stages from
the air and asked if any exploration had occurred into other potential methods.
3. She stated that the project has the potential to change habitat conditions at the river
mouth/delta and that this could have direct impacts on the feeding potential for belugas.
Kate Wynne (NMFS) stated that any project related impacts should be addressed as they relate to
belugas, not just the “significant impacts”.
Mandi asked if the beluga whale and habitat data will be used to assess impacts to fish. And if
so, it should be done in the opposite order. Betsy McGregor agreed that that portion of the plan
was poorly worded and it was going to be in the opposite order. Betsy went on to explain that
AEA’s beluga expert was not present but that it was her understanding that May and June were
selected as study months in an effort to focus on the calving period. Bob Small (ADF&G) stated
that year-round monitoring should be considered and that telemetry data shows that belugas use
the deltas in the winter. He stated that foraging behavior has been cited in data from work done
in the past 10 years as well.
Bob asked for clarification of the objective related to the 2 days of monthly aerial surveys. He
stated that you could get group size, distribution and presence/absence information from this data
but no population size. He additionally inquired as to why emphasis was being placed on all of
9
critical habitat area 1. Mary Lou asked if since AEA was only doing 2 days of aerial surveys,
should the survey area be narrowed down to just the mouth and delta to allow for more intensive
survey. Kate stated that her first impression that a survey of all of critical area 1 was not needed
but follow-up within her agency prior to a final recommendation would be needed.
Mandi stated that data suggests that calves are being produced in July as opposed to the
May/June timeframe currently proposed. She went on to question the viability of aerial surveys
for identifying calves. Bob suggested collecting supplemental observations opportunistically
from other flights using the area.
Bob recommended looking into passive acoustic monitoring as a potential methodology option
for the beluga work. He stated that ADF&G has successfully used it for the past 4 years. He
stated that it can be set up to process data as it is collected and they can run 24/7. He stated that
he would be willing to discuss this with AEA’s beluga specialist if adding it to the study plan
was an option. Michael Link stated that the primary issue with this approach in the Susitna Flats
was the possibility of false negatives. Bob stated that this approach would at least give you some
data in the winter but agreed it wouldn’t be 100% successful. He acknowledged that the amount
of time needed to post-process video and photo data is extensive and that this approach would be
more efficient. Michael reiterated that it wouldn’t be good to spend the time and money for
inconclusive data. Bob stated that you would need to get the baseline data to determine actual
feasibility.
Wayne Dyok asked if there were other alternatives for winter beside acoustics. Mandy stated
human observation in the winter isn’t reasonable due to safety issues and that acoustics was a
better choice in the winter. Wayne asked if there were any suggestions on defining criteria for
impacts. Mandy stated that a meeting with AEA’s specialist would be helpful. Bob stated that
the change in hydrology as a result of the project won’t likely impact the whales directly, but it
could impact their prey. He stated that the question is how and acknowledged that it may help
and it may hurt. Wayne stated that more discussion was needed.
Mary Lou stated that the May and June surveys were focused on the primary months that
eulachon would be in the river. Betsy McCracken stated that there should be additional surveys
in August and September to focus on prey as well. Mandy stated that data from NMFS’s survey
events would not be a quick turn around and if it was needed quickly, AEA may want to consider
an additional survey in August. She was not comfortable committing to an expedited analysis
period from NMFS personnel without discussion with them.
Future Reservoir Fish Community and Risk of Entrainment
Mary Lou gave the Future Reservoir Fish Community and Risk of Entrainment presentation.
Areas discussed included goals and objectives, study area, methods and expected results.
Wayne Dyok asked about the maximum elevation of the reservoir area displayed on the
presented map. Betsy McGregor stated that it was at 2200 feet, which depicted the planned
extent of the study area for resources adjacent to the proposed reservoir. Wayne stated that AEA
was continuing to evaluate the proposed maximum water surface elevation for the reservoir and
10
that currently it was anticipated that the maximum elevation would be 2050 feet. Joe Klein
asked if that would increase the drawdown. Wayne responded no and stated that AEA was still
refining the plan.
Jeff Davis asked if anyone had looked at shelf ice and its potential impact on fish in the littoral
zone. Mary Lou stated that it had not been brought up to date. Wayne stated that AEA reviewed
Williston Reservoir in the 1980s and it wasn’t an issue there. He asked if Jeff could cite some
examples where shelf ice was an issue. Action Item. Jeff stated he would find some references.
Jeff asked if sediment deposition and settling rate downstream of the dam would be looked at.
Wayne stated that it would be discussed on Friday and that it was considered in the 1980’s.
Jeff asked if smolt movement through still water habitats would be looked at. May Lou stated
that that would be part of the passage study.
Fish Passage Barriers in Middle/Upper Susitna River and Tributaries
Mary Lou gave the Fish Passage Barriers in Middle/Upper Susitna River and Tributaries
presentation. Areas discussed included goals and objectives, study area, methods and expected
results.
Jan Konigsberg asked if any assessment of barriers below Talkeetna would occur. Mary Lou
stated there was no assessment planned because it is assumed that the project will not create any
barriers and the instream flow study will identify additional need, if any. Jan stated that winter
fluctuations may create barriers and inquired if any work was planned. Mary Lou stated that the
hydrology has yet to be finalized and that if a need is apparent, the study plan will be amended.
Jeff Davis stated culverts should be evaluated and used the Twister Creek culvert as an example.
Jeff stated that these methods were working under the assumption that the bed elevations would
remain stable. He asked if elevation fluctuation and bed profile changes would be addressed.
Mary Lou stated that Bill Fullerton would address geomorphology issues on Friday.
Jeff stated that it appeared that all passage issues were focused on adult anadromous species and
there was no discussion of rainbow trout passage in the spring or juvenile sockeye movement
into side channels for rearing. Mary Lou stated that the intent of the passage work was not to be
life stage specific.
Michael Barclay (HDR) stated that the study was designed to collect the necessary information
to determine what effect a change in water surface elevation would have on depth and access.
Once that data is collected, you can apply it to the selected species and life stages to determine
level of impact. Jeff stated that he’d like to see all species included in the analysis. Additionally
he stated analysis of delay of access to river mouths, increased predation and stranding should be
looked at. Michael stated that some of this could be addressed by the instream flow study. Mary
Lou confirmed this.
11
Jeff asked if a change in turbidity occurred as a result of the project, would there be an impact on
out-migrating juveniles. Wayne stated that he is unsure if the water will be clear enough to
facilitate additional predation and that the water quality discussion on Thursday should be
helpful in answering this question.
Joe Klein stated that other life stages and timing should be included in the fish passage study.
Michael Barclay stated that the timing issue will be addressed in the hydraulic modeling.
Genetics Baseline for Selected Fish Species
Michael Link gave the Genetics Baseline for Selected Fish Species presentation. Areas
discussed included goals and objectives, study area, methods and expected results.
Mike Buntjer asked how many samples were needed to meet the study objectives. Michael
stated that about 200 were needed from each basin. Mary Lou stated that the methods AEA is
proposing will supplement the statewide database.
Mike Buntjer asked if out-migrant traps were an option in the upper river. Mary Lou confirmed
that they were an option but the trapping locations haven’t been determined. Additionally she
stated that there likely won’t be enough fish captured to determine the proportion that have come
from the upper river. Jeff Davis asked if AEA would know the proportion of upper river fish
that rear downstream of the impediments. Michael Link stated that information would not be
able to be determined. Betsy McCracken stated that the extent of genetic differentiation is
important to understand. Michael stated that he understood the concerns and some additional
detail could be added to the study plan to refine the document.
Jeff Davis asked if only Chinook were being evaluated. Michael Link confirmed this and stated
that there was no plan to evaluate any other species. He stated that samples from other species
would be collected but not analyzed. There is no baseline to work with for other species and a
large amount of gene flow occurs with sockeye. He stated there is very little site fidelity.
Mary Lou asked Jeff Davis to clarify an earlier statement related to fish rearing outside of the
middle reach. Jeff stated that he was referring to juveniles that moved downstream, out of the
middle reach and into tributaries to rear. Mary Lou asked Jeff why that couldn’t be addressed
using fish habitat availability information. Phil Hilgert stated that data is still being compiled
from the 1980’s and that sockeye were rearing in upland sloughs.
Michael Link made two clarifications to the flow chart he showed during the Salmon
Escapement presentation:
1. There was a large increase in flow in mid-June.
2. When the fish passed the 3rd impediment in Devils Canyon, they were within 1000 cfs of
the all-time low flow for that period.
Jeff Davis asked how that low flow related to movement of fish into other tributaries. Michael
stated that there was no obvious relationship.
12
Aquatic Resources Access/Transmission Alignment/Construction Area
Mary Lou gave the Aquatic Resources Access/Transmission Alignment/Construction Area
presentation. Areas discussed included goals and objectives, study area, methods and expected
results.
Eric Rothwell asked if there was any text discussing passage design at stream crossings. Mary
Lou stated that the standards were referred to in the study plan. Matt Cutlip stated that it was not
uncommon to discuss potential for evaluation of building crossings on fish. Mary Lou stated that
the state has criteria for passage at stream crossings and those are discussed in the plan. Stormy
Haught (ADF&G) stated that a fish habitat permit would be needed for each crossing. Eric
stated that NMFS has passage standards that must be met as well. Mary Lou stated that if
passage is needed, from a state perspective, it was her understanding that a bridge should be used
wherever possible. Stormy stated that wasn’t necessarily true. It is the preferred alternative but
not always the case. Mary Lou stated that the intent of the study is to identify areas where
impacts may result from stream crossings. Betsy McGregor elaborated by stating that this study
is the first step toward determining where the stream crossings will be and that there are
currently three road options that must be narrowed down to one.
Fish Harvest In and Downstream of Project Area
Mary Lou gave the Fish Harvest in and Downstream of Project Area presentation. Areas
discussed included goals and objectives, study area, methods and expected results.
Jeff Davis asked if the study took into account the ability to navigate the river during the spring
Chinook fishery. Mary Lou stated that the recreation study addresses that issue.
Fred Winchell (LBG) indicated that the potential for the project to impact the fishery is listed in
the plan. Fred stated that it would be useful to put together a table of how the studies are related
and how they work together to address the overall impacts. Mary Lou stated that that was a good
point but the intent of this study wasn’t to address changes to the fishery. Catch statistics from
ADF&G would be used. Dani Evenson (R2 Resource Consultants) confirmed this and stated
substantive harvest records and commercial data would also be used.
Joe Klein stated that effects of emergency closures should be included in the analysis. Action
Item. Dani stated that it will be added. Betsy McGregor stated that this data was being collected
to feed into the recreation and subsistence studies.
Jeff Davis asked if the ADF&G studies are to a scale so that they can be accurately utilized.
Dani stated that they were for broad-scale regions. Jeff Davis stated that new surveys could be
done. Dani stated that sometimes the state doesn’t like duplication of their effort.
River Productivity
Tim Nightingale gave the River Productivity presentation. Areas discussed included goals and
objectives, study area, methods and expected results.
Mike Buntjer inquired about the rationale for not having surrogate sites. Mary Lou stated that
they couldn’t find a comparable system and a literature review would allow a broader search.
13
Jeff Davis disagreed and stated that the Kenai may be comparable but he doubted it. He stated
that there aren’t other rivers like the Susitna so a literature search likely wouldn’t work. Mary
Lou stated that rivers outside Alaska may be relevant for a literature search. Jeff Davis asked
how that would be more comparable than the Talkeetna or the Chulitna rivers. Tim stated that
using the Talkeetna and Chulitna rivers as references was still an option. Joe Klein stated that a
literature review wouldn’t work and that a stream-based approach was needed.
Tim stated that there are a number of glacially fed rivers in Europe that would provide good
review material. Joe asked if some Alaska rivers may be assessed in addition to any literature
review. Tim stated that this was correct. Joe asked if an appropriate system was found in Alaska,
would the licensing period permit its analysis. Joe stated that he needed to put a bit of thought
into the current proposed process and potential alternatives. Mike Buntjer concurred with this
approach.
Jeff Davis stated that primary productivity should increase due to the project. He asked why
AEA was conducting this study by looking at periphyton. He suggested looking at primary
productivity, ecosystem production, dissolved oxygen in sloughs, etc. Mary Lou asked Jeff to
clarify if he thought AEA shouldn’t look at periphyton. Jeff stated no, but the other variables
should be looked at as well. Mary Lou asked when Jeff thought these variables should be
assessed. Action Item. Jeff stated that they should be looked at throughout the growing season
and asked if anyone else had brought this issue up and noted that there were references to this
methodology from Idaho that he could provide. Eric Rothwell and Mike Buntjer stated that no
one else had raised this issue.
Mary Lou acknowledged that if they modified the methods in accordance with Jeff’s suggestions
it would be a significant departure from what is currently being proposed. Action Item. She
suggested a smaller group meet to discuss further details. Joe Klein agreed with this approach
and requested that Jeff get everyone the references that he was referencing. Jeff stated that the
primary reference was from Snyder and the work was done on the Kootenai River.
Jeff asked how deep water would be sampled. Mary Lou stated that only wadable sections were
being assessed since the margins are the areas that will be most impacted by the project. Michael
Lilly (GW Scientific) stated that supporting fish data will assist in documenting areas for
sampling macroinvertebrates. Phil Hilgert added that bathymetry and the flow routing model
results will be available in December and they will know what to look for prior to heading out
into the field.
Jeff stated that the margins may or may not be more productive than deeper areas. Joe Klein
concurred that sampling of deeper areas should occur. Phil stated he has looked at similar
situations in Washington State and the margins that stay wetted tend to be the most productive.
Fish Passage Feasibility at Watana Dam
Mary Lou gave the Fish Passage Feasibility at Watana Dam presentation. Areas discussed
included goals and objectives, study area, methods and expected results.
14
Wayne Dyok stated that AEA has not decided at this time that fish passage will be needed and
that the results of the studies will drive this decision. Wayne asked for Ed Meyer’s (NMFS)
thoughts on the proposed study plan. Ed stated that the study plan seemed to cover everything
that was typically needed but that a bit more evaluation was needed. Wayne noted that Ed would
be participating in a site reconnaissance in September and that passage related efforts will
incorporate the results of other studies. Wayne stated that AEA is looking at the passage
evaluation effort as an iterative approach.
Steve Padula recapped the discussion from the meeting and stated that a series of small group
meetings would be planned once the next two days of meetings had taken place.
Mary Lou stated that AEA heard the feedback that the study plans are lacking detail in some
areas. She acknowledged that they aren’t to the point where field study could occur and they
won’t be there entirely by November due to how integrated some of the studies are. She stated,
for example, that Bill Fullerton’s work on habitat mapping will be completed in September and
is the first step in the habitat evaluation process.
Mary Lou stated that prior to the RSP, AEA will develop and incorporate a schedule/flow chart
showing how the integrated process will take place. Action Item. Wayne stated that the
stakeholders will see this in September. Mary Lou stated that in addition, AEA will define in the
RSP the process that will be used to get to the necessary detail. Betsy McGregor added that
wherever possible the additional detail requested will be included in the RSP.
Eric Rothwell asked if the ILP schedule can be extended to work through some of the issues.
Wayne stated that AEA needed to think about that and the preference would be to get things
done within the current timelines. Wayne stated that AEA was committed to a collaborative
process throughout and opportunities for input will be ongoing.
Marie Steel (ADNR OPMP) asked for an explanation of the process for dealing with ongoing
issues. Matt Cutlip stated that if additional details are not expected to be worked out until after
the RSP, a schedule must be presented in the study plans to deal with these issues. He also
requested periodic reporting. Steve state that the TWG would continue to exist past the RSP and
that AEA would keep the TWG up to date on progress of the study program and engage the
TWG in reviewing study reports. It will be an interactive and collaborative process throughout.
Wayne added that he believes there is value in having the stakeholders in the field periodically to
keep them involved.
Steve previewed the next two days of meetings prior to adjourning.
1
Meeting Summary
Susitna-Watana Hydroelectric Project Licensing
Technical Workgroup Meetings
August 15-17, 2012
AEA Project Offices, First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
ILP Formal Study Plan Meeting for IF, Riparian IFS, Groundwater,
Glacial Runoff, Geology/Soils, August 16, 2012, 9:00 am - 4:00 pm
Attendees:
Organization Name
AEA Betsy McGregor
AEA Wayne Dyok
AEA Bryan Carey
USFWS Mike Buntjer
USFWS Betsy McCracken
USFWS Bob Henszey
ADNR Kim Sager
ADNR Roy Ireland
ADNR OPMP Marie Steele
NMFS Eric Rothwell
ADF&G Joe Klein
ADF&G Stormy Haught (by phone)
USGS Dave Meyer
USGS Chris Holmquist-Johnson
Tribal Council Wilson Jastin
FERC Matt Cutlip
LBG/FERC Contractor Fred Winchell
Natural Heritage Institute/Hydropower Reform Coalition Jan Konigsberg
Long View Associates Steve Padula
Long View Associates Cory Warnock
Van Ness Feldman Matt Love
MWH Kirby Gilbert (by phone)
MWH Brian Sadden
HDR James Brady
R2 Resource Consultants Kevin Fetherston
R2 Resource Consultants MaryLouise Keefe
R2 Resource Consultants Phil Hilgert
R2 Resource Consultants Stuart Beck (by phone)
R2 Resource Consultants Dudley Reiser
Tetra Tech Bill Fullerton
Tetra Tech Mike Harvey (by phone)
University of Alaska Fairbanks Regina Hock (by phone)
Cardno Entrix Jim Gill
2
Organization Name
GW Scientific Michael Lilly
Stillwater Sciences Dirk Pedersen
Stillwater Sciences Jay Stallman
LGL Michael Link
URS Paul Dworian
ARRI Jeff Davis
Alaska Ratepayers Scott Crowther
Introduction
Steve Padula opened the meeting and explained that the intent of this meeting was to discuss the
Instream Flow, Groundwater, Glacial Runoff and Geology/Soils studies that have been proposed
and to have substantive discussions related to any remaining differences or inconsistencies. Steve
went through a few slides reminding everyone about the formal study planning process, current
status, and associated deadlines. (See the presentation on the AEA website.)
He noted that another set of TWG meetings is scheduled after the October 15 due date for filing
comments on the Proposed Study Plan (PSP) to address any remaining issues. Steve stated that
the agenda, meeting minutes and all presentations given during the day would be made available
on the AEA website. Introductions were held.
Jeff Davis (ARRI) stated that the Susitna River is dynamic but stable. He stated that the Project
would reduce the high summer turbidity and trap sediment. This may make the Susitna more
like the Kenai River and it may become a more confined, single channel type situation where
primary productivity and species of macroinvertebrates are changed. He expressed concern that
the focus of the studies would not address the actual impacts. Phil Hilgert (R2 Resource
Consultants) suggested that Jeff had basically just provided an introduction to the Instream Flow
presentation and added that the approach on the Susitna instream flow study is more integrated
than a typical instream flow study. Jeff stated that the fish habitat, distribution and productivity
studies aren’t addressing the “Kenai scenario”. Phil asked Jeff to hold that thought until later in
the instream flow presentation. Phil stated that Bill Fullerton’s (Tetra Tech) work would be used
to document the existing habitat and forecast what will happen to habitat over time. If it turns
out that the river will become more confined, that effect will be modeled.
Jeff went on to state that appropriate biological data needed to be collected as input to the model.
Bill Fullerton stated that the changes can be documented within the model. Jeff stated that there
was the potential for the river to change from heterotrophic to autotrophic. Steve Padula stated
that while Jeff’s comments were relevant, the studies needed to be reviewed individually for
study planning purposes with the understanding that the study efforts would be integrated at a
later date. Steve asked for folks to identify the holes in the integration process so they could be
addressed. Jeff stated that everyone needed to go back and look at the biological studies that
inform the models and asked Joe Klein (ADF&G) for his thoughts. Joe stated that it was an
iterative process but he felt the plans were on the right track. Eric Rothwell (NMFS) stated that
he wasn’t sure if the plans were on the correct path and that he didn’t feel the study plans
adequately addressed the issues that had been raised by NMFS.
3
Wayne Dyok (AEA) encouraged the group to read FERC’s draft EIS from the 1980’s. He stated
that the same issues that are being raised now were raised then but our technology and
quantification tools are much better now. Betsy McCracken (USFWS) echoed the concerns
raised by Jeff and Eric and stated that she was concerned about the instream flow study
approach. Phil stated that he thought that everyone had common objectives regarding using the
instream flow study to assess Project effects and that more detail was needed to refine the
approach.
Study Presentations
Fish and Aquatics Instream Flow
Phil Hilgert gave the Fish and Aquatics Instream Flow presentation. Areas discussed included
goals and objectives, study area, methods and expected results.
Eric Rothwell stated that the goals and objectives in the presentation sounded similar to his
vision but what he read in the study plans sounded different. He stated that utilization of habitat
types by all species and life stages needed to be understood. Phil stated that it was unlikely that
data for certain species (e.g., burbot) would be able to be acquired and that you have to obtain
and utilize the best available data. Eric asked what the end product would look like if inadequate
data were being used. Phil stated that the RSP was not the end product and that details could be
worked out after the Study Plan Determination (SPD). He stated that collaboration would be
ongoing throughout the process.
Matt Cutlip stated that a schedule in the RSP relative to when that continuing collaboration
would take place is necessary for FERC to approve the plan. Phil acknowledged that the PSP
didn’t have that level of detail but text and tables would be developed to incorporate into the
RSP. Joe Klein stated that the instream flow plan was a good concept but he needed more
confidence in the approach and associated details. Phil stated that a 3-day meeting at the end of
September would address some of the detail. It would consist of a one day office workshop and
2 days in the field. Joe stated that another meeting was needed before that to discuss habitat
suitability curves (HSC).
Betsy McCracken stated that she didn’t want to replicate the 1980’s work. Phil asked her to
hold that thought as it was addressed in the presentation and encouraged the idea of having an
additional meeting.
Mike Buntjer (USFWS) asked how the instream flow sites would be selected. Phil agreed that
details of the site selection process were needed in the RSP. Study site selection is dependent on
the results of reach stratification and habitat mapping that is being done later in 2012. Action
Item. In the absence of identifying study sites, the RSP should describes the process, schedule
and criteria for identifying and reaching consensus on study site selection. Phil acknowledged
that they will try to increase the level of detail in the RSP regarding process, schedule and
criteria for reaching consensus on instream flow details.
Chris Holmquist-Johnson (USGS) asked if there had been any thought into using the Delphi
Method. Phil stated that it was a possibility depending on what site specific data are available
4
and what can be acquired. Dudley Reiser (R2 Resource Consultants) stated that the Delphi
method exists in the hierarchical approach that is planned; primarily if enough data points can’t
be acquired for a specific species. Joe asked why all species data couldn’t be acquired during the
open water period. Phil stated that certain species just don’t exist in numbers high enough in the
Susitna to acquire the needed data. Eric stated that areas where AEA feels that the participants
are requesting too much must be specified in the PSP. Betsy McCracken stated that the USFWS
put a good amount of effort into their requests and much of it was ignored. Wayne Dyok stated
that discrepancies would be addressed during RSP production and AEA wants to work through
all of the issues.
Joe asked what the contingency plan was if site specific species data couldn’t be acquired.
Eric Rothwell asked what variables other than depth and velocity influence habitat suitability for
species. Mary Lou Keefe (R2 Resource Consultants) stated that topography and gradient are
considerations in describing mesohabitat units, and that other factors such as substrate, cover,
and upwelling will influence microhabitat suitability.
Dudley Reiser stated that the initial HSC work will use the 1980’s data and then current data will
be integrated as it comes in. Betsy McCracken stated that the “good” and “bad” data needed to
be sorted out prior to utilization. Jeff Davis stated that the fish distribution study plan needs a lot
of work and noted that that study feeds the instream flow work.
Jan Konigsberg (NHI/HRC) asked if any of the literature related to stranding discussed peaking
in the winter and ice flows. Phil stated that there is a lot of literature on peaking operations, but
much of it was from the Pacific Northwest; they would also be looking at a hydropower peaking
project on a large river in Manitoba with similar characteristics.
Jeff Davis asked about the image of Whiskers Creek Slough in the presentation and noted that
changes had occurred since that image was taken. He pointed out that backwater effects exist in
the slough and there are different conditions now than in the 1980’s. Phil stated that the degree
of change is a matter of scale; the gross channel characteristics have not changed much, but there
have been localized changes, such as large woody debris distribution. The localized changes are
one of the reasons why they need to replace and expand hydraulic modeling from the 1980’s.
Eric Rothwell asked if the 2-D model addressed upwelling. Phil said that 2-D modeling can be
used to quantify depth, velocity and substrate and they will be looking to integrate upwelling as
an additional parameter. Michael Lilly (GW Scientific) pointed out that there are several
models that will be used with this Project and that the cumulative output from these models will
tie together to answer the big questions.
Betsy McCracken asked if the groundwater studies were at a scale appropriate for fish habitat.
Michael stated that they were. Betsy suggested that piezometers be installed at the sites.
Michael stated that that language was already in the plan. Michael mentioned that the AEA
teams such as geomorphology, instream flow-fish and riparian had been discussing and
coordinating their approach. Bob Henszey (USFWS) asked why he hadn’t been involved in all
of the discussions leading up to plan development. Phil stated that some discussions of study
approach have been internal to the AEA project team but no one has been excluded from any
participant meetings.
5
Joe Klein asked if AEA would be using PHABSIM/RFR for certain life stages. Phil stated that
the river flow routing model (RFR) will be used to identify river stage under alternate Project
operations at locations downstream of the dam site, thus it will be used for all of the studies
connected to river flow. Betsy McCracken asked how the appropriate habitat models could be
selected prior to knowing fish distribution and abundance. Phil stated that model selection is
preliminary at this time but is tailored to anticipated Project effects based on the 1980s studies.
Model selection may change depending on the results of current studies, but the intent is to
collaboratively make decisions with the TWG.
Jan Konigsberg asked if ice formation will be modeled and how stranding and trapping would be
addressed during the winter. Phil stated that a combination of the ice work from HDR and the
varial zone model will quantify the potential for stranding and trapping during the winter time
under alternate Project operating scenarios.
Eric Rothwell stated that the overall schedule seemed idealized and that a contingency should be
built in to extend the study period if it can’t be completed within the current confines of the ILP.
Action Item. Phil stated that AEA is working to fit it into the existing schedule. Eric stated that
he wanted to make the point to FERC that if the process or approach wasn’t consistent with
participant sentiment, the schedule needed to be extended. Matt Cutlip stated that he understood
and that there were opportunities throughout the process to comment and if extensions deemed
appropriate, FERC would make that determination.
Marie Steele (ADNR OPMP) asked if Alaska was unique given that an abundance of statewide
data isn’t available. Matt stated that this was a unique project. He stated that it was a large
project on a large system and that the data needed to be seen before a determination relative to
extensions was made. Matt Love (Van Ness Feldman) stated that every project is challenging
and what was needed was a path to move the study program forward.
Action Item. Eric stated that he needed to see biological cues related to flow. He wanted that
added to the overall instream flow analysis. Phil said he understood. Joe Klein added that more
discussion was needed and listed a series of questions:
1. What is the sampling strategy for the defined habitat types?
2. How many and at what range will discharge-calibration sets be collected for each
sampling method?
3. Will the 2-D model include side channels and sloughs within the study area?
4. What criteria will be used to identify cover types and substrate sizes?
5. For PHABSIM, will transects be dependent or independent?
6. What water surface elevation models and composite suitability index will be used?
7. What criteria will be used to select and weight transect-derived models?
8. What criteria will be used to identify “a representative number”?
9. HSI curves are needed for identified target species for each habitat type, over two years.
10. How will the data be aggregated to evaluate single flow recommendations?
11. Will a DSS-type program be available to review study results?
12. How do you envision the “collaborative process” will work?
13. When will major decisions be made, (e.g., site selections) and how often will the work
group get together?
14. What equipment will be used?
6
15. Similar information is needed for the eulachon and boating evaluations. What is the
sampling strategy, how many cal-sets and how will HSI curves be developed?
16. Varial zone modeling may need more defined time steps.
Phil stated that these were the details that needed to be discussed and worked out with the TWG.
Joe stated that more meetings were needed. Phil stated that some details could be addressed
prior to the RSP. Relative to the areas that can’t be addressed till later, the RSP will discuss the
process, schedule and criteria for reaching that level of detail.
Joe asked what type of equipment would be used for velocity measurements. Phil stated that his
personal preference was the Price AA but there were other options including ADCP (acoustic
Doppler current profiler), and Swoffer meters and stated that this was a good example of the
detail that could be worked out at a later date. Matt Cutlip stated that FERC would have to make
a determination about whether implementing the RSP will provide the FERC with enough
information to make licensing decisions. Ideally, this level of detail should be worked out at the
RSP phase under the ILP, but it comes down to a FERC determination about study plan
adequacy. Dudley Reiser stated that instrumentation use can be a contentious issue and they
expected that the level of detail of instrumentation would be worked out collaboratively with the
TWG. Wayne Dyok thanked Matt for his input and stated that the Boundary Dam PSP/RSP,
which had been approved by the FERC had been used to a large extent as a template for the level
of detail presented in the PSP. He acknowledged that some studies needed additional detail and
that AEA plans on being collaborative throughout. Matt said he understood and reiterated that if
the RSP is missing information needed to respond to specific requests, there needs to be a
specific plan and schedule for reaching agreement on those details.
Phil stated that the proposed 3-day meeting was brought up after the June meeting; after some
discussion, the dates for the meeting were set at September 26-28.
Marie Steele asked if there would be a workshop with participants to go over instream flow field
methods. Phil stated that this would happen in 2013 prior to field work occurring. Marie asked
if that was in the plan. Phil reiterated that additional detail would be added to the RSP and where
that detail couldn’t be added, the RSP will discuss the process, schedule and criteria for reaching
that level of detail.
Betsy McGregor stated that there would be another preparatory instream flow meeting in
September prior to the 3 day meeting/site visit. Action Item. Eric Rothwell wanted to make
sure that everyone who wanted to attend would be notified. Wayne agreed. Eric suggested that
once the “core group” was invited, the dates should be put on the AEA website. Joe asked if
there was a SharePoint site for meeting minutes, correspondence, etc. Betsy stated that the
meeting minutes and presentations are located on the AEA website and that an FTP site existed
as well for transferring large files.
Riparian Instream Flow
Kevin Fetherston gave the Riparian Instream Flow presentation. Areas discussed included goals
and objectives, study area, methods and expected results.
7
Bob Henszey stated that before the presentation started, he wanted to preface by saying that the
plan needed more detail and collaboration.
Action Item. Bob asked if seed recruitment would be looked at. Kevin stated that it would be.
An ADNR representative asked if wetlands would be included in the analysis. Action Item.
Kevin stated that some wetlands would qualify and that floodplain conditions and alterations
would be addressed. Jan Konigsberg asked if the role of downed cottonwoods would be
evaluated. Kevin stated that it would be discussed later in the presentation.
Joe Klein asked if ice scars on trees were indicative of an ice jam. Kevin stated that that was the
preliminary conclusion. Jeff Davis stated that at times, multiple chunks of ice the size of sheds
flow through certain areas.
Michael Lilly led a discussion on ice jams and ice erratics and their associated processes. Eric
Rothwell asked if data existed documenting at what flows ice jams form and break-up occurs.
Kevin stated that they haven’t yet collected these data. Michael elaborated by saying that you
will get pulses moving down the system causing these conditions.
Bob Henszey pointed out that transpiration can be measured on plants by looking at the water
table. He added that by looking at the water table, you can get a feel for root length. Action
Item. Jan Konigsberg asked if the study will document how transpiration is affecting the
understory. Kevin stated that it would.
Bob stated that given the bimodal flow trend on the Susitna, he doesn’t see any 2 year old
seedlings. He asked if it was worth looking at both peaks. Action Item. Kevin stated that
during the study, seedlings would be evaluated for age and then the hydrograph would be
reviewed.
Michael Lilly lead a discussion on the Whiskers Slough complex, its specific issues and resource
areas to be addressed. Eric stated that he saw a need to have a stream gauge on the Chulitna.
Michael pointed out that the USGS was in the process of reestablishing a gauge on the Chulitna.
Bob stated that he’d like to see more wells near the channels. Action Item. Kevin stated that
further discussion could be had to refine well sites.
Bob asked how groundwater will be linked to perennial response. Kevin stated that if a robust
data set exists, this can be done. Michael stated that there are long-term USGS gauge data that
can be run through project groundwater models to predict what will happen relative to plant
response.
Joe Klein asked if cottonwoods needed a descending water table to recruit. Kevin stated that
they can’t be drowned but need to stay wet.
Action Item. Joe asked if climate and wildlife issues would be integrated into the analysis of
riparian succession. Kevin confirmed that it would.
8
An ADNR representative asked if longer term monitoring stations were needed. Kevin stated
that it depended on the results from the initial 2 years of monitoring.
Jeff Davis asked how changes in channel formation would affect patterns of vegetation. Kevin
stated that it would have a dramatic affect and that looking at changes in channel formation over
time will help identify vegetation patterns.
Jay Stallman (Stillwater Sciences) asked if different operational scenarios as they relate to
geomorphic change over time were going to be evaluated. Bill Fullerton stated that it will be
characterized but some of the longer term changes would extend beyond the license term and the
results would be speculative. He stated that the results of the geomorphology study wouldn’t be
as specific as defining new topography but that reviewing the history of the areas and associated
changes would help the process of predicting pre vs. post project conditions. Kevin added that
there are likely to be zones of change. Bill Fullerton stated that integrating dendrochronology
with photos will be a great tool.
Jeff Davis asked if a reduction in fines would change the groundwater. Kevin stated that it
could. Michael Lilly stated that if fines were removed from the system, there would likely be a
change to the downstream environment. It could be positive, it could be negative.
Jeff asked if we had the data to support the hypothesis that there was limited embeddedness in
the system. Michael stated that the work was currently being conducted to assess bed mobility
and noted that the bed was active.
Michael Lilly added to the earlier ice jam discussion by stating that ice jams and flooding in
early May are more temperature related than flow related. He pointed out that significant events
aren’t always driven by flow. They also result from temperature.
Cross Section Study
Michael Lilly gave the Cross Section Study presentation which was included within the Fish and
Aquatics Instream Flow Study presentation. Areas discussed included goals and objectives,
study area, methods and expected results.
Bob Henszey asked if any of the 1980’s wells had been found. Michael stated that they haven’t
looked for them.
Joe Klein asked if the ADCP was being used in shallow water. Michael Lilly said the ADCP
was the primary velocity measurement tool used in the cross-section and showed pictures of it
mounted on a cararaft for use in shallow water. He pointed out that velocities in very shallow
areas between channels were estimated. Moving bed tests were conducted and water
temperatures were collected.
Groundwater Related Aquatic Habitat
Michael Lilly gave the Groundwater Related Aquatic Habitat presentation. Areas discussed
included goals and objectives, study area, methods and expected results.
9
Michael Lilly began the presentation by saying that additional meetings are needed to address the
details, process, etc. If the stakeholders could get their questions and concerns to him prior to
those meetings, it would be helpful.
Joe Klein asked if wells would be dug as a part of this work even though it isn’t discussed in this
plan. Action Item. Michael confirmed this and reiterated that coordination was the key to the
study program. Joe asked which group would be the appropriate one to discuss the details
related to the wells. Michael stated that discussion with multiple groups at once would be the
best approach. Wayne Dyok asked what the best approach for showing the integration would be.
Michael stated more meetings were needed along with continual dialogue. He stated that after
the RSP is in, continued collaboration to develop the details was imperative.
Jeff Davis stated that the groundwater and surface water work should be related to the fish work.
Michael pointed out that this would be discussed later in the presentation. An ADNR
representative asked if water temperatures could be measured near the bottom of the water
column to identify groundwater sites. Michael stated that this would be addressed during the
water quality presentation tomorrow. Jeff Davis stated that it wasn’t clear who was doing what
from a water temperature perspective.
Wilson Jastin (Tribal Council) pointed out that there is a precipitation cycle to take into account
and he is worried that AEA is collecting the right data but will reach the wrong conclusions.
Michael pointed out that historical data would be reviewed.
Jeff asked if the same water quality parameters would be measured for the water quality study
and the instream flow study. Michael stated that the parameters were different because of
differing needs.
Betsy McCracken asked how the lower boundary for the study was selected. Michael explained
that the current lower boundary is based on the assumption that project effects will not extend
below this point. The river routing model will be used to help confirm that potential downstream
limit of Project impacts. If the impacts appear to extend downstream further or not as far, the
boundary may be adjusted. Betsy McGregor stated that the 2012 data should assist in finalizing
that boundary. Phil Hilgert stated that the intent is to use the flow routing model results to define
the downstream boundary prior to 2013 field work. Jeff stated that the boundary should vary
depending on flows out of the Chulitna and Talkeetna. Phil stated that that would be looked at as
part of the boundary selection process. Wayne Dyok pointed out that AEA was looking at the
amount of flow fluctuation that would result from the most extreme levels of load following
operations.
Joe Klein asked a series of questions:
1. Will the operational scenarios be developed in 2012?
2. Will project design and access be developed in 2012?
3. Is the goal of the intensive study sites to overlap studies as much as possible?
Wayne answered the first two questions by stating that no project infrastructure or operational
scenarios would be developed in 2012. Michael confirmed that the intensive study sites were
intended to integrate many of the individual studies.
10
Wilson asked about a comment from Wayne regarding “negotiating” with landowners and stated
that he gets concerned when he hears discussion related to negotiations. Wayne stated that he
was stating that all parties with ownership interests should be involved in discussions related to
potential access routes. Wilson pointed out that Indian grave sites, campsites, etc. should be
taken into consideration.
Bob Henszey stated that more wells were needed. Wayne stated that AEA wasn’t averse to
discussing this but he needs certainty that additional wells will add value to the study.
Michael displayed a flow chart showing the integration of resource areas and pointed out that
there would be intensive data collection at the intensive study sites. Eric asked how many
intensive study sites were proposed. Kevin Fetherston stated that 6 intensive study sites were
proposed. Eric asked if a similar flow chart existed for the aquatics because the chart was very
helpful. Michael stated that a chart was in development.
Jeff Davis stated that available habitat in sloughs can change depending on the season, flow, etc.
He stated that appropriate water quality parameters in the sloughs were key. Michael reiterated
that more detail was forthcoming and where that detail couldn’t be incorporated into the RSP,
additional schedule, process and criteria information would be included.
An ADNR representative asked if the discharge measuring stations were telemetered. Michael
stated that they were. Dave Meyer (USGS) stated that there was a QA/QC process for their stage
data in the winter and anomalous data is removed.
Joe Klein stated that there was a good amount of work to do to get to the appropriate level of
detail. He stated that he needed more comfort and confidence about how the study will be
conducted.
Geology and Soils Characterization
Bryan Carey gave the Geology and Soils Characterization presentation. Areas discussed
included goals and objectives, study area, methods and expected results.
Wilson Jastin asked about the fault that caused the 2002 earthquake and whether it joins the fault
system near the project. Bryan stated that the USGS had many recording instruments in the area
and that fault would be included in the assessment. He continued that 4 more seismographs were
being installed 10-40 miles from the dam site to collect additional data. Brian Sadden (MWH)
stated that there was going to be an extensive analysis of factors that could impact the project.
Wilson stated that his question was more emotional than scientific.
Jay Stallman asked if AEA was looking at potential instability along the shorelines. Brian stated
that there are shoreline areas that have slumped without the reservoir, so rising of water could
increase instability. Areas that have potential for movement will be evaluated. Bryan Carey
stated that Watana Creek would also be looked at to see if any instability there could impact the
project.
11
Wilson stated that he was very familiar with both the 1964 and 2002 quakes and they were very
different with respect to the amount of upland sloughing.
Glacial Runoff Changes
Bryan Carey gave the Glacial Runoff Changes presentation. Areas discussed included goals and
objectives, study area, methods and expected results.
Bob Henszey asked if this study will be looking at sediment from the glaciers. Bill Fullerton
confirmed this and stated that it will be evaluated in terms of how much of that sediment will
reach the reservoir. Mike Harvey -TT stated that glacial surges will increase sediment loading
and that the big question is, will the sediment loading increase sediment flux downstream. Bob
asked if any sediment increase would attenuate out. Mike stated that it would.
Wayne stated that due to personal reasons, Dr. Harrison’s services couldn’t be used to date in the
study plan development. Wayne will follow up to verify his future availability. Wayne
introduced Regina Hock (UAF) to discuss the modeling component of the study. Regina stated
that the modeling set-up and file preparation was underway. She stated that initially the error
bars would be large due to stations still being installed. The data collection effort in 2013 will
assist greatly. Wayne asked her to explain how the model works.
Regina explained that it was a fully physical based watershed model that includes glacial retreat.
It can model changes in the water cycle. She is currently using existing climate data sets and
will refine further once site specific data is collected. Wayne stated that he had talked briefly
with Sue Walker (NMFS) and Eric Rothwell and asked Eric if he’d like to speak on the topic.
Eric declined and requested a meeting in 2 or 3 weeks. Wayne agreed to explore that possibility.
Wayne asked Regina how permafrost and changes to vegetation were monitored. She stated that
the developer of the model was coming to Fairbanks to work on adjusting the model to better fit
Alaskan conditions.
Steve Padula reminded everyone of the schedule for Friday and reiterated AEA’s understanding
of the need for additional detail in the RSP. He stated that after the meeting on Friday, follow-up
meetings would be scheduled. Action Item. He added that all details that could be added prior
to the RSP, would be added. Where detail cannot be added, the process, schedule and criteria for
reaching that level of detail will be included.
Eric Rothwell stated that it would be helpful to know when that additional detail would be
provided to the agencies for review. He requested some indication be provided at the close of
this set of meetings. Steve stated there would likely need to be some internal discussion and
small group meetings prior to producing text for review.
Meeting Summary
Susitna-Watana Hydroelectric Project Licensing
Technical Workgroup Meetings
August 15-17, 2012
AEA Project Offices, First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
ILP Formal Study Plan Meeting for Geomorphology, Ice Processes,
Water Quality, Mercury, August 17, 2012, 8:30 am - 3:00 pm
Attendees:
Organization Name
AEA Betsy McGregor
AEA Wayne Dyok
AEA Bryan Carey
USFWS Mike Buntjer
USFWS Betsy McCracken
USFWS Bob Henszey
USFWS Lori Verbrugge
ADNR Melissa Hill
ADNR OPMP Marie Steele
NMFS Eric Rothwell
ADF&G Joe Klein
ADF&G Ron Benken
USGS Dave Meyer
Tribal Council Wilson Jastin
FERC Matt Cutlip
LBG/FERC Contractor Fred Winchell
Natural Heritage Institute/Hydropower Reform Coalition Jan Konigsburg
Long View Associates Steve Padula
Long View Associates Cory Warnock
Van Ness Feldman Matt Love
MWH Kirby Gilbert (by phone)
Watershed Geodynamics Kathy Dube
HDR Robin Beebee
R2 Resource Consultants MaryLouise Keefe
R2 Resource Consultants Phil Hilgert
R2 Resource Consultants Dudley Reiser (by phone)
Tetra Tech Harry Gibbons
Tetra Tech Rob Plotnikov
Tetra Tech Bill Fullerton
Tetra Tech Bob Mussetter
GW Scientific Michael Lilly
Meeting Summary Page 2 of 11
Susitna-Watana Hydroelectric Project
August 15-17, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Organization Name
Stillwater Sciences Dirk Pedersen
Stillwater Sciences Jay Stallman
URS Paul Dworian
Genovar Karen Olson
ARRI Jeff Davis
ARRI Gay Davis
Alaska Ratepayers Scott Crowther
Tetra Tech Mike Harvey (by phone)
Introduction
Steve Padula (Long View Associates) opened the meeting and explained that the intent of this
meeting was to discuss the Geomorphology, Ice Processes, Water Quality and Mercury studies
that have been proposed and to have substantive discussions related to any remaining
misunderstandings or inconsistencies. Steve went through a few slides reminding everyone about
the formal study planning process, current status, and associated deadlines. He noted that
another set of TWG meetings is scheduled after the October 15 due date for filing comments on
the Proposed Study Plan (PSP) to address any remaining issues. Steve stated that the agenda,
meeting minutes and all presentations given during the day would be made available on the AEA
website. Introductions were held.
Jeff Davis (ARRI) stated that he didn’t understand how the geomorphic classification could be
done when the fish data weren’t acquired yet. He stated that without the site specific distribution
data, you don’t know how geomorphic classification relates to fish in Susitna. He stated that fish
communities should drive geomorphic classification. He went on the state that alterations to the
biological fish studies may be needed to get the appropriate data.
Study Presentations
Geomorphology
Bill Fullerton (Tetra Tech) gave the Geomorphology presentation. Areas discussed included
goals and objectives, study area, methods and expected results. See the presentation on the AEA
website.
Wayne Dyok (AEA) pointed out that the studies were looking at all 3 potential access routes and
that AEA will narrow down to a preferred option later in the process.
Eric Rothwell (NMFS) asked if current data was being collected in the Chulitna River. Bill
stated that it was. Eric added that it would be nice to know the location of all of the bed loading
sites. Action Item. Bill agreed and stated that he would add a map.
Meeting Summary Page 3 of 11
Susitna-Watana Hydroelectric Project
August 15-17, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Betsy McCracken (USFWS) asked if there was a significant gradient change below the tri-rivers
area that would affect the habitat. Bill stated that currently, the downstream boundary of the
study is at Sunshine and that if project impacts appear to extend further downstream, the
boundary may be moved. Matt Cutlip (FERC) asked when that boundary decision would be
made. Bill stated that additional coordination meetings over the course of the next month would
assist in determining the boundary and if a consensus couldn’t be reached by the RSP, a protocol
and schedule would be put in place for reaching that decision. Michael Lilly added that the cross
section analysis is actually looking downstream of Sunshine to river mile 75 and if project
impacts extend further downstream, the model will be adjusted accordingly. Matt Cutlip
clarified that that decision could be reached by the Initial Study Report (ISR). Betsy McGregor
(AEA) said that it would.
Betsy McCracken asked why the study wasn’t looking all the way to the mouth as she felt that
there would be biological impacts all the way down the river. Bill pointed out that he was only
dealing with geomorphology issues and that other studies were looking all the way down to the
mouth. Matt Cutlip stated that it would be helpful to identify the downstream extent of each
study and put a mechanism in place to modify the boundaries if needed. Action Item. Bill
stated that as information was developed, a technical memo would be developed for discussion
purposes.
Jeff Davis asked if the eulachon study was tied to the geomorphology study. Action Item.
Wayne Dyok stated that AEA would provide how studies are interrelated.
Jan Konigsberg (NHI/HRC) asked if AEA would be able to determine the downstream project
affects over a 50 year period. Bill stated that that would be looked at. Jeff asked if the studies
would be able to document how the sediment that was transported out of the middle affected the
lower river. Bill stated that would be done as well. Bob Henszey (USFWS) asked Matt Cutlip if
the cumulative impacts of the project don’t show up in the term of the license will an impact
beyond that term be taken into account by FERC when making the determination. Matt stated
that FERC only considers a 50 year timeframe (i.e., the term of an original license).
Jay Stallman (Stillwater Sciences) asked if bank erosion would be evaluated. Bill stated that it
would. Jay asked if the sediment budget was broken down into different size classes. Bill stated
that the field work would initially be looking at bed load and the model would be more specific.
Eric Rothwell asked if that meant that there wouldn’t be good resolution on diffuse processes.
Bill stated that that was correct with respect to the field work.
Wilson Jastin (Tribal Council) stated that he was concerned about mixing disciplines to reach
conclusions. He was concerned that the right data will be acquired but the wrong conclusions
will be reached.
Ron Benken (ADF&G) stated that an inventory and assessment should be done along the Denali
Highway if the Seattle Creek access route is chosen. Ron stated that if the Seattle Creek access
Meeting Summary Page 4 of 11
Susitna-Watana Hydroelectric Project
August 15-17, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
route was chosen, improvements would be needed and ADF&G would like to see Tier 1 stream
crossings if the streams were fish bearing.
Betsy McCracken asked if one flow was being modeled for the lower river. Bill clarified that
they were just looking at one flow in 2012 but it had nothing to do with the model. Betsy asked
what that flow was. Bill stated that it was 36,300 cfs. Bob Henszey asked if tributary input
would be evaluated. Bill said that it would be evaluated during modeling exercises. Bob asked
if the modeling relied on some of the field data being collected in the field during this study. Bill
confirmed that it did.
Jeff Davis asked/made a series of questions/statements:
1. Explain the effective discharge sites for bed load movement and how the data will be
used.
2. The tributaries discharge a good amount of sediment during storm events.
3. Explain the interrelationship between ice processes and bank erosion on sediment.
4. Can the scale of large wood debris be assessed on fish habitat in sloughs?
Bill answered questions 1-3:
1. The sediment rating curves are indicative of the river over time. We assume that the river
is in a state of dynamic equilibrium. The 1-D model will further detail the sediment
balance.
2. Tributaries will be taken into account during modeling.
3. We need to continue to get a handle on ice processes and develop an approach for
handling them. One key factor will be where ice forms now and where ice is influencing
the channel.
Kathy Dube (Watershed Geodynamics) answered question 4:
4. The goal is to look at how large woody debris influences aquatic habitat. Wood will be
mapped via aerial surveys and some site specific work.
Jeff Davis asked if the study would look at spawning habitat modifications for chum salmon at
specific sites along the river. Bill stated that the next presentation would discuss this.
Betsy McCracken asked how ice processes were being related to project impacts. Bill stated that
AEA currently wasn’t proposing to model geomorphological changes under ice conditions
because the low flow conditions don’t warrant it. Wayne stated that Robin Beebee’s (HDR)
presentation would look at this issue.
Jeff Davis stated that the channel cross section can be reduced when ice is present. Even though
flows are low, the channel is still compressed. Bill stated that as the study progressed, they
would consider that as an option for 2-D modeling.
Meeting Summary Page 5 of 11
Susitna-Watana Hydroelectric Project
August 15-17, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Bryan Carey (AEA) stated that current work included looking at slope stability issues in the
reservoir area, particularly Watana Creek. Eric Rothwell asked if the reservoir
geomorphological analysis would look at the potential effects for different dam heights. Kathy
Dube stated that the plan was to look vertically above the maximum height of the dam and create
a band around the reservoir.
Matt Cutlip stated that yesterday, Kevin Fetherston (R2 Resource Consultants) said he was
looking at 6 focus sites and they were going to be integrated with the 2-D modeling sites. Matt
stated that those sites should be selected soon because if the stakeholders decide to say that they
feel there should be more than 6 sites, AEA will need a justification for why this isn’t necessary.
Bill stated that the study plan says approximately 6 sites will be evaluated. Matt reiterated that
the possibility exists that the stakeholders will request more than 6 sites and that would have a
significant impact on the level of effort. Bob Henszey stated that Matt’s comment was a good
one and that with only 6 sites, you’d have a low level of confidence relative to the results. Bill
pointed out that the 2-D modeling won’t be completely based on the intensive sites and that the
2-D modeling is only one tool that will be used. Matt asked if the stakeholders would assist in
selecting the 2-D modeling sites. Bill stated that they would.
Jay Stallman stated that more detail was needed about specific geomorphic data variable
collection. He additionally stated that it would be helpful if you further defined the stratification
system at both a local and reach scaled. Bill acknowledged that more detail was needed.
Jan Konigsberg asked if you have 2 similar sites but one produces fish and one doesn’t, is there
value in modeling both sites. Mary Lou Keefe (R2 Resource Consultants) asked if Jan was
talking about spawning. Jan stated that he was talking about sites where you’d expect fish to be
but they aren’t. Phil Hilgert (R2 Resource Consultants) stated that sites were being expanded to
include both areas where we know fish are and areas that look good but fish aren’t present. Phil
acknowledged the need for more detail in the plans and stated that more detail would be
incorporated into to the RSP. Any areas where the detail cannot be added until a later date, the
RSP will describe the schedule, process and criteria for getting to that detailed level. Phil went
on to say that the goal is to be able to extrapolate the findings at the intensive study sites to other
areas and that this method would be developed with collaboration with the stakeholders.
Wilson Jastin stated that he felt 6 sites were not enough. He used the Copper River salmon run
as an example of how drift in peak spawn timing can be altered over time. He stated 60 or 70
sites were needed.
Jay Stallman pointed out that in the USFWS and NMFS study requests they ask for pebble
counts and asked that more detail be added as to when and where bed material samples will be
taken. Bill noted the comment and stated additional detail would be added.
Fluvial Geomorphology Modeling Below Watana Dam
Meeting Summary Page 6 of 11
Susitna-Watana Hydroelectric Project
August 15-17, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Bill Fullerton (Tetra Tech) gave the Geomorphology presentation. Areas discussed included
goals and objectives, study area, methods and expected results.
Bob Henszey asked what the mesh size was for the 2-D modeling. Bill stated that mesh sizes
would be adjusted relative to the study site. Jeff Davis asked if feedback from the field
measurements would define the mesh sizes. Bill stated that field data input would help focus on
the appropriate areas. Bob Mussetter (Tetra Tech) stated that if only hydraulic conditions were
being modeled, the mesh sizes could be adjusted significantly. He stated that he expect to have 2
meshes for each site, 1 for habitat conditions and one for the mobile boundary. Marie Steele
(ADNR OPMP) asked at what point in the process mesh sizes would be chosen. Bill stated that
they would be selected within the next year.
Eric Rothwell asked if additional cross sections may be selected at areas that aren’t hydraulic
controls if sediment deposition was being evaluated. Bill confirmed this. An unknown person
asked how long a model run would take. Bob stated that the mobile boundary run would take 1-
3 days and the hydraulic and sediment run would take a few hours.
Betsy McCracken asked for more information related to the data needs for modeling. Bill stated
that stakeholder expectations and needs along with data collected will assist in populating the
model. Betsy stated she wanted to see how fish distribution over time changes with the proposed
project. Bill stated that that was the goal of the interaction of the models.
Jeff Davis stated that the modeling would be somewhat limited due to the use of intensive study
sites. Bill agreed. Bob Henszey asked if a comparison was done between what the stakeholders
requested and what was in the study plan. Bill stated that he felt that everything that could be
addressed at this point, has been and that the additional detail needed would continue to be
worked on. Bob stated that the discussion related to the discrepancy between what was in the
plans and what was needed. Betsy McGregor pointed out that there was a table discussing the
comments.
Jay Stallman stated that FERC requested that if there were multiple requests for model
production and output, it must be made clear what model will do what. Bill acknowledged the
need to come up with a hierarchical diagram that will document what model feeds what. Matt
Cutlip asked if that could be done for the RSP. Action Item. Phil Hilgert stated that AEA
would try to have it ready by that point. Betsy McGregor pointed out that in June, Bill produced
a technical memo related to what models will be used. She asked if anyone had any comments.
Eric Rothwell stated that he was comfortable with the memo. He asked if the 2-D model was
proprietary. Bob Mussetter stated that hydraulic component was publically available and the
mobile boundary had limited availability but Tetra Tech has been granted access.
Bill reviewed an internal comment response table. There was a request for AEA to make the
table publically available. Action Item. AEA stated that a modified version may be made
available after the upcoming small group meetings.
Meeting Summary Page 7 of 11
Susitna-Watana Hydroelectric Project
August 15-17, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Eric Rothwell stated that the geomorphology plan lined up better with stakeholder requests but
that more detail would be needed to refine the plan. Eric asked Matt Cutlip if it would be
possible to extend the comment deadline by 30 days. Matt Cutlip stated that he wasn’t the
coordinator and couldn’t make those decisions.
Jay Stallman stated that it wasn’t clear to him how calibration of the 2-D modeling sites occurred
without existing measurements. Bill stated that there would be a good deal of ADCP data and
more was forthcoming and as far as sediment transport modeling, there would be no calibration
at the 2-D sites. Bob Mussetter stated that water surface elevations would also be calibrated. He
added that transport rates would be used to calibrate the sediment transport model. Bill added
that water surface elevation data loggers would be installed at each site. Michael Lilly reiterated
that the integration of studies would be clearer in the RSP.
Jeff Davis asked if the model could be calibrated to model chum spawning with changes in
substrate size, and how can the model be depended upon. Bob Mussetter explained that the
model is calibrated to all available parameters. For the data that isn’t available, you must trust
the physics and reliability of the model. Phil Hilgert added that you can model changes in gravel
movement but you can’t calibrate it.
Betsy McCracken asked if the models are what would be used to quantify habitat loss in an effort
to mitigate for the project. Bill stated that the models are part of the process and that it is all
coordinated. Betsy stated that if studies are cut off at the downstream boundary, the area of
concern is being limited. She asked if mitigation options were being considered. Betsy
McGregor and Wayne Dyok stated that they weren’t ready to discuss mitigation.
An ADF&G representative asked how far along the engineering models were. Wayne stated that
the reservoir operations model was done and output of that model would provide input to the cost
production model. He stated that there were still unknowns including maximum flows, size of
units, etc.
Betsy McCracken asked when she could expect to hear about mitigation options. Matt Love
stated that at this phase in the process, AEA was setting up the methods to determine what the
project impacts would be. Once those are determined, then PM&E’s would be discussed. He
stated that conversation was premature at this point. Betsy asked if AEA had adequate budget to
mitigate for the project. Wayne stated that mitigation has been considered in the overall budget.
Betsy McGregor stated that AEA was considering options but nothing was firm yet. AEA is
currently most interested in developing studies that will adequately define project impacts.
Matt Cutlip asked if the 30,000 cfs release would be from a low level outlet. Bryan Carey stated
that it would be combination of spill and a low level outlet.
An ADF&G representative asked if PM&E options wouldn’t be seen until after model runs in
2015. Matt Love suggested that after the study planning process was complete, the TWG get
together to understand the process for PM&E’s.
Meeting Summary Page 8 of 11
Susitna-Watana Hydroelectric Project
August 15-17, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Ice Processes
Robin Beebee (HDR) gave the Ice Processes presentation. Areas discussed included goals and
objectives, study area, methods and expected results.
Mike Buntjer asked if this modeling effort would be done in conjunction with the other modeling
and what the downstream extent of this work would be. Robin stated that the downstream extent
was river mile 75 and the model type had not been determined yet.
Eric Rothwell asked how many sites would be evaluated and how often discharge measurements
would be taken. Robin stated that the River 1-D model used the same open water calibration
sites and that fewer sites were used in the winter. Eric acknowledged that winter discharges
were hard but stated that flow change significantly in the winter and without enough discharges,
the winter time frame may not be defined appropriately. Robin asked if Eric was thinking
primarily of braided areas. Jeff Davis confirmed that this was his concern. Michael Lilly stated
that AEA was coordinating with USGS for additional winter gauging data.
Bob Henszey asked if the model could document water coming out of the proposed reservoir.
Robin confirmed that this was possible.
Bob Henszey asked if jumble ice in the fall resulted in stronger ice in the spring. Michael Lilly
confirmed this and stated that there are indications that you’ll see some of this type of ice in the
Susitna.
Bob asked if there would be a camera in Devils Canyon. Robin stated that there would not be.
Eric asked about the availability of the telemetered data. Action Item. Betsy McGregor stated
that the 2012 videography and photos from Robin would be available soon via the ADNR
website and Michael Lilly’s work would be available via the AEA website. Michael added that
other available data would include water temperature, water height, air temperature and images
for ice studies.
Joe Klein asked if the ice processes model would predict anchor ice. Robin confirmed that it
would.
Jeff Davis stated that jumble ice appears overnight and asked if it was coming from upstream.
Robin stated that it was. Jeff asked how the model dealt with calibration and what the level of
confidence was. Robin stated that it depended on the process. It wouldn’t predict overflow at a
bend but it would predict less localized events. Steve Padula asked about the timing for getting
folks more information on the model. Robin stated more information would be made available
in the next month. Wayne Dyok asked the group if they had an issue with using the University
of Alberta 1D/River 2d modeling framework. Eric Rothwell stated that he didn’t have a problem
with it but more detail was needed. Robin stated that a model hierarchy would be created. Bob
Henszey asked if a 2D model was necessary. Robin stated that it would be a huge time
Meeting Summary Page 9 of 11
Susitna-Watana Hydroelectric Project
August 15-17, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
commitment and there would be a need to route water down the river laterally. Robin stated the
primary need for 2-D model would be for lateral routing across a floodplain.
Baseline Water Quality
Harry Gibbons (Tetra Tech) gave the Baseline Water Quality presentation. Areas discussed
included goals and objectives, study area, methods and expected results.
Lori Verbrugge (USFWS) stated that the criteria weren’t specified to address aquatic life and that
needs to be addressed. Jeff Davis added that detection limits need to be clarified. Action Item.
Harry stated that that would be specified.
Bob Henszey asked if copper was being looked at. Harry stated that it was. Lori stated that the
plan doesn’t include analysis of element mixture toxicity. Harry stated that mercury was the
parameter with the highest interest but the intent was to look at all metals. Lori added that
toxicity related to pH interaction should also be evaluated. Harry stated that by going through
the pathway analysis, other methods would be understood. Lori disagreed and stated that at
some point an aquatic toxicity model would be required.
Wilson Jastin stated that there have been massive changes in the sediment in the river and that
criteria are going to be difficult to work with. He stated that having a standard in an ever-
changing system is difficult.
Joe Klein stated that more information was needed relative to site selection and what is being
sampled. Rob Plotnikov (Tetra Tech) stated the 6 intensive study sites were selected based on
historical studies and concerns voiced by stakeholders.
Jeff Davis stated that water quality parameters in the side channels and sloughs of the middle
river need to be understood. He added that DO needed to be focused on in these areas and that a
comparative analysis was needed. He stated a calculation was needed for limited concentration
in macro nutrients. He stated turbidity at depth, suspended sediment and water color in the
presence of less turbidity should be looked at. Rob stated that there were more complex
temperature monitors in place in the sloughs at various depths to understand and explain what
other characteristics are influenced.
Eric Rothwell stated that in case thermal imaging didn’t work, he’d like to see a decision tree in
the RSP that would document what will take place to adjust to the appropriate methods. He
stated his concern was what would be done with things like upwelling, thermal refugia, etc. if
thermal imaging wasn’t successful. Michael Lilly stated that Robin Beebee’s work will look at
the bigger picture of upwelling and open leads and that there are USGS methods for evaluating
upwelling. Eric pointed out that these methods weren’t currently proposed. Michael stated that
the intensive study sites are used to look at upwelling and then scale up to extrapolate over the
river length. He stated that if the processes are understood at the intensive study sites, then we
will know what level of confidence to have in the ability to scale up.
Meeting Summary Page 10 of 11
Susitna-Watana Hydroelectric Project
August 15-17, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Joe Klein asked when the QAPP would be ready. Matt Cutlip asked if it could be filed with the
RSP. Harry said that that could probably be done.
Water Quality Modeling
Rob Plotnikov gave the Water Quality Modeling presentation. Areas discussed included goals
and objectives, study area, methods and expected results.
Lori Verbrugge asked about inputs from vegetation, peat, etc. Rob stated that the plan was to
rely on how work like this has been successfully conducted under similar conditions. Detail will
be added prior to modeling. Lori asked if after the small group meetings, the necessary level of
detail could be reached. Matt Love stated that perhaps a red-lined comment response table
would be made available. Wayne Dyok asked Lori when her study plan comments had to be
approved by the USFWS. Action Item. Lori stated that she would get AEA her comments soon
and that she saw some inconsistencies in the plan. Rob stated that detail would be added to the
plan. Bob Henszey asked if the slides could be referenced. Matt Cutlip confirmed that this was
ok.
Matt Cutlip stated that two other things FERC would need to see would be:
1. An incorporation of evaporation into hydrology
2. Methane production
Mercury Assessment and Potential for Bioaccumulation
Paul Dworian (URS) gave the Mercury Assessment and Potential for Bioaccumulation
presentation. Areas discussed included goals and objectives, study area, methods and expected
results.
Jeff Davis asked what fish species are being sampled. Paul stated that AEA was using the
Alaska DEC list for adult fish. Lori Verbrugge asked why macroinvertebrates were not being
looked at. Paul stated that there would be a lot of non-detections with macroinvertebrates.
Jeff Davis asked if lake turnover increased methylation. Rob Plotnikov stated that cold water
environments have very limited stratification and that modeling will inform the methylation
question.
Lori asked if there was a step for conducting a risk assessment for terrestrial species. Paul stated
that there was a sampling issue with terrestrial species and since fish were being evaluated the
higher trophic levels would be easier to predict. Lori stated that some bird species like the
kingfisher were possibilities and it would be good to know how much assimilative capacity
terrestrial species have. Paul stated he was confident that the risk to terrestrial species could be
evaluated based on the data being gathered.
Meeting Summary Page 11 of 11
Susitna-Watana Hydroelectric Project
August 15-17, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Wayne Dyok asked if everyone was ok with using the EFDC model. The general consensus of
the group was that would be okay. Wilson Jastin asked if the pathway analysis had predictive
powers to look into the future. Paul stated that it did and the idea was to predict conditions with
the reservoir in place.
Eric Rothwell asked when meetings will be scheduled to review stakeholder comments. He
stated that he didn’t want to have the meetings the day after stakeholder comments were due to
FERC. Betsy McGregor stated that AEA would like to have those meetings in September.
Steve Padula adjourned the meeting.
Susitna–Watana Hydroelectric Project
Agency Consultation on Proposed Study Plan for Landbirds/Shorebirds
Thursday, September 6, 2012 — 10:00 A.M.
AEA conference room, 411 West 4th Avenue, Anchorage, AK
Invitees: Maureen de Zeeuw, USFWS; Catherine Berg, USFWS; Steve Matsuoka, USFWS;
Kim King, ADFG; Brian Lawhead, ABR, Inc.; Terry Schick, ABR, Inc.; David Turner,
FERC; Betsy McGregor, AEA; Robin Reich, Solstice
[David Tessler, ADFG, will be unable to attend]
Goal: To understand, discuss, and resolve differences between agency comments/study
requests and AEA’s Proposed Study Plan, as discussed at the Terrestrial Resources
Technical Work Group meeting on Aug. 9, 2012, for incorporation into AEA’s
Revised Study Plan
Agenda Items:
1) Example of wildlife habitat mapping and evaluation approach proposed by ABR
2) Discussion and resolution of differences between USFWS study request (May 2012),
ADFG comments on AEA study request (May 2012), and AEA’s Proposed Study Plan
(July 2012):
Study-area size (1–10-mile vs. 5-mile buffers around Project area)
Point-count survey methods (level of effort, distance estimation, detectability, habitat
characterization) and relationship to Alaska Landbird Monitoring System protocols
Need for ‘study plots’ outside of Project area (Denali NP&P, Copper R. Basin, etc.)
Survey methods for riverine/fluvial species
Surveys of ‘overwintering’ birds and spring surveys of resident breeding species
Migration surveys using mist-netting and/or nocturnal sampling with radar
Other topics?
Meeting Summary
Susitna-Watana Hydroelectric Project Licensing
Landbirds and Shorebirds
Study Plan Meeting
September 6, 2012; 10:00 am–2:00 pm
AEA Project Offices, First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Attendees:
Organization Name
ADF&G Kim King
USFWS Maureen de Zeeuw
USFWS Steve Matsuoka
FERC David Turner (by phone)
AEA Betsy McGregor
ABR, Inc. Brian Lawhead
ABR, Inc. Nathan Jones
ABR, Inc. Terry Schick
Solstice Alaska Consulting, Inc. Robin Reich
MWH Kirby Gilbert
Assessing Habitat Loss Effects for Landbirds and Shorebirds
The steps to be conducted in assessing habitat loss impacts for landbirds and shorebirds for the Susitna-
Watana Project are described below. In the Proposed Study Plan (PSP), this information is described in
several different sections (Vegetation and Wildlife Habitat Mapping Study, Breeding Survey of Landbirds
and Shorebirds, and Evaluation of Wildlife Habitat Use Study).
1. Prepare a fine-scale wildlife habitat map in GIS by combining Alaska Vegetation Classification (AVC)
Level IV vegetation types (Viereck et al. 1992) and other landscape factors such as physiography,
surface form, soil drainage, disturbance type, as needed. The mapping methods are described in the
PSP (Vegetation and Wildlife Habitat Mapping Study). All mapping of landscape features will done
by photointerpretation, supported by ground-truth data for each of the landscape features in each
photosignature in the Project area. (As an aside, wetland types will be mapped during this effort
and separate jurisdictional wetland maps for the Project area will be created; the wetlands mapping
work will be done as described in the Wetland Mapping Study section in the PSP).
2. Preliminary mapping of wildlife habitats will be prepared and checked during the field ground-truth
surveys. Detailed information on plant species occurrence and percent cover, vegetation structure,
physiography, surface form, soils, and disturbance will be collected in the field during the ground-
truth surveys.
3. Field surveys for breeding landbirds and shorebirds will be conducted using standard point-count
methods with distance estimation, as described in the PSP (Breeding Survey of Landbirds and
Shorebirds and Land birds Study Plan
Susitna-Watana Hydroelectric Project
September 6, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 2 of 6
Shorebirds). Because the habitat mapping will not be complete at the time of the point-count
surveys, point-count locations will be allocated by photosignature type using stratified random
sampling. The goal will be to sample each photosignature type (habitat type) repeatedly over two
years of surveys. The habitat being used by each bird species at the time of detection will be
recorded whenever possible. The sampled habitat at the point-count location will be treated as the
“focal habitat.” On field forms, observers will record the use of the focal habitat (yes or no), and the
use of adjacent habitats will be recorded whenever feasible.
a. As described in the PSP, and agreed to in the meeting, the point-count surveys for
landbirds and shorebirds would occur at a different time (mid-May through mid-June)
than the ground-truth effort for the habitat mapping study (late June through August).
4. Overlay the point-count locations on the wildlife habitat map in GIS to link each point-count site
with the final mapped habitat type surrounding each site.
a. The group agreed that Kessel’s bird habitat classification system for Alaska (Kessel 1979)
should be crosswalked to the Level IV vegetation types of Viereck et al. 1992. Most of the
data needed for Kessel’s classification would be collected also for the Susitna-Watana Hydro
habitat mapping study (e.g., shrub height information would be collected). Steve Matsuoka
(USFWS) will send out a document that Colleen Handel (USGS) prepared that compares the
Kessel classification with Viereck; Steve’s recollection was that the two classification systems
are very similar. The ABR team will review that document and get back with the agencies on
a proposed classification for the mapping of wildlife habitats.
5. Determine how important each mapped habitat is to selected species of birds and mammals. This
work will be done as described in the PSP (Evaluation of Wildlife Habitat Use Study).
a. The product of the habitat evaluation study will be an array of each mapped habitat type
and each bird and mammal species to be evaluated, with the cells representing a habitat
value ranking category.
b. The habitat-value ranking categories are likely to be: “0” = negligible value, “1” = low value,
“2” = moderate value, and “3” = high value. The rankings for each species will be based on
how often the species is observed in that habitat using Project-specific data whenever
possible. For less common species with fewer observations, habitat-use information from
the literature will be used; Alaska-specific habitat-use information will be used as much as
possible. From a number of recent studies in the state and in Canada, there is more habitat-
use information available for boreal forest areas (i.e., there should be less need to evaluate
habitat use from studies in the lower 48 states). Some professional judgment likely will be
needed when observations or information from the literature does not exist for a particular
habitat. ABR will employ the professional judgment of bird and mammal biologists who have
worked in the state for many years (often with over 20 years of field experience).
c. The group agreed that the rationale and assumptions used in the habitat evaluation study
would be clearly documented. It is understood that just because a landbird or shorebird
Shorebirds and Land birds Study Plan
Susitna-Watana Hydroelectric Project
September 6, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 3 of 6
species is not observed or documented in certain habitats, does not mean that those
habitats are not used by that species. This is the case especially for species that are less
common and infrequently observed. ABR is aware of this and the habitat rankings for less
common species always take into account the number and quality of the field observations.
USFWS agreed that the Pebble Project documentation (which included individual sections
for each species assessed describing that habitat-use information used to determine the
habitat-value rankings), would be an appropriate model to follow on the Susitna-Watana
Hydro effort.
6. Finally, using GIS, overlay the Project footprint and disturbance buffers on the habitat map to
determine the acreages of each habitat type that would be directly affected (lost) or indirectly
affected (altered by disturbance) from Project activities.
Focal Species in the Landbird and Shorebird Surveys
All birds that are seen or heard will be documented, although in the habitat evaluation study (noted
above), a subset of species of concern will be evaluated for habitat use and, ultimately, habitat loss
effects.
The group agreed that the landbird and shorebird surveys should focus on the species listed in Table 2
of the Wildlife Data-Gap Analysis For The Proposed Susitna–Watana Hydroelectric Project, from
August 2011. Steve will review Table 2 further and provide feedback on the species listed, specifically to
determine whether any additional species of conservation concern could occur in the area, which should
be listed in the table. During the surveys, species that use riverine habitats, like Belted Kingfisher,
American Dipper, and several shorebirds will be sampled using a set of point-count surveys along the
Susitna River and tributary streams; the riverine corridors will be walked inbetween point-count
locations and all incidental observations of birds will be recorded.
The group agreed that a survey from a boat would be conducted to record breeding swallow colonies
along the Susitna River within the inundation zone. Swallows are a concern because the inundation
zone would flood swallow breeding habitats, including cliffs and cutbanks.
The group agreed that a winter survey for owls is not needed. Maureen said that although the current
study plan doesn’t adequately cover forest owls, additional field study isn’t needed. A good explanation
of the value of owl habitat should be assessed based on existing literature and field studies conducted in
Alaska.
Study Area Size
The Proposed Study Plan (PSP) identifies a 5-mile buffer around the Project footprint (roads, powerline
corridors, and inundation zone) in which landbird/shorebird surveys would be conducted.
The group agreed that a 2-mile study area buffer around the Project footprint will be adequate for the
landbird/shorebird surveys as long as the inundation zone and representative habitats within the
Shorebirds and Land birds Study Plan
Susitna-Watana Hydroelectric Project
September 6, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 4 of 6
Project area are sampled. The study area would not extend west of the Parks Highway near Cantwell or
beyond the east bank of the Susitna River and Chulitna River.
The group agreed also that the 5-mile buffer study area could be maintained for the mapping of
wildlife habitats.
The group agreed that additional point counts outside the Project study area, for example, within
Denali National Park or the Copper River Basin, are not needed. The USFWS noted, however, that
existing point-count data from those other areas could be used to bolster the habitat use information
used in the study (e.g., for less common species that are infrequently recorded), and the group agreed
this would be an important step to take in the analyses of habitat use for the habitat evaluation study.
Data from those other areas can be obtained by coordinating with Colleen Handel at the USGS.
Point-Count Survey Methods
The current level of effort for the landbird/shorebird surveys identified in the PSP is:
4 field crews of 2 people each
Assume at least 8 point counts per crew per day = 32 point counts per day
14 survey days total in May and June (beginning mid-May survey for shorebirds and early
nesting landbirds, and early June survey for Neotropical migrants)
Likely ~10 to 15 different habitat classes sampled in May and up to ~25 in June
Surveys in 2013 and 2014
Total number of point counts per year could be 448
About 900 point counts total for 2 years
No location would be visited more than once, except if randomly selected
USFWS and ADF&G (according to Maureen) do not think that this is enough field time to get an
adequate understanding of the number of birds using the Project area and to get density estimates.
USFWS thinks that there may be logistical and weather problems that could limit the number of actual
survey days. It is also known that interannual variability in numbers of breeding landbirds and
shorebirds can be substantial. USFWS also is concerned that the number of point counts conducted in
each habitat type (assuming ~25 habitat types will be mapped) may be low with level of effort noted
above. USFWS would like the sampling to occur continuously from mid-May to mid-June (approximately
a month).
The group agreed that the Alaska Landbird Monitoring System (ALMS) protocols should be used. The
ALMS methods allow for a determination of densities and would be comparable to other studies. The
group agreed that the ALMS methods can account for both how far away and how often birds are
calling (queuing rate). Distance analyses and removal analyses would be completed on the point-count
data (by species) to estimate densities of breeding landbirds and shorebirds.
The group agreed that existing detection functions, derived from other point-count studies in Alaska,
could be used in cases (e.g., uncommon species) in which data from the Project are too limited to
Shorebirds and Land birds Study Plan
Susitna-Watana Hydroelectric Project
September 6, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 5 of 6
derive adequate detection functions. Steve said that the distance analyses to determine bird densities
should not require an inordinately large effort.
The group determined that the addition of double-observer methods would not be needed and the
ALMS methods with distance analyses and removal analyses should be adequate. Steve indicated that
he thought the application of double-observer methods would result only in a small increase in the
reliability of the resulting density estimates and that the extra field and analysis effort was probably not
worth the return.
Overwintering/Resident Species
Maureen said that no winter surveys for landbirds are needed because sampling in mid-May would
probably be adequate in identifying resident species. She agreed that the winter bird surveys
completed in November/December 1984 and late January and late March 1985 would help in
determining which resident bird species use the Project area during the winter.
Migration Mist-netting
The group did not decide whether mist-netting should be used to determine if the inundation zone is
used as a stopover habitat for landbirds or shorebirds. Maureen noted that mist-netting could
potentially be used to determine whether the inundation area is an important migration stopover
habitat. Maureen said that determining the importance of the proposed inundation zone habitat is
important, since this habitat would be replaced by open water once the project is constructed. Terry
and Brian questioned where nets should be placed and how many nets and stations of nets would be
needed to understand the importance of the area for migration stopover. The utility of this method for
achieving the objective of determining the value of the affected area as a migratory stopover site was
considered to be equivocal.
Migration Radar Survey
The group did not decide whether a radar study should be conducted to quantify the volume of
nocturnal bird migration. Maureen said that the issue is potential bird collisions with project
infrastructure, which could be exacerbated by attraction to lights. She said that the biggest area of
concern is around the dam and associated facilities.
Terry said it would be possible to conduct an intensive collision-hazard study using visual observations
only in the corridor area once the corridor(s) is/are determined; such a survey would not address use of
those areas by nocturnal migrants, but, in comparison with the dam area, attraction to lights should not
be a problem.
Terry said that a radar survey around the dam site could be competed in the fall and spring, but collision
hazard likely is greater in the fall with the extended migration period and the increased number of birds
present (adults and juveniles). The radar work could be coupled with migration point counts. Brian said
that flight volumes from previous studies in the Tanana and Copper River valleys could be compared
Shorebirds and Land birds Study Plan
Susitna-Watana Hydroelectric Project
September 6, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Page 6 of 6
with the results of the study. Brian said that he would talk with ABR employees Brian Cooper and Bob
Day regarding the feasibility and design of radar studies for the Project.
Maureen said that wetland areas potentially used by migrating shorebirds should be surveyed at least
within or near the Project footprint. Terry indicated that such surveys would have to be ground-based
and that point counts are not really appropriate; more likely these surveys would need to be walking
transect surveys.
Study Method Decisions That Have Not Been Made
Landbird and shorebird point-count survey effort; the mid-May to mid-June timing was agreed
to be appropriate, but the number of days of point-count surveys needed remains unresolved.
Sampling method(s) to determine bird collision-hazard potential, especially for nocturnal
migrants.
Sampling method(s) to determine whether the inundation area provides stopover habitat for
migrating shorebirds and landbirds.
Action Items
Brian will follow up with Dave Tessler, ADF&G, since Dave was unable to attend the meeting.
Steve will try to locate a copy of Colleen Handel’s document that compares Kessel’s
classification with Viereck’s AVC and send it out to the group.
Steve will look over the list of bird species in Table 2 in the Wildlife Data-Gap Analysis For The
Proposed Susitna–Watana Hydroelectric Project to make sure all species of conservation
concern likely to occur in the Project area are included.
Brian will talk with ABR radar experts Brian Cooper and Bob Day regarding bird migration study
design considerations and logistics for this Project, as well as identifying information available
from previous radar studies.
MEETING RECORD
Record of Meeting Page 1 of 3
AEA Team Member Other Party
Name: Justin Hays, Cultural Resources Study Lead Name:
Organization: Northern Land Use Research, Inc. Organization: AEA
Study Area: AEA Office Phone
Number: 800-315-6338 code 3957#
Date: September 7, 2012 Time: 9:03am to 11:37am
Meeting held by: X AEA Team Other Party
Others at meeting:
Present:
Taylor Brelsford, URS
Bill Simeone, URS
Fran Seager-Boss, MatSu Borough
Kirby Gilbert, MWH
Betsy McGregor, AEA
Richard VanderHoek, OHA
John Jangala, BLM
By Telephone:
Chuck Mobley,CM &A
Scott Miller, NOAA
Angela Wade, Chickaloon
Katherine Martin, Ahtna
Dara Glass, CIRI
Frank Winchell, FERC
Subject: Cultural Resources Study Plan Workshop
Discussion:
Introductions around the conference room table and then teleconference participants. The
URS/NLUR study team introduced themselves and led the discussion of their study plan and study
efforts to date. General comments about the proposed study plan (PSP) were made with regards to
up-coming milestones. Katherine asked if Ahtna would still be able to provide comments about our
plan. Kirby informed her that they and all stakeholders can provide comments to the proposed study
plan (PSP) filed with FERC and distributed to interested parties on July 16, 2012. The next step in the
formal process is get all formal comments on the PSP by October 15th and then file an updated study
plan, or Revised Study Plan (RSP) with FERC on November 14th after the comments have been
addressed.
Angela asked if we had looked for culturally modified trees (CMT) this year. Justin described that the
study group had looked and recorded two in the study area. None of the CMTs were the braided
willow variety. It was agreed we need to incorporate the methods for recording CMTs in the RSP.
John inquired how we planned to determine the meaning of some tree modification beyond bark
stripping. We agreed it was a good question without a straightforward answer so some more follow up
is needed.
MEETING RECORD
Record of Meeting Page 2 of 3
Taylor gave the Project background to the meeting attendees. He defined what traditional cultural
properties are, and other types of cultural resources such as prehistoric lithic scatter and historic
mining claims. He informed the meeting attendees that we have a plan for inadvertent discoveries in
the field regarding resources and human remains.
The direct impacts APE was described by AEA as the impoundment area and adjoining transportation
and transmission facilities which are defined by three distinct corridors on the overall Project study
area maps. The current plan is that the normal maximum impoundment area is planned at elevation
2050 feet ASL. The draft APE maps used the 2,200 foot elevation study boundary and thus this needs
to be changed for the next series of maps. At this point in the Project planning process Kirby said they
did not know of locations of future campgrounds, boat launches, etc. but they would likely be added
after the recreation studies are complete and a recreation plan is developed, however the area we are
tentatively planning as indirect should encompass likely locations of such future development. The
transmission and road corridors themselves are buffered as an initial proxy indirect effects APE. They
could be thought of in terms of a buffer around a narrow corridor that will contract as studies progress
and things are better defined. We presented our 2-mile buffer map as a starting point of discussion.
We all agreed that recreation trails should be drawn even though the data is incomplete and the
indirect affect areas can extend along those trails possibly. It was also discussed that to refine the
coarse 2-mile buffer, we should use sub-watershed drainage basin boundaries adjoining the Project
features, as those would be likely locations where people in the future might move into (once the
Project is built), centering on drainage courses and not necessarily over the top of ridge lines. Betsy
mentioned we should also trim the buffer at the terminal ends of the corridors where they meet the
railroad. The Denali Hwy Susitna Bridge was another area that will likely see increased use as an
indirect result of the proposed project. John thought we should add trails that are near by the project
area that may extend or reroute as an indirect result of the project. Richard asked how the permafrost
would be affected due to the increase in temperature from adding a 39-mile lake. Betsy said mass
wasting studies have been on going and are looking at those types of effects.
Land status was another topic discussed in the meeting. We were directed to make new maps with
the most recent land status information and consider using with both topographic and aerial
photograph backgrounds. Kirby showed examples of map panels being produced for the Revised
Study Plan. Frank asked when we could have these new APE maps made, Taylor said by the end of
next week. There was a question about if there are any 14h1 ANILCA selections that BLM is
transferring to Ahtna within the study area. For those areas there was another question about
whether BIA done any surveys on any of those or other conveyed lands? Katherine thought that
Ahtna may have heard that there were some BIA surveys performed this summer in the region. Dara
at CIRI also wondered about this and follow up with BLM and BIA is needed.
There was general discussion that the locational model needed to be described in more detail in the
RSP. Frank said there was not enough information about how it will be used, reiterated, etc. Justin
indicated we would improve and enlarge that section in the RSP. Frank asked when we will be
producing the model as a geodatabase. Justin said it was already completed but that it still requires
input from this year’s data. Frank asked when that would be done? Frank then asked Richard if they
would concur with our RSP or at least the APE definition prior to the FERC filing. Rich said that his
office will be working with everyone as much as possible. Frank said that the APE can be modified
after the 11/14 filing date but we just needed to go forward with the best APE we have from the
information we presently have.
MEETING RECORD
Record of Meeting Page 3 of 3
Ethnogeography was described by Taylor to all participants. The language areas were introduced:
Ahtna, Tanana, and Dena’ina. Frank advised us to look where things are that might be affected in the
cultural landscape. We agreed to make a new language area map that showed more of the arbitrary
language family boundaries. We noted how the ethnogeography study will help inform not only the
archaeological survey strategy but also the other disciplines such as wildlife, fish, stream, etc.
The topic of having area interns was introduced by Taylor. Justin said that the idea today was to come
up with some ideas for internships. Both field and laboratory settings were suggested by Fran. John
said in the lower 48 states he had hired area guides to be present in places where they thought they
may encounter human remains during construction. Dara suggested our starting point should be to
contact the Alaska Heritage Center in Anchorage.
Fran asked Betsy if she could see the study area this year before a snowpack develops. She asked if
Justin would be willing to go in the field to show Fran the APE by air. Justin said yes and Betsy said
she would see when the next opening on the helicopter schedule would be and get back with us.
Action Items:
1. Incorporate CMT recording methods in the RSP
2. Draw maps with the new 2050 ft. impoundment area elevation
3. Incorporate updates to the indirect effects to our buffer map
4. Use newer land status map with mining claims and ANCSA designations
5. Identify if there is any BIA surveys information on conveyed land
6. Combine maps to show intensively tested areas next to unsystematic surveys
7. Augment methods section in RSP to reflect locational modeling
8. Maps of survey area by type (pedestrian and aerial)
9. Create new language area maps with larger scale
10. Contact the Alaska Heritage Center for possible internship applicants
11. Schedule next meeting for 9/24 1-3pm
12. All new maps are due for circulation by 9/21
13. Schedule aerial survey of APE in September
Page 1
Draft Minutes
Fisheries Study Plan Work Session
September 13, 2012
LOCATION: ADF&G Office
Denaina Conference Room
333 Raspberry Rd, Anchorage, AK 99518
TIME: 12:30 pm – 2:30 p.m. (AKDT)
CALL IN NUMBER: Conference Dial-in Number: (712) 451-6000
Participant Access Code: 603667#
SUBJECT: Fisheries Study Plans
GOAL: To define the processes that will be utilized for sampling stratification,
selection of sample sites, and techniques that will be applied by objective
and season.
12:30 – 12:35 Introductions, Review Meeting Objectives
Attendance: MaryLouise Keefe (R2)*, Steve Padula (LVA)*, Jack Erickson (ADF&G), Joe Klein,
(ADF&G), Stormy Haught (ADF&G), Monte Miller (ADF&G), Mike Buntjer (USFWS), Dani
Evenson (R2), and Kathryn Toews (LVA). *on the phone
MaryLouise Keefe reviewed the agenda and meeting objectives. She explained that this was going to be
a focused discussion on the Fish Abundance and Distribution study plans; the River Productivity study
plan would be discussed separately.
Sample Locations
MaryLouise Keefe set the stage for the discussion on study site selection by explaining that she
envisioned three levels of fish sampling:
1.) fish presence/absence and distribution
a. sampled for at many sites throughout the river
2.) relative abundance (Catch-per-unit-effort)and fish density
a. sampled for at various sites including “intensive study sites” to get representative
coverage
3.) population density
a. involves more robust sampling and statistical design
b. sampled for at the “intensive study sites”
Page 2
Study sites would be selected based on a stratified random design. The first level of stratification is by
Lower, Middle and Upper reach. The 2nd stratification level will be the 6 major mainstem habitat types:
main channel, side channel, side slough, upland slough, tributary, and tributary mouth. Due to the scale
of the Chulitna and Talkeetna rivers relative to the Susitna River above the Three Rivers Confluence,
sampling in the Lower River will go down to the level of major mainstem habitat type, as the potential
Project impacts in the Lower River is expected to be substantially moderated by the Chulitna and
Talkeetna rivers. For the Middle and Upper river, AEA is proposing to sample down to the mesohabitat
level. In Upper River tributaries, methods would be similar to that outlined in Buckwalter et al (2011)
which was also used in the 2012 Upper River Fish Barrier study. These methods suggest sampling
habitat units at 150-meter intervals upstream up to the 3,000 foot elevation level, as Chinook salmon
have been documented that high in an Upper River tributary.
For a visual reference of the classification tiers:
Fish presence/absence and distribution involves a low level of effort and therefore can be done at many
sites, but population level sampling requires a much greater level of effort and will occur at “intensive
study sites”. Keefe provided examples of the type of methods that would be used for each of the 3 levels
of sampling. For example, 1-pass electrofishing may be used for fish presence, and at intensive study
sites, block nets and multiple methods may be used. She stated that the goal of level one sampling was
Page 3
‘who’s home where’. She asked that everyone keep these three levels in mind as study site selection is
discussed.
Dani Evenson explained that intensive study sites would be locations where a full complement of studies
would occur– instream flow, geomorphology, ice, groundwater, riparian, and fisheries. Proposed study
reaches would be discussed in further detail at the September 14, 2012 instream flow Technical
Workgroup (TWG) meeting, but proposed sites were generally 1-2 river miles long and encompassed the
suite of habitat features. She added that there are essentially 2 approaches. Firstly, sites should be
representative and descriptive of the habitat types present in-river. Because there is data from the
1980s, the representative sites will be supplemented with critical sites- areas that are known to be
biologically important to fish. She also said that reaches where the 1980s studies did not document fish
would be included as well. An important goal would be to focus more empirically on early life history.
She showed a few examples of maps of proposed intensive study sites.
Joe Klein asked whether the first two levels, fish distribution and relative abundance, could be
combined. Jack Erickson remarked that they differ in terms of level of effort. To generate a catch-per-
unit-effort (CPUE) takes more effort than presence/absence. Dani Evenson pointed out that for some
methods, i.e., gillnetting, both levels are similar but for other methods such as electrofishing they differ.
Mike Buntjer asked why not just collect relative abundance data everywhere. Jack suggested that if that
was done the additional effort required would likely limit the total number of sampling sites.
Jack Erickson asked how population abundance/density would be estimated at critical sites. MaryLouise
said that mark-recapture would be used where possible. Jack Erickson said that it may be very difficult
to get abundance estimates; perhaps more rigorous and frequent sampling would yield sufficient
estimates of relative abundance.
Jack asked how rare species such as burbot would be sampled. MaryLouise Keefe responded that she
thought it was a good question. She indicated that if monthly sampling did not catch them, then specific
objectives would be developed to address rare species.
Joe Klein commented that he likes the scope of the proposed study plan, but would like to see more
detail.
Sampling Methods
Mary Louise Keefe discussed methods for sampling and said that they would be habitat and species
specific. Keefe stated that with 20 fish species and 3 freshwater life stages and sampling of up to 140
sites, it is possible that fish will be found at every sampling site. Erickson expressed sympathy over the
size and complexity of this study. Joe suggested that due to the relative short-timing window for open
water sampling (i.e., assuming June 1 – Sept 15 window gives only 14 weeks of field time),
considerations should be given to ensure a dedicated effort is made (e.g., during the 1980s, ADF&G’s
approach was to hire a lot of Fish Technicians and maintain a continuous field presence throughout the
summer to provide adequate manpower and availability for field sampling activities).
Keefe asked whether fish distribution and abundance was a worthy endeavor throughout the river.
Stormy Haught responded that it is important, but not at the expense of focal sites.
Monte Miller added that a “who’s home where” approach was important but “when” should be added
as well. There are specific traits of certain species– i.e., whitefish, burbot that make them hard to find at
Page 4
some times. Trot lines are age-selective; the life stage information is important. ADF&G generally
agreed the sampling effort to compare over space and time was valid. Discussion ensued about the
value of the population sampling effort and it was decided that relative abundance would be adequate
in place of population estimates.
The instream flow study includes an intergravel study and a Varial Zone study.
Mary Louise Keefe added that the approach would be flexible and sampling locations and methods
would be adjusted over the course of the study as new information became available. Mike Buntjer
mentioned the possibilities to adjust effort in 2014 based on 2013.
Added Specific Objectives
An objective to address burbot was discussed. The discussion was expanded to include white fish and it
was suggested that a new objective be added to the study that focuses on life history of winter
spawning fishes. Joe Klein will send contact information for the ADF&G biologist to discuss how to
further refine this objective.
Winter sampling
Joe Klein mentioned that he was struggling with specifics such as winter use, i.e., burbot spawning.
There will be limitations of access to sites during the winter months. This needs to be considered when
creating a schedule. Some methods discussed for winter field efforts included video, minnow traps, trot
lines. The 2012 pilot study created to determine feasible winter efforts was agreed by all as a good
tactic considering limited field seasons. MaryLouise Keefe mentioned a December 1st and April field
effort at two sites with the hopes of fitting in a November effort.
Permitting
Dani Evenson asked ADF&G whether it would be difficult to obtain a Fisheries Resource Permit for
specific methods such as electrofishing and gillnetting and if so, should methods be tailored in advance.
Stormy Haught responded that it is difficult for even ADF&G to get a permit to electrofish when adult
salmon are present (i.e., July through September) and that ADF&G has also expressed concerns with
gillnetting. It was agreed that permitting may be a limiting factor and that ADF&G Area Management
Biologist, who make the determination on permissible gear types, should be contacted as early as
possible in the process (Sam Ivey for the Susitna River).
Outmigrant trapping, radio tagging and PIT tagging
ADF&G mentioned concerns with using PIT tags. Monte Miller asked why half duplex tags were
proposed for use. In the Columbia River, PSMFC’s PIT tag data system, PITAGIS, uses full duplex tags.
He suggested reading a recent paper out of the USFWS Abernethy Lab, “Aquatic PIT Tag Interrogation
System Construction and Standard Operating Procedures (Steinke et al 2011). It was mentioned that it
would be worth contacting Doug McBride at USFWS. MaryLouise Keefe said that would be considered
as well as the manufacturer’s delay for tags. Stormy Haught added that the consequences of implanting
a 12 mm long tag in a 60 mm long fish should be considered.
Page 5
Stormy Haught asked what happens if a person eats a PIT tag. Monte Miller and MaryLouise Keefe
pointed out that on the Columbia River, this issue is ignored. PIT tags are encased in glass and have
some copper and other metals. It is an interesting question.
Dani Evenson discussed the location of outmigrant traps. She said that in the 1980s there were four
inclined plane traps deployed at Talkeetna Station, Sunshine, and near the mouth at Flathorn; one of the
traps was mobile. She summarized the comments of the USFWS discussion earlier in the day and asked
if ADF&G had any insights or preferences. Stormy Haught thought that outmigrant traps would be
valuable in Upper and Middle River tributaries.
Stormy Haught inquired as to the sample size for radio tags. Dani Evenson responded that the PSP
indicates 10 per species per habitat type in the Lower and Middle river. She also suggested not limiting
the sampling strategy by habitat type since fish may not be captured in all habitat types and the
opportunities to tag fish could be lost. ADF&G agreed, but wanted to make sure tags were distributed
longitudinally along the river. Monte Miller cautioned that all tags should not be deployed in one
location. MaryLouise Keefe agreed. MaryLouise Keefe asked if Eulachon Smelt should be included on
the list of fish to be tagged. ADF&G responded that since they are too small to tag they should be
dropped from the list, but they would like to see Arctic grayling added. To make sure all the species of
interest were included, Dani Evenson compiled the list- lamprey, humpback whitefish, round whitefish,
rainbow trout, grayling, burbot, Dolly Varden, and northern pike.
Monte Miller requested that the information be organized in a table by species explaining tagging
metrics by species including the type of tag (PIT or radio), # of individuals and any discrepancies. He
stated that it would be easier to understand how each species would be addressed. MaryLouise said
that it is a good suggestion.
Stormy Haught mentioned that the State has specific rules on fish anesthetics. Dani Evenson
responded that AEA’s study team is aware of those regulations and would comply.
Details are requested in the RSP including surgical methods, battery life and specifications which
determine battery life.
River Productivity
MaryLouise Keefe suggested scheduling a meeting for river production before the site visit on
September 26, 2012.
Page 1
Draft Minutes
Fisheries Study Plan Work Session
September 13, 2012
LOCATION: US Fish and Wildlife Service, Anchorage Field Office
605 W. 4th Ave, Room G-72
Anchorage, AK 99501
TIME: 9:00 am – Noon (AKDT)
CALL IN NUMBER: Conference Dial-in Number: (800) 315-6338
Participant Access Code: 3957#
SUBJECT: Fisheries Study Plans
GOAL: To define the processes that will be utilized for sampling stratification,
selection of sample sites, and techniques that will be applied by objective
and season.
Attendance: MaryLouise Keefe (R2)*, Betsy McGregor (AEA)*, Wayne Dyok (AEA)*, Steve Padula
(LVA)*, Mike Buntjer (USFWS), Betsy McCracken (USFWS), Matt Cutlip (FERC)*, Ethan Bell (Stillwater
Sciences)*, Fred Winchell (Louis Berger Group)*, Jeff and Gay Davis (ARRI), Brian Lance (USFWS), Phil
Hilgert (R2)*, Dani Evenson (R2), and Kathryn Toews (LVA). *on the phone
MaryLouise Keefe reviewed the agenda and meeting objectives. She explained that this was going to be
a focused discussion on the Fish Abundance and Distribution study plans; other study plans would be
discussed separately.
Sample Locations
MaryLouise Keefe set the stage for the discussion on study site selection by explaining that she
envisioned three levels of fish sampling:
1.) fish presence/absence and distribution
a. sampled for at many sites throughout the river
2.) relative abundance (CPUE)and fish density
a. sampled for at various sites including “intensive study sites” to get representative
coverage
3.) population density
a. involves more robust sampling and statistical design
b. sampled for at the “intensive study sites”
Page 2
Study sites would be selected based on a stratified random design. The first level of stratification is by
Lower, Middle and Upper reach. The 2nd stratification level will be the 6 major mainstem habitat types:
main channel, side channel, side slough, upland slough, tributary, and tributary mouth. Due to the scale
of the Chulitna and Talkeetna rivers relative to the Susitna River above the Three Rivers Confluence,
sampling in the Lower River will go down to the level of major mainstem habitat type, as the potential
Project impacts in the Lower River is expected to be substantially moderated by the Chulitna and
Talkeetna rivers. For the Middle and Upper river, AEA is proposing to sample down to the mesohabitat
level.
For a visual reference of the classification tiers:
Fish presence/absence and distribution can be done at many sites, but population level sampling
requires a much greater level of effort and will occur at “intensive study sites”. Keefe provided examples
of the type of methods that would be used for each of the 3 levels of sampling. For example, 1-pass
electrofishing may be used for fish presence, and at intensive study sites, block nets and multiple
methods may be used. She asked that everyone keep these three levels in mind as we discuss study site
selection. Keefe also reminded participants of the March meeting at which a site-specific habitat
classification system specific to the Susitna River was developed and adopted, and this classification
system includes application of the USFS Aquatic Habitat protocol for on the ground surveys.
Page 3
MaryLouise Keefe and Phil Hilgert explained that the mesohabitat characterizations are not the same
approach as the 1980s studies. The 1980s took a unique hydrologic based approach based on breaching
flows rather than a physical habitat approach.
M. Keefe and D. Evenson explained Intensive Study Sites; these would be locations where the suite of
studies would occur– instream flow, geomorphology, ice, groundwater, riparian, to enable modeling of
Project effects. Currently proposed sites are generally 1-2 river miles long and encompass the suite of
habitat features. Phil Hilgert added that there are essentially 2 approaches. Firstly, sites should be
representative and descriptive of the habitat types in river. Because data from the 1980s is available,
representative sites will be supplemented with critical sites- areas that are known to be biologically
important to fish. An important goal would be to focus more empirically on early life history. Hilgert
also mentioned that review of the potential intensive study sites would occur on Friday, September 14
during the instream flow TWG meeting.
MaryLouise Keefe explained that the plan is to collect data that are representative of fish communities
within the sampling strata, i.e. meso-habitats and/or geomorphic reaches and there is no plan to
extrapolate the abundance numbers to the river scale. There was much discussion about the ability to
extrapolate the data and to what level extrapolation is needed. Jeff Davis expressed concerned that the
data may not be representative if sites are selected without developing species- and life stage-specific
hypotheses. Others expressed concern that by focusing on what we think we know about target species
regarding habitat use, migrations, etc. we might miss something.
M. Keefe raised the importance of going back to what the Project effects were likely to be– access and
quality of different habitats as a result of regulated river flows. Clarification came, just prior to a fire
alarm, when Mike Buntjer noted that the general fish distribution and abundance sampling was only
directed towards Objective 1 of the study plan and was not intended to provide information for all study
objectives. MaryLouise indicated that yes all of the discussion of distribution and abundance was to
fulfill Objective 1, and added that additional objectives requiring the collection of fish samples would
also be addressed with this sampling scheme. Objectives regarding movements and migrations would
require a different sampling program to be discussed later in the meeting.
R2 clarified that fish distribution and abundance study sites will be selected randomly within
mesohabitats, with a goal of 25% of each habitat type being sampled.
SAMPLING FREQUENCY
MaryLouise Keefe suggested that frequency of sampling should be somewhere between 8 times per
year and monthly with more sampling occurring at intensive study sites. Specific objectives to sensitive
species or life stages would be in addition to baseline fish community characterization.
Sample frequency would increase based on parameters used to predict critical life stages. Depending on
the stage, a variety of collection techniques will be used, such as screw traps, fyke nets, and
electrofishing. Jeff Davis suggested that sampling occur bi-weekly during the critical periods for early life
stages of salmon.
JUVENILE SALMON
Page 4
Phil Hilgert referenced studies from the Pacific Northwest suggesting that fish <55 mm are highly
vulnerable to stranding and trapping in the Varial Zone. It is a concern that fish <55 mm will be
overlooked using the given methods. MaryLouise Keefe noted that attention must be placed on this
topic and that the group will address it later under the Additional USFWS Objectives agenda item.
MaryLouise Keefe stated that stranding will be captured in the Varial Zone study and it will include
physical parameters in spawning areas. Phil Hilgert pointed out that PHABSIM is an effective model for
spawning. The Varial Zone model would be used to evaluate trapping and stranding. This model
incorporates physical and biological elements (alevins, emergence, and fish up to 55mm). MaryLouise
also indicated that an intergravel temperature study was being developed by the instream flow program
for inclusion in the RSP.
Some of the participants remarked that they hadn’t seen the Varial Zone and Intergravel Temperature
study plans and requested more details.
Someone pointed out that juvenile salmon was missing from objective 2. MaryLouise Keefe said this
was an oversight and that it would be added.
OUTMIGRANT TRAPPING, RADIO TAGGING AND PIT TAGGING
Outmigrant traps are labor intensive and there was some uncertainty how many could be realistically
deployed. Discussion ensued about locations for 6 to 8 traps at the mouths of tributaries and lateral
habitats to focus on target salmon species. For example, to address Chinook salmon migrations,
consider placing a trap or two downstream in tributaries, such as Fog Creek, Kosina Creek, Potage Creek,
Indian Creek and possibly Gold Creek.
MaryLouise Keefe suggested that PIT tag arrays would be concentrated at intensive study sites and Dani
Evenson mentioned that the 1980s studies used 4 traps including one mobile trap, moving it as needed.
The 1980s studies were focused on getting information on the timing of outmigration and size at
migration. As in the 1980s, the possibility of one trap being mobile is up for consideration.
Which species are being tagged and how are they being selected? MaryLouise Keefe will address
before next meeting.
W INTER SAMPLING
There would be a pilot study in winter 2012-2013 in conjunction with instream flow studies. This study
would likely occur at Whiskers Creek and Slough 6a and will test different methods including DIDSON,
video, minnow trapping, and trot lines. This topic was tabled for future discussion due to a lack of
time.
ADDITIONAL OBJECTIVES FROM USFWS/NMFS.
Mike Buntjer said that he is interested in egg deposition through development post emergence. Jeff
Davis added that the movement of juveniles from incubation areas to rearing areas was also important.
Discussion ensued about additional empirical study needs.
MaryLouise Keefe summarized Mike Buntjer’s objectives for study as follows:
Page 5
1. How will the Project effect changes in temperature and survival? (There will be an Intergravel
study in the instream flow program).
2. How will flow fluctuations affect early life history? (The instream flow physical habitat model will
address this)
3. When are fish active- day vs. night?
4. Timing of movements with respect to flows to understand Project flow effects
MaryLouise said that her perspective was that USFWS was looking for additional empirical data such as
an incubation study. Mike and Jeff both talked about their concerns for incubating eggs, emerging fry
and small juveniles less than the size suited to PIT tagging. The USFWS is not necessarily looking for an
egg box study but is looking for information on emergence timing, and success of fry to leave spawning
habitat and move into rearing habitats. MaryLouise Keefe summarized the process to study fry
emergence and movement. The first step is a desktop analysis based on spawning timing and degree
days for incubation, the results of which will help narrow down the time frame for sampling. Secondly,
sample frequency would be increased, and then a variety of methods would be applied. Jeff Davis
suggested sampling bi-weekly during the critical periods.
Discussion ensued about conducting an early life history study for Chinook, coho and sockeye salmon.
Jeff Davis asked when habitat quality of incubation habitat would be discussed. MaryLouise and Phil
suggested that he bring that up the following day at the instream flow meeting.
Susitna–Watana Hydroelectric Project
Agency Consultation on Proposed Study Plans for Selected Mammals
Thursday, September 13, 2012 — 10:00 A.M.
Alaska Department of Fish & Game, Fischer Conference Room, 67th St. building, Anchorage
Invitees: Mark Burch, Kim King, Earl Becker, Howard Golden, Todd Rinaldi, David Tessler, all
of ADF&G; Brian Lawhead & Alex Prichard, ABR, Inc.; David Turner, FERC; Betsy
McGregor, AEA; Robin Reich, Solstice Alaska Consulting
[Terry Schick & Nate Schwab of ABR plan to join for latter portion of the meeting]
Goal: To understand, discuss, and resolve differences between ADF&G comments on
AEA’s study requests and Proposed Study Plan, as discussed at the Terrestrial
Resources Technical Work Group meetings on June 6 and August 9, 2012, for
incorporation into AEA’s Revised Study Plan
Agenda Items:
1) Discussion and resolution of differences between ADFG comments on AEA study
request (May 2012) and AEA’s Proposed Study Plan (July 2012):
Analytical techniques for bear population density; survey methods for downstream
study area along anadromous streams (DNA, stable isotopes)
Survey methods for wolverine & aquatic furbearers (river otter, mink, beaver,
muskrat)
Survey methods and study area for Dall’s sheep
Other topics, if needed (terrestrial furbearers? big game species?)
2) Break-out meeting, after above session, with Dave Tessler [Terry Schick will join]:
Wildlife habitat evaluation
Survey methods for bats [Nate Schwab will join via teleconference]
Survey methods for wood frogs
Survey methods for landbirds/shorebirds (follow-up to Sep. 6 meeting with USFWS)
Meeting Summary
Susitna–Watana Hydroelectric Project Licensing
Alaska Department of Fish and Game (ADF&G) Office, Fischer Conference Room
333 Raspberry Road, Anchorage, AK
Wildlife Program Meeting on Selected Study Plans (Mammals, Frogs, Landbirds/Shorebirds)
September 13, 2012, 10:00 a.m. – 3:50 p.m.
Attendees:
Organization Name
ADF&G Wildlife Conservation Mark Burch
ADF&G Wildlife Conservation Kimberly King
ADF&G Wildlife Conservation Earl Becker
ADF&G Wildlife Conservation Todd Rinaldi
ADF&G Wildlife Conservation Howard Golden
ADF&G Wildlife Conservation David Tessler (joined at 1:20 p.m.)
FERC David Turner (by phone, left at 12:00 p.m.)
AEA Betsy McGregor
ABR, Inc. Brian Lawhead
ABR, Inc. Nathan Schwab (by phone, 1:30–2:00 p.m.)
ABR, Inc. Alex Prichard
ABR, Inc. Terry Schick (joined at 1:30 pm)
Solstice AK Robin Reich
Brian opened the meeting with introductions and briefly summarized the Proposed Study Plan (PSP) and
the 16 study plans for wildlife before beginning discussion of specific study plans.
Analytical Techniques for Bear Population Density Modeling
No field surveys are planned for bears. The group agreed that existing data from previous line-
transect surveys conducted by ADF&G would suffice for the analysis.
Earl said that it may be possible to apply a recently developed spatial density modeling
technique, which uses distance sampling data from line transects, to existing regional survey
data for bears and derive a density estimate specifically for the Project area and surrounding
areas nearby, which were surveyed in the past during two different survey efforts.
This modeling effort would need to be developed by ADF&G working cooperatively with the
originator of the technique, who recently moved to the University of Rhode Island from
Scotland.
The work would begin in 2013 and would need to be completed in winter 2013–2014, preferably
by the end of 2013. A study plan description and cost estimate for this work is needed from
ADF&G by October 10, 2012 so that it can be incorporated into the revised study plan.
Bear Survey Methods for Downstream Study Area Along Anadromous Fish Streams
Fieldwork is needed downstream of the inundation zone to investigate bear use of, and
numbers in, fish-spawning areas that could be impacted by alteration of flow. ADF&G stated
that DNA and stable-isotope data could be collected from hair samples to determine the
minimum numbers of bears and their diet, respectively.
Meeting Summary: Wildlife Study Plan for Selected Mammals Meeting Page 2 of 6
Susitna-Watana Hydroelectric Project
September 13, 2012 10:00-3:00 pm
Alaska Department of Fish and Game (ADF&G) Office, Fischer Conference Room
333 Raspberry Road, Anchorage, AK
The group agreed that anadromous waters cataloged within the middle reach of the Susitna
drainage should be examined. The study area will be modified to include and depict cataloged
anadromous fish streams.
ADF&G suggested using hair traps that capture one individual’s hair (and then close) rather than
using hair snags. Check with Laverne Beier for more details on this sampling approach. ADF&G
suggested that scat also could be used for DNA sampling.
Survey Methods and Study Area for Dall’s Sheep
Brian mentioned that the goal of the Dall’s sheep study is to understand sheep use of natural
licks and obtain a minimum population estimate of sheep using the Project area, rather than
generating a statistically robust population estimate. The latter approach (using a line-transect
method developed recently by the National Park Service) would pose unacceptable safety risks
to aerial survey crews, so ADF&G’s more traditional aerial survey method is proposed.
The group decided the study area should be revised to incorporate more area north of the
Susitna River. The group discussed using a watershed approach to define the study area,
instead of applying a buffer around the Project area.
Study Methods for Terrestrial Furbearers
ADF&G is supportive of the proposed terrestrial furbearer study, but offered some suggestions
to improve the study plan.
Earl and Howard said that applying standard mark/recapture techniques to derive furbearer
population estimates poses some problems in the proposed study area because of the expected
low densities (and thus low sample sizes) of furbearers available for capture, particularly during
the low phase of the snowshoe hare population cycle, and because of potential problems with
capture heterogeneity and population closure assumptions. Instead, Earl recommended using
spatially explicit capture-recapture (SECR) model/cluster-grid sampling to account for spatial
variability and differential capture probability. A suggestion also was made to consider
extending the length of the study to allow population estimation techniques to be modified, if
necessary.
ADF&G said that coyotes are potentially important for game management because coyotes
could be positively impacted by the Project. If coyote numbers increase, there could be
negative impacts on prey species such as Dall’s sheep.
ADF&G said that the Project could result in increased trapping pressure on furbearers by
improving access. Because furbearer population density is naturally variable, it will be difficult
to determine indirect Project impacts.
Study Methods for Aquatic Furbearers
Brian mentioned that USFWS is interested in population estimates of river otter and mink in the
inundation zone and areas downstream for use in assessing the potential risks of mercury
bioaccumulation to piscivorous wildlife. He then described a discussion he had with Dr. Steve
Buskirk, who conducted the furbearer studies for the original Susitna Hydro Project in the 1980s,
regarding the low abundance of river otters and mink in the study area, as well as the difficulty
of working in the area, which makes development of reliable population estimates problematic.
Meeting Summary: Wildlife Study Plan for Selected Mammals Meeting Page 3 of 6
Susitna-Watana Hydroelectric Project
September 13, 2012 10:00-3:00 pm
Alaska Department of Fish and Game (ADF&G) Office, Fischer Conference Room
333 Raspberry Road, Anchorage, AK
ADF&G agreed that developing population estimates for otters and mink will be difficult,
although enumeration of beavers and muskrats would be much more straightforward and
amenable to aerial survey methods. A mark/recapture study would be difficult with low-density
populations. Density estimation methods have been developed for coastal river otters by
examining latrine sites or by obtaining hair samples for DNA analysis, but applying those
methods to a low-density interior population would be difficult and time-consuming.
Presence/absence surveys would be sufficient, in view of the large size of the Project area. It
would take a large amount of work to develop a potentially poor estimate of uncommon species
such as river otter and mink.
Howard suggested getting relative abundance information by surveying river otter tracks from
the air. The method would involve flying the study area after snowfall and using GPS to mark
tracks (specify single versus many tracks). ADF&G suggested flying the area for 2 to 3 days, 2 or
3 times in a season.
Earl said that winter track surveys of furbearers should be done by estimating the number of
segments and number of networks.
Howard said that mink are more difficult to study than river otter; for this reason, he suggested
that the aquatic furbearer study should focus on river otters and not try to focus on mink. The
use of aquatic trackbeds to detect mink would require an intensive effort for a small number of
animals. Howard suggested consulting with Dr. Merav Ben-David at the University of Wyoming
because of her experience working on these species in coastal Alaska.
Howard said river-bank surveys to determine beaver density and caches are difficult because of
the tree canopy. He agreed that helicopter surveys in fall (after leaf-fall and before freeze-up) to
detect fresh caches are the best way to enumerate active colonies. He recommended noting all
lodges and fresh food caches. Muskrat pushups can be readily detected by aerial surveys, as
proposed in the study plan.
Study Methods for Wolverines
ADF&G (Howard, Earl, and Todd) said that the sampling blocks (quadrats) for the SUPE should
be 25 square kilometers, not 25 square miles. The study area should be “squared up” to avoid
issues with animals leaving and reentering the study area. (The group redrew and agreed on the
revised study area boundary.) Howard said that quadrats should be stratified based on the
likelihood of seeing wolverines.
ADF&G said that the aerial survey should be done 12 to 36 hours after a snowfall. February and
March are the best times to do surveys because of increasing daylength and abundant snow but,
later in that period, some females might not be out of maternal dens because of the presence of
small youngsters.
ADF&G said that there could be issues determining when/where the snowfall occurs. Also, wind
effects may cause problems by wiping out tracks at higher elevations. ADF&G suggested hiring
pilots to do reconnaissance flights to assess snow depth and freshness (besides fresh snowfall,
enough snow to cover low shrubs is needed).
Only one good survey needs to be done to get adequate information to calculate population
density. The work should be attempted in 2013, however, because the survey might need to be
attempted again in 2014 if suitable conditions do not occur in 2013.
Meeting Summary: Wildlife Study Plan for Selected Mammals Meeting Page 4 of 6
Susitna-Watana Hydroelectric Project
September 13, 2012 10:00-3:00 pm
Alaska Department of Fish and Game (ADF&G) Office, Fischer Conference Room
333 Raspberry Road, Anchorage, AK
ADF&G recommended dropping the study plan objective regarding habitat associations because
a single survey effort would not be adequate to provide that information. The most effective
way to obtain good data on habitat associations for wolverines is to use GPS telemetry.
ADF&G is concerned about the ability of wolverine populations to sustain themselves in the face
of harvest pressure. It is difficult to sustain a population anywhere where wolverines are
actively trapped without recruiting replacement animals from outside of the harvest area; that
is, harvested populations appear to need nearby refugia where harvest pressure is low to
provide a population source of dispersing animals. The Project should look at harvest data to
determine levels of harvest in the Project area. Denali National Park (which is not trapped) and
other areas with difficult access may provide additional wolverines. This information would help
with ADF&G management decisions.
Lunch break, 12:30–1:30 p.m.
Study Methods for Bats
Brian said that, although there was only one record of a bat (presumed to be a little brown bat
(Myotis lucifugus) from the 1980s Susitna Hydro Project studies, bats are assumed to occupy
suitable (forested) habitats in the Project area.
Dave Tessler said that ADF&G has received reports of bat records in Alaska for every month of
the year. The records are all associated with structures and bats may be hibernating in
buildings. Bat sightings are reported most commonly between mid-August and late
September/mid-October, after juveniles have become flight-capable.
Dave said that the bat study should identify topographic features that may be suitable as roosts
or hibernacula, although it is recognized that the field effort can’t feasibly survey all dead trees
(snags) or rock crevices. The study should assess habitat suitability. Human structures are good
habitat and should be identified through a survey of historical resources and other dwellings.
Use of broadband ultrasonic detectors in different forest habitats within the reservoir
inundation zone should be conducted throughout the entire flight season (between emergence
and hibernation). Dave approved of the use of Anabat™ detectors, as proposed in the study
plan.
Dave said that an acoustic survey should be conducted throughout the area of interest during
the first year of study (2013). In the second year (2014), the acoustic survey should focus on
following up on detections from the first year’s surveys. Dave suggested scaling down the
listening time (reducing sampling to match night length) around solstice.
Dave said that acoustic sampling won’t be appropriate for identifying bat habitat associations. A
structure and geological features inventory should be completed to determine where bat roosts
and hibernacula could be located.
Dave suggested focusing on the Project infrastructure area and reservoir inundation zone and
not in the access and power transmission corridors. He said that efforts should focus on areas
where there are geologic features and historical structures of any size, including small cabins.
Dave agreed that the study won’t be able to determine Project impact levels, but impacts on
bats could be inferred from the wildlife habitat evaluation.
Dave said that the Project likely will not have much impact on bats, although there would be a
direct threat if bat hibernacula occur in the inundation zone.
Meeting Summary: Wildlife Study Plan for Selected Mammals Meeting Page 5 of 6
Susitna-Watana Hydroelectric Project
September 13, 2012 10:00-3:00 pm
Alaska Department of Fish and Game (ADF&G) Office, Fischer Conference Room
333 Raspberry Road, Anchorage, AK
Study Methods for Wildlife Habitat Evaluation
Terry outlined the procedure proposed for mapping wildlife habitats and evaluating wildlife
habitat use for the Project. Wildlife habitat mapping would be a local-scale effort based on fine-
scale imagery (1-m pixels or less), and the wildlife habitat evaluation would be prepared using
those mapping data. Dave Tessler said that the Alaska Gap Analysis Project (GAP) map data are
at a coarser scale than what is planned for the habitat mapping and evaluation studies for the
Project. GAP data are derived from coarse-scale satellite imagery, using 30-m pixels, so the
resulting habitat-use information also is coarse-scale (most suitable for regional-scale analyses).
Dave suggested that it would be helpful if the wildlife habitats mapped for the Project could be
crosswalked with the habitats defined in the GAP mapping. Keith Boggs and Tracy Gotthardt at
the Alaska Natural Heritage Program should be consulted regarding data comparisons between
the Project and Alaska GAP. The Alaska GAP data may be suitable to provide a regional-scale
context for assessment of Project impacts. Such a regional-scale assessment would complement
the local-scale impact assessment that is planned using the fine-scale habitat mapping for the
Project.
Study Methods for Wood Frogs
Dave Tessler said that the Project should gather data on fish presence in waterbodies to
determine whether frogs are present. Where fish occur, it is very unlikely that frogs will be
present. Dave said that any flooded vegetation could be breeding habitat for frogs. There is no
minimum size of waterbody (very small flooded areas can be used for breeding) and generally
larger waterbodies are not frog habitat because of the presence of fish. Betsy noted that a
number of waterbodies will be studied in the fish study program for the Project, so data will be
available on fish occurrence in many waterbodies.
The PSP described a method for breeding frog surveys employing a single visit to each
waterbody with two observers, timed during the peak calling period for male frogs. Dave said
that, because of variability in calling among male frogs, a negative detection at a particular
waterbody during a single visit does not prove that frogs aren’t there. If the waterbody
supports fish, however, then that negative detection is likely to be accurate.
Dave mentioned that the USGS amphibian monitoring protocol suggests a second visit to
improve detectability and occupancy estimates. He suggested conducting two visits in May
because the peak calling period can be difficult to identify in a given year.
Alex noted that occupancy estimates are likely to be more robust statistically if two or more
visits are made to each waterbody.
Terry noted that multiple visits to each waterbody could be performed within fairly reasonable
cost and time constraints, but only if the number of waterbodies to be surveyed was not
excessively large.
Dave suggested that the Project may result in direct loss of breeding habitat in the inundation
zone, as well as indirect effects in the access corridor due to road-related transmission of
contaminants or possibly chytrid fungus, but that effects are unlikely to impact wood frogs on a
regional or global level.
Dave said that frogs don’t need to be collected to determine the presence of chytrid fungus.
Instead, a simple swab of the frog is all that is needed. Meg Perdue or Mari Reeves (USFWS) can
suggest suitable laboratories to analyze swab samples from frogs.
Meeting Summary: Wildlife Study Plan for Selected Mammals Meeting Page 6 of 6
Susitna-Watana Hydroelectric Project
September 13, 2012 10:00-3:00 pm
Alaska Department of Fish and Game (ADF&G) Office, Fischer Conference Room
333 Raspberry Road, Anchorage, AK
Study Methods for Landbirds/Shorebirds
Dave Tessler noted that, based on subsequent discussions he had with Maureen de Zeeuw of
USFWS, his concerns had been addressed during the previous meeting on the
landbirds/shorebirds study (September 6, 2012), which he was unable to attend.
Dave emphasized that the observers used in the point-count surveys for the
landbirds/shorebirds study should undergo distance estimation training and testing before field
surveys are conducted.
Dave said that, although he sees some validity in using double observers, the USFWS
recommendation of employing distance and removal analyses based on standard Alaska
Landbird Monitoring System (ALMS) field methods would be adequate.
Dave agreed with the USFWS recommendation of conducting point counts over a longer period
of time than currently proposed in the PSP, largely because weather and logistics constraints
may limit the number of point-count samples collected.
Dave said that getting an estimated 440+ point counts each year was a good goal and that it was
not necessary to revisit those same sites in the second year. He emphasized the need for a
longer sampling period, however (as above), and also noted the difficulty of finding a large
number of qualified observers to conduct these surveys.
Version October 31, 2012 Page 1
Draft Meeting Summary
Instream Flow Study-Fish, IFS-Riparian
Groundwater, Ice, Geomorphology, Water Quality
Technical Work Group Meeting
14 September 2012
LOCATION: AEA Project offices – 1st Floor Conference Room
411 W 4th Avenue; Suite 1
Anchorage, Alaska 99501
TIME: 8:00 am – noon; 1:00 pm – 3:45 pm (AKDT)
SUBJECT: Preliminary Instream Flow Study Site Selection
Attendees: Bob Henszey USFWS, Jeff Davis ARRI, Gay Davis ARRI, Leslie Jensen ARRI, Dudley Reiser
R2, Joe Klein ADF&G, Phil Hilgert R2, Betsy McCracken USFWS, Kevin Fetherston R2,
Stormy Haught ADF&G, Michael Buntjer USFWS, Betsy McGregor AEA, Michael Lilly
GWS, Ron Benkert ADF&G, Dani Evenson R2, Kathryn Toews LVA, Marielle Remillard
GWS, Paul Dworian URS, Wayne Dyok AEA, Joetta Zablotney R2, Mark Lamareaux Village
of Eklutna, Bill Fullerton TetraTech , Robin Beebee HDR
On the phone: Rob Plotnikoff TetraTech, MaryLouise Keefe R2, Kim Sager ADNR, Matt Cutlip FERC, Fred
Winchell Louis Berger, Matt Love Van Ness Feldman, Steve Padula LVA, Becky Long
Coalition for Susitna Alternatives, Tim Ruga Louis Berger, Ethan Bell Stillwater, Krissy
Plett ADNR
This meeting was focused on the Study Site Selection process. Dudley Reiser noted that since there had
been many different issues and questions raised regarding the instream flow study, the plan moving
forward was to have TWG meetings that would focus on and advance the state of understanding issues
central to moving the study forward. This meeting was focused on Study Site Selection, but there will be
other meetings scheduled that will focus on Methods selection, Habitat Suitability Curve development,
Periodicity, and more topics. More information regarding specific TWG meeting topics and schedules
would be provided in subsequent TWG meetings.
Following introductions, there were a series of four PowerPoint presentations prepared by Dudley
Reiser and Phil Hilgert (Instream Flow Study – Fish), Kevin Fetherston (Instream Flow Study -Riparian),
Bill Fullerton (Geomorphology), and Robin Beebee (Ice Processes). The presentations are available on
the Susitna-Watana Hydroelectric Project website (http://www.susitna-watanahydro.org/meetings/).
It was explained by AEA and study leads that the process being discussed during this meeting related to
site selection is a first cut and that refinements would be made based on further information (e.g.
results of habitat mapping) and further discussions with the TWG.
Status of Reach Stratification and Habitat Mapping
Version October 31, 2012 Page 2
Habitat classification was explained by Dudley Reiser in the following hierarchical arrangement (NOTE -
this figure was not presented at the meeting but is included here to summarize the classification
system).
The current study sites were selected based on interpretation of the high resolution aerial imagery
gathered with the LiDAR data by the Mat-Su Borough in 2010 and 2011. The study areas will be further
refined as additional data (e.g. 2012 ADCP transect data, habitat mapping videography) become
available.
River Mile Designation
Joetta Zablotney presented the work underway to create a current GIS hydrography data layer for the
Susitna River as well as the naming convention for tributaries and features in the mainstem Susitna
River, such as side channels, side sloughs and upland sloughs. The hydrography and thalwag location is
being determined by the current aerial imagery and the ADCP transect data. The new river mile system
being created will be utilized project-wide. A crosswalk will be created to compare the historical and
current river miles.
Joe Klein asked if river mile (RM) 0 will be located at mean low tide. Dudley Reiser indicated that is
under discussion. Mean low tide may be designated as zero or as a negative number (i.e. distance) from
Version October 31, 2012 Page 3
the existing/historic river mile zero. The location of mean low tide needs to be determined. Betsy
McGregor added that the updated mapping will be made available (once finalized), through the ADNR’s
website for the Susitna Watana Project.
Jeff Davis questioned which study is sampling to the level of meso and/or microhabitat. Habitat
mapping will be done as part of the Aquatic Habitat Characterization study (see Section 7.9 of the PSP).
Currently, all proposed intensive study sites are based on mainstem habitat types, as that is the most
specific information presently available. Jeff Davis pointed out that species are affected on a
microhabitat level. Videography of the middle river has been gathered for mesohabitat mapping
purposes and is currently being processed; habitat types may be refined based on that data as well as
additional data gathered in the field. Betsy McGregor mentioned that the videography, when finalized,
would also be available on ADNR’s website; Courtney Smith at ADNR is the contact person for the
Susitna-Watana geodatabase.
Study Site Selection/Extrapolation Criteria
Intensive study sites1 (i.e. Focus Areas) were chosen to represent many aspects of the respective river
reach including fish habitat, geomorphology, water quality, groundwater and riparian resources. The
objective of this approach is to evaluate and determine relationships between main channel flow in the
Susitna River and the quality and quantity of habitats within off-channel habitats (e.g. side channel, side
slough, upland slough, tributary mouths). It is anticipated that the study results within these areas will
be extrapolated and applied to a larger scale of the river.
Bill Fullerton stated that the lower river stations were sampled at a single flow in 2012. Sampling at
additional flows is an option in the future if additional data are deemed necessary.
With respect to the selection of the Focus Areas, raptor nest locations will need to be factored in, as
there are buffer requirements during the nesting season to avoid disturbance to the birds. Other Focus
Area selection considerations include accessibility and land ownership. Phil Hilgert noted that data from
the 1980s had been reviewed and factored into the identification of the candidate Focus Areas as listed
in the PowerPoint presentation. Site selection completed in 1981 and 1982 was extensive and
incorporated a random selection approach. Sites became more focused in 1983 and 1984 as
information became available indicating where the highest fish use occurred. Dudley Reiser noted that
there was an extensive amount of data collected in the 1980s and that it is important to use and apply
these data in planning future studies. Other sources of information that will be used in determining
Focus Areas include results of the 2012 studies and the LiDAR data. Wayne Dyok added that the
dramatically changing water conditions this year may help to understand conditions associated with
Project operations.
Preliminary Study Site/Focus Area Selection
1 During the course of the meeting, this terminology “intensive study sites” was modified to “Focus Areas”.
Version October 31, 2012 Page 4
Jeff Davis voiced concerns of sampling in turbid water and the difficulty of differentiating whether there
are no individuals present (if not collected) or if the methods simply limit the collection of the
individuals. He feels that sampling methods need to be suitable to have confidence in the results. Phil
Hilgert indicated that sample sites will be in both turbid and clearwater areas. Focus Areas: Phil Hilgert
noted that Focus Areas will be used to sample across resource disciplines (fish, habitat, riparian,
geomorphology, water quality, ice, groundwater). The areas will not necessarily be the only locations of
data collection for each resource area, but will serve to provide a more comprehensive understanding of
how specific areas are influenced by and respond to main channel flows. Study Leads (Phil Hilgert, Kevin
Fetherston, Bill Fullerton, Robin Beebee) presented proposed river reaches and Focus Area descriptions
(refer to presentations available on AEA’s website for the 9/14/2012 Instream Flow Study-Fish, IFS
Riparian meeting). These Focus Areas were selected as representative of the respective geomorphic
river reach in which they are located and include all mainstem habitat types. Joseph Klein asked if the
entirety of each Focus Area will be evaluated by, for example the riparian study. Phil Hilgert indicated
that this would be the case. He further explained that the reason no Focus Areas were identified
between MR3 and MR4 was for safety concerns related to their proximity to Devils Canyon. It was
emphasized that safety will take precedent in conducting all studies so that locations with dangerous or
hazardous sampling conditions would not be selected
Some added details regarding specific Focus Areas that were discussed are as follows:
The MR1 Focus Area includes a portion of a side slough. It was noted that the upstream portion
of the slough was not included in the area and a concern was raised regarding the absence of a
hydraulic control for that slough in the area. New boundaries were considered and Phil Hilgert
mentioned that there will likely be some adjustment in final boundaries of the Focus Areas. He
mentioned that a location downstream of current proposed Focus Area was discussed during an
internal meeting but was deemed less representative of side channel habitat types.
The Focus Area in MR2 (upstream site) will likely include a gross mesh (i.e. larger spacing) in the
main channel and a finer mesh (more dense spacing) sampling strategy in the side channel areas
when applying 2D modeling. This Focus Area is representative of rearing habitat and of features
found between Devils Canyon and the proposed Project site. This area was not studied in the
1980s because the 1980s design concept included 2 dams and this area coincided with the lower
reservoir that is not part of the current Project. This area includes groundwater and surface
water as well as multiple geomorphic characteristics.
MR5‘s Focus Area includes Portage Creek and is representative of the MR5 reach.
With respect to the Focus Areas in MR6, Joe Klein mentioned that he knows of coho presence
above the boundary shown in Slough 8A. He asked for fisheries work to cover that area.
Michael Lilly clarified that other studies would include sampling outside of Focus Area
boundaries as appropriate to each particular resource. Dudley Reiser indicated he observed
chum and sockeye spawning in Slough 8A during 2012 field reconnaissance. He also noted there
were no beaver dams present at this site on September 13, 2012. Robin Beebee noted that in
some cases, the absence of beaver dams may reflect areas where ice jams are not present and
Version October 31, 2012 Page 5
the river narrows. She thought Slough 8A would be a good location for evaluating effects of the
Project in the winter because the added winter flow would likely flush this area.
Betsy McCracken requested that Focus Areas include both areas where fish occur and areas
where no fish occur. Phil Hilgert noted that few/no fish were observed in Slough 17 which is
part of the Indian River Focus Area (MR6). The Focus Area at Indian River (in MR6) was actually
selected because it had this side slough (Slough 17) which looks similar to Slough 6A which did
support substantial fish use in the 1980s. Adding the river delta at Indian was another factor in
choosing this site. He also reiterated that no fish sampling was conducted in the 1980s at the
Focus Area sites above Devils Canyon. Kevin Fetherston pointed out there were sharp lines
between areas with meadows and trees and hypothesized this may be due to ice shear. Beaver
dams can also form meadows. This site includes such meadows and will ensure that such
habitats are studied.
Robin Beebee discussed Slough 21 (in MR6) as having characteristics considered interesting for
the ice processes study. According to the 1980s data, a channel in this area seems to have been
created by river ice. Based on the 1980s simulation, this area will incorporate the edge of ice
formation on the river after the Project effects are established. Jeff Davis also mentioned that
Slough 21 is a sockeye spawning location. Spawning was seen in the 1980s but not in 2012. This
slough currently includes a beaver dam complex; beaver dams were likewise mentioned in the
1980s at this location.
Whiskers Slough is a Focus Area in MR8 that supports chum salmon spawning. Jeff Davis asked
why chum would prefer this area since it is not distinguishable from other areas in the river. He
asks that studies be developed to address this question.
Slough 11 (also in MR6) is downstream of Gold Creek and the railroad bridge. Studies of this
area were done in the 1980s. However, access to railroad property may constraint sampling
intensity at this focus area. Dudley Reiser stated that spawning was seen on September 13,
2012 just down from the beaver dam.
Dudley Reiser noted that while no specific proposed Focus Areas had been identified yet for the
lower river, plans were to select one or more sites. The 2012 salmon radiotelemetry data would
be used to identify specific study locations in the lower river section.
Critical Sites: Critical sites will be added to emphasize particular life stages. Jeff Davis asked what
classification scale the critical sites would be based on (mainstem habitat type, mesohabitat or
microhabitat). Dudley Reiser explained that the life stages may be associated with either a mainstem
habitat type or mesohabitat type.
Betsy McCracken and Jeff Davis asked if non-physical habitat characteristics at the micro level (such as
temperature, DO and food source) will be used in selecting the site locations. MaryLouise Keefe
explained that those factors are based on the physical habitat (meso level) so the mesohabitat level will
allow us to map all habitat types. Jeff Davis is interested in biotic information being a factor in choosing
critical sites as attributes. Dudley Reiser mentioned that other studies will tie into this. The AEA team is
Version October 31, 2012 Page 6
aware that factors other than those currently available are important to fish. Joe Klein indicated he
supported moving forward with the critical site concept. As important sites are recognized (a location of
spawning burbot for example) then a critical site could be created.
Instream flow sites will include the tributary delta upstream to the upper extent of potential hydrologic
influence from the Project, but not further upstream within the tributary itself.
Phil Hilgert expressed the need for Focus Areas and critical sites to be chosen by March 2013 in order for
data collection to begin.
Winter studies: A participant (not identified) inquired when winter studies were scheduled to occur.
Phil Hilgert said that they would begin this winter and that the dates would depend on the weather and
ice conditions.
Ice damming and shearing effects were explained by Kevin Fetherston
and Robin Beebee. The scarring on trees of the riparian zone will be
used to map out the ice floodplain – tree interactions and to define ice
process domains for site selections. Also, bringing data in from the
botanical riparian study will provide a greater understanding. Michael
Lilly brought in a portion of a tree with an ice scar. Kevin Fetherston
explained how these scars can tell the height of the ice as well as the
years in which the scarring occurred, providing historic data (see
photo). A core sample can be taken and growth rings can date the
time of the ice scar. He noted that the upper and lower end of the scar
could be measured for scar elevation.
The effects of the Project on ice will be predicted by looking at current
effects of ice dams. The proposed dam will be “collecting” any
upstream ice. This needs to be considered when predicting post-
Project ice damming. Natural climate change is also a consideration as
it may be a factor changing ice and its effects. Robin indicated that there is currently insufficient data to
determine if ice cover has naturally changed since the 1980s. Wayne Dyok elaborated by saying that
NOAA/NMFS is working on collecting data, and AEA is planning on combining NMFS’s and AEA’s data to
see if natural climate changes have occurred. The distance of an ice free zone caused by the Project was
discussed. The ADCP transects and possible controls (for GIS accuracy) will be used in ice process zone
mapping.
Betsy McCracken asked that side slope be considered in the floodplain to choose sites. It was explained
that would be possible with the use of the surveyed transects and the LiDAR data.
Other Topics Discussed
Terminology
Version October 31, 2012 Page 7
The importance of consistent language throughout the studies was discussed and will be provided in the
RSP, in the form of a glossary. It is important to note that different terminology exists for different fields
(e.g. geomorphology and riparian). These terms will be defined in the RSP.
References
Michael Buntjer mentioned that references were not provided/correct in the PAD with regard to chum
emergence dates. References, emergence dates and how to handle variability of multiple references
going forward will be explored by the team.
Corrections to the presentation material
In the Geomorphology PowerPoint Presentation on the slide titled “Mainstem Aquatic Habitats
Determination of 1980s and 2012 Areas”, the final sentence should read:–1980s habitat types only
available downstream of RM 149 (Portage Creek) since 1980s effort did not extend upstream from Devils
Canyon.
Protocol and future meetings
The protocols for TWG meetings were discussed regarding the distribution of presentation materials.
Betsy McGregor said that any materials such as PowerPoint presentations will be available online prior
to each TWG meeting and the attendees are responsible for printing materials if they would like
hardcopies. Hardcopies of agendas will be provided at the meeting by AEA.
Jeff Davis requested an outline for the habitat classifications and the integration of studies. Dudley
Reiser indicated he would try to present something at the next TWG meeting but that final details of the
classification are still being refined. These would be more fully described in the RSP. Jeff Davis has
requested a visual representation showing the integration of studies for him, and others, to comment
on.
The next TWG meeting will focus on Methods and will include a Site Reconnaissance. Several
participants commented that the protocol for providing feedback on meetings needs to be clear. It was
noted that when providing comments to AEA one may also file it with FERC by CCing them in the email
or distributing it directly to FERC.
Action Items
The designation of mean low tide as river mile (RM) 0 will be determined.
Videography, when finalized, will be made available through the ADNR’s website for the Susitna-
Watana Project.
The RSP(s) will include:
o glossary of terms;
o outline/schematic of the habitat classification system; and
o schematic/description of the integration of the studies.
DRAFT AGENDA
2013-2014 Wetlands Preliminary Study Plan—Wetlands Functional Assessment
18 September 2012
LOCATION: AEA Project offices – 1st Floor Conference Room
411 W 4th Avenue; Suite 1
Anchorage, Alaska 99501
(Parking off 3rd Avenue; at Sunshine Mall)
TIME: 1:30-3:00 pm
SUBJECT: Discussion for Finalizing List of Functions for Wetlands Functional
Assessment
TELECONFERENCE NUMBER: 1-800-315-6338 Code 3957#
1:30-1:45 pm Overview of Current Proposed List of Functions
1:45-2:45 pm Discussion
2:45-3:00 pm Action Items (if needed)
Meeting Summary
Susitna-Watana Hydroelectric Project Licensing
AEA Project Offices, Conference Room
411 W 4th Avenue, Anchorage, AK
Wetlands Delineation and Mapping
September 18, 2012 1:30 pm-3:00 pm
Attendees:
Organization Name
ADEC William Ashton
EPA Matt LaCroix
USACE Michiel Holley (on phone)
USFWS Maureen de Zeeuw
USFWS Bob Henzsey (on phone)
AEA Betsy McGregor
ABR, Inc Terry Schick
ABR, Inc. Janet Kidd
ABR, Inc. Wendy Davis
ABR, Inc Sue Ives
MWH Kirby Gilbert (on phone)
Solstice Alaska Consulting, Inc. Robin Reich
Van Ness Feldman Matt Love
Terry Schick (ABR) opened the meeting and said that the primary goal of the meeting was to
agree on wetlands functions to assess for the Susitna-Watana Hydroelectric Project.
Janet Kidd (ABR) (following the PowerPoint presentation attached to these notes) discussed
various functional assessment methods employed in Southcentral Alaska and their data
collection requirements.
Water Quality Function
There was discussion regarding how the “modification of water quality” function should be
assessed. Primary points included:
The group agreed that it is difficult to assess pristine wetlands that are not near human
development for the modification of water quality function, because there is little
opportunity to perform this function.
USACE, USFWS, and EPA stated that sediment, toxicant, and pathogen retention could
be important once the project is built.
Mike Holley (USACE) stated that the USACE needs to understand a wetland’s role in
water quality protection for the permitting effort.
The group discussed whether the water quality function should be split into functions like
sediment/toxicant/pathogen retention and nutrient removal / retention / transformation.
Meeting Summary: Wetlands Functional Assessment Page 2 of 4
Susitna-Watana Hydroelectric Project
September 18, 2012 1:30-3:00 pm
AEA Project Offices Conference Room
411 W 4th Avenue, Anchorage, AK
As proposed in the study plan, ABR is planning to collect functional data for
modification of water quality function by assessing the presence of inlets and outlets,
outlet restriction, cover types and distribution, and soil types.
The group decided that it is important assess the “modification of water quality”
function, but that the function did not need split into more detailed water quality
modification functions or subfunctions.
Contribution to Abundance and Diversity of Wetland Fauna Function
There was discussion regarding assessing the contribution to abundance and diversity of wetland
fauna function of wetlands within the Project area. Primary points included:
Fish Habitat Function
Determining whether wetlands are functioning in support of fisheries habitat is important
to agencies.
The summer 2012 wetlands fieldwork did not assess the fish habitat function of wetlands.
A separate comprehensive fish study is occurring for the Susitna-Watana Hydro project.
The wetlands field study area and the fisheries field study area do not completely overlap.
Matt LaCroix (EPA) prefers that a fish habitat function be validated in the field; however,
the outputs of the separate fish study could be attributed to the wetland functional
assessment work in GIS.
The group agreed that fish habitat would be assessed as a subfunction of the
abundance and diversity of wetland fauna function. Data collected by the fish study
will be incorporated into the wetlands functional assessment to determine whether
wetland polygons are performing a fish habitat function.
Wildlife Abundance and Diversity Function
Maureen de Zeeuw (USFWS) said that it will be important to document when wildlife
diversity is low.
Matt Lacroix said that it would be good to have a list of associations for determining
whether the wetland is functioning in the abundance and diversity of wildlife. For
example, functional level could be determined by the number of species or the number of
species group retained within a wetland.
Terry Schick (ABR) said that if necessary the wildlife habitat evaluation could be
repeated using the wetland types instead of the wildlife habitat types.
Matt LaCroix said that moose and caribou are important to the public and that there is
value to looking at public’s interest.
Matt LaCroix said wetland fauna attribution will be very important as the Project moves
forward.
Maureen said that wildlife habitat attributions will be very important especially outside
inundation zone as these could change once the Project is constructed.
Bob Henzsey (USFWS) said that the wetlands effort should rely on the wildlife habitat
evaluation for information about the wildlife function. He said that it is important to
Meeting Summary: Wetlands Functional Assessment Page 3 of 4
Susitna-Watana Hydroelectric Project
September 18, 2012 1:30-3:00 pm
AEA Project Offices Conference Room
411 W 4th Avenue, Anchorage, AK
assess whether the wetland will be able to provide that function once the Project is
constructed.
The group decided that wildlife abundance and diversity would be assessed as a
subfunction of the abundance and diversity of wetland fauna function.
The group agreed that the wildlife habitat work will be incorporated into the
wetlands functional assessment to determine whether wetland classes are
performing a wildlife diversity and abundance function.
Wetland Function Scoring
There was discussion regarding assessing wetlands functional scores or weighting functions
within the Project area. Primary points included:
The group discussed how wetland functions could be scored.
Janet said that the methodology will not make an assessment of what function is most
important or weigh functions at this point.
Permafrost
ABR confirmed that there were some wetlands with permafrost in the Project area.
Terry said that there have been limited studies conducted on permafrost characteristics in
the Project area.
Matt LaCroix asked whether there might be different wetland functions related to
permafrost. Janet said that permafrost usually lowers functional values like floodwater
storage and productivity. She said that permafrost wetlands, however, are more sensitive
to disturbance.
Matt LaCroix said that the team might want to note in the method/report document where
permafrost is seen and document how it affects wetland functions.
The group decided that permafrost would be addressed by classifying permafrost
dependent wetlands as separate classes.
General comments
Matt LaCroix asked whether the proposed wetland functions meshed with the types of
functions seen in the field during the summer 2012 wetlands delineation field effort.
Janet said that many of the functions proposed for the Susitna-Watana Hydro wetlands
field effort would be analyzed using GIS; however, she said that parameters that reflect
wetland functions would still be assessed in the field. Matt said that he wanted to be sure
that the GIS-based, landscape-level assumptions are validated with field data.
Mike Holly (USACE) said that he agreed with the listed wetland functions. Mike said
that had no preference whether the wetlands function list was split into more concise
functions or lumped together into larger functional categories. Mike said that the USACE
needs to be able to address wetland functions in the decision document. He preferred that
wetland functions that could be performed once the Project is constructed remain in the
assessment method.
Meeting Summary: Wetlands Functional Assessment Page 4 of 4
Susitna-Watana Hydroelectric Project
September 18, 2012 1:30-3:00 pm
AEA Project Offices Conference Room
411 W 4th Avenue, Anchorage, AK
William Ashton (ADEC) said that he agreed with assessing the habitat contribution of
fauna. He said that fish and large fauna should be assessed as separate wetland functions
because of public interest and because these functions could be important for mitigation
later in the process.
Matt LaCroix said that not all of a certain type of wetland will have the same function,
and he said that information from the field might be needed to support the GIS-attributed
functions.
Susitna-Watana Hydroelectric
Functional Assessment Methodology
Wetland Functional Assessment as
Part of the Section 404 Process
• Identify development alternatives that result in
the lowest impacts to wetlands in terms of
functional value
• Determine the magnitude of the effects of
potential impacts (i.e., what is the functional
value of the wetlands that will be lost)
• Develop mitigation plans to compensate for
losses in wetland function
Wetland Functional Assessment
Methodology Requirements (from
Smith et al. 1995)
• Standardized methods
• Applicable across study area
• Inclusive of all wetland types and functions
• Compatible with time and resources available
• Sensitive to potential impacts
• Addresses agency and other stakeholder
concerns
• Capable of incorporating new data or changing
project requirements
• Wetland Functional Classes will be used as
the foundation of the assessment and will be
linked to HGM classes
•Landscape, hydrologic, soil, and vegetation
variables will be incorporated into the model
• GIS layers identifying wetlands important for
recreation, subsistence, and habitat use will
be used in developing the models
• Allows for developing criteria for determining
the functional value of wetlands for
compensatory mitigation planning
ABR Functional Assessment (modifed
Magee Hollands Approach)
Mat-Su Wetlands
Functions and Values
• Contribution to groundwater
• Transmission of groundwater
• Streamflow moderation
• Floodflow alteration
• Sediment/Toxicant/Pathogen
retention
• Sediment shoreline stabilization
• Nutrient
removal/Retention/Transformation
• Foodchain support
• Anadromous fish habitat
• Habitat and maintenance of
biodiversity
• Habitat for species of interest
• Recreation
• Consumptive uses
• Education
• Visual quality/Aesthetics
• Cultural and historical significance
• Uniqueness
Wetland Functional Assessment Methods
Cook Inlet Basin
• Discharge of water to downgradient
systems
• Surface and shallow subsurface
water storage
• Particulate retention
• Organic carbon export
• Cycling of elements and compounds
• Maintenance of characteristic plant
communities
• Maintenance of characteristic
habitat structures
• Interspersion and connectivity
HGM (Slope/Flat
Wetlands)
Interior Alaska
• Soil Profile Integrity
• Characteristic Soil Thermal Regime
• Surface and Near Surface Water
Storage
• Cycling of elements and compounds
• Organic carbon export
• Plant Community
• Faunal Habitat Components
• Interspersion and connectivity
ABR Proposed
Functions and Values
• Modification of groundwater
discharge
• Modification of groundwater recharge
• Storm and flood-water storage
• Modification of stream flow
• Modification of water quality
• Export of detritis
• Contribution to abundance and
diversity of wetland vegetation
• Contribution to abundance and
diversity of wetland fauna
• Consumptive uses
• Uniqueness
Version September 27, 2012 Page 1
Draft Meeting Notes
Cook Inlet Beluga Whale Study
September 19, 2012
LOCATION: AEA Project offices
411 W 4th Avenue
Anchorage, Alaska 99501
(Parking off 3rd Avenue; at Sunshine Mall)
TIME: 10:00 am – 12:00 pm (AKDT)
SUBJECT: Cook Inlet Beluga Whale Study Plan
Betsy McGregor (AEA), Wayne Dyok (AEA), Keri Lestyk (HDR), Michael Link (LGL), Mandy
Migura (NMFS), Mark Burch (ADF&G), and by phone: Bob Small (ADF&G), Kate Savage
(NMFS) and Matt Love (VanNess Feldman).
Topics:
Aerial surveys
The PSP included aerial surveys of all of Type 1 critical habitat for beluga whales.
However, after further discussion AEA decided to limit the study area to the Susitna
River delta to concentrate efforts where possible Project effects could take place. The
NMFS and ADF&G agreed that this was the appropriate study area.
Approximately the same number of flight hours (80-100) will be flown, but given the
smaller study area, these hours will provide for more surveys. How these additional
surveys will be distributed will be described in the Revised Study Plan.
The RSP will also address the schedule of the aerial surveys to include not only periods
when large fish runs are present (May and June), but also times when beluga whale
calves may be present (July and August).
The RSP will also address survey timing in relation to tidal cycle. Surveys during low
tide are preferred for group counts because whales are more concentrated than when the
mudflats are covered with water at high tide. However, surveys during high tide are more
appropriate to assess the northern (upriver) extent of animals in the Susitna River. AEA
will take this into consideration when planning surveys.
Aerial surveys will also serve as a means to ground-truth the video analyses. There will
be direct comparisons between the two study methods.
Aerial surveys are only being used to assess distribution and relative group size. There
will be no attempt to calculate an abundance estimate from these surveys.
Video Cameras
Version September 27, 2012 Page 2
The video camera data will serve as the primary means to assess group composition since
it will be hard to distinguish smaller, darker animals from the aerial surveys that will be
flown at 1,000 feet altitude. Some opportunistic still photography will be obtained from
the aircraft when it does not interfere with counting animals or greatly reducing survey
coverage.
Video camera data will also serve as a means to observe behavior, especially for
individual animals rather than the group behavior that will be documented during the
aerial surveys.
Acoustics
ADF&G questioned how non-daylight and winter months were going to be addressed
because aerial surveys and video cameras will only be used during the open-water season
(April – October) and are effective only during periods of daylight. They suggested
acoustics as a way of documenting beluga whale presence and foraging behavior during
these times.
There was a lengthy discussion on the costs and efficacy of acoustics in this area,
especially during winter months. The group concluded that several factors would limit
the efficacy of an acoustic array, including sufficient range/coverage of the survey area,
ice scour in the river and intertidal areas, high in-water noise, and, most importantly, a
high probability of false negatives regarding presence of whales.
Because lack of acoustic recording cannot necessarily imply that whales are not present
(only that they were not detected), and there is evidence of use of the area in winter, the
impact analysis will just assume that whales are present during winter months.
ADF&G suggested that AEA consider using bottom-founded acoustic recorders during
the summer months to augment the aerial and video visual-based methods.
Impact Analyses
There was discussion regarding how the information from this study would be analyzed
to look at potential Project-related impacts. Everyone agreed that if Project impacts did
occur it would be through impacts to either habitat or prey availability rather than directly
to beluga whales in the form of altering access to the areas they use. Therefore, the
impact analyses needs to address these indirect pathways to potential impacts on the
beluga whale population and its critical habitat. AEA explained that there are several
studies that will address potential Project impacts on habitat and prey including: Instream
Flow, Geomorphology, Ice Processes, Water Quality, and fish studies for salmon and
eulachon. Data from these studies will be incorporated with beluga whale data for
characterizing potential impacts. NMFS asked AEA to clarify this in the RSP.
There was a discussion about the potential for impacts to the mudflats because that is also
a PCE for beluga whales. The Project will be placed upstream approximately 180 RM
from the mudflats. Physical impacts to the environment will decrease with increasing
Version September 27, 2012 Page 3
distance from the Project given additional inputs to the river from tributaries and relative
contribution by the Susitna River to Upper Cook Inlet. Project effects at the mouth of the
Susitna may be dwarfed by the large tides. AEA will look into adding a modeling
component to the RSP that will include a more in-depth look at tidal flow, currents, and
oceanography in the Susitna River delta and put these into perspective with the Project-
related changes to the hydrograph at the mouth of the river.
NMFS requested clarification for what type and magnitude of impacts will be considered
significant. NMFS and AEA agreed to work closely to help establish these criteria. It was
agreed that impacts to foraging ability will be easier to establish criteria (i.e. decrease in
prey density) than criteria for reproductive success since information on beluga whale
reproductive success is limited in Cook Inlet.
Meeting Summary
Susitna-Watana Hydroelectric Project Licensing
AEA Project Offices, First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Recreation and Social Sciences Survey Meeting
September 20, 2012, 9:00 am – 1:00 pm
Attendees:
Organization Name
ADF&G Joe Giefer
ADF&G Davin Holen
AEA Wayne Dyok
AEA Nick Szymoniak
AEA Betsy McGregor
Alaska HIA Paul Anderson*
BLM John Jangala*
BLM Cory Larson
Center for Water Advocacy Harold Shepherd
DOWL HKM Maryellen Tuttle
FERC David Turner*
FERC Ken Wilcox*
HDR Tracie Krauthoefer
The Louis Berger Group Lisa McDonald*
McDowell Group Donna Logan
McDowell Group Bob Koenitzer
MWH Kirby Gilbert*
Natural Heritage Institute/ HRI Jan Konigsberg
Northern Economics Pat Burden
Northern Economics Jonathan King
NPS Cassie Thomas
NPS Harry Williamson*
SRB&A Steve Braund
SRB&A Liz Sears
URS Bridget Easley
URS Tim Kramer
URS Louise Kling*
URS Mark Storm*
ERM John Gangemi*
NOAA Scott Miller*
Resident Becky Long*
ADNR Dave Griffin*
*by telephone
Meeting Summary Page 2 of 6
Susitna-Watana Hydroelectric Project
September 20, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Introduction and Meeting Overview – Wayne Dyok (AEA)/Kirby Gilbert (MWH)
Kirby provided an overview of the recreation and social sciences study planning process from
release of the PSP on July 16th through the current phase of study plan revision. He also provided
an overview of the agenda, which is focused on surveys and survey instruments along with
interconnections to other studies, and he noted that the August 8th meeting minutes had been
posted..
Recreation Survey Planning
Donna Logan (McDowell) provided an overview of the surveys planned through the recreation
studies. Donna outlined the three categories of surveys; 1) incidence observation survey form; 2)
Intercept Surveys (w/Online component/option); and 3) Mail Survey (with telephone
component). Donna went on to describe the Project area and the study areas including a study
area for the intercept survey. The area is generally bordered by the Parks highway, Denali
highway, Richardson highway and Glennallen highway.
Cassie Thomas (NPS) expressed interest in having more intercept survey sites on the lower
Susitna River that could be affected and suggested that it would be prudent to collect seasonal
information on users and use patterns in the river areas, especially related to angling use but also
river flow changes and possible ice changes. She suggested that perhaps more emphasis could
be given to survey and evaluate recreation downstream of Talkeetna in the Susitna River corridor
and perhaps less along the Richardson Highway. Bob (McDowell) explained the stratified
random access rationale for the various intercept locations.
Scott Miller (NOAA) noted that NOAA Fisheries is interested in Essential Fish Habitat and
associated recreation changes to the river downstream of Talkeetna. Scott also mentioned boaters
and users might go up the Susitna River from Cook Inlet, departing from Anchorage possibly,
and that it would be important to capture these forms of recreation in the intercept survey.
There was further discussion about the Intercept survey sites. Cassie (NPS) suggested basing the
intercept survey area using information from other resource study areas such as what anticipate
effects might occur in ice processes, river flow, and fish. . Following on this, there was some
discussion that perhaps popular gas stations and the larger boat ramps would be good places to
pick up survey respondents. There was also discussion of the use and merits of using the
Statewide Angler surveys and freshwater guide log books. Scott cautioned use of the Statewide
Angler survey may introduce potential bias. However, AEA’s consultant’s thought that the
survey data would be sufficient for the intended use. Kirby (MWH) emphasized the importance
of characterizing the regional recreational environment, including those beyond the immediate
project area, to understand use and establish context and the potential displacement of
recreational use.
Becky Long (Talkeenta Resident) asked about how we will get at river transportation uses.
Tracie (HDR) stated that there will be a separate resident subsistence survey that includes
Meeting Summary Page 3 of 6
Susitna-Watana Hydroelectric Project
September 20, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
questions related transportation uses. It was discussed that the subsistence survey and thethe
recreation surveys will contribute to the efforts in the transportation study attempting to
characterize the transportation uses of the river corridor. Scott Miller (NOAA) expressed
support for using the Whistle Stop train stops to undertake the surveys.
Bob (McDowell) summarized the details of the Intercept Survey including timing, logistics,
anticipated response numbers, the rationale behind intercept site selection, key recreational
groups, and the methodology to be used to ensure a stratified random sampling. There will be
three sampling periods centered on based on seasons (i.e., winter starting late February 2013,
June-August peak summer use, and the fall hunting period). Some discussion occurred on
additional methods and instruments (postcards on vehicle windows, polling at internet forums,
and focus groups) that could be utilized and the pros and cons of each.
Donna went on to explain that the Intercept Survey will likely serve as the basis for the mailing
survey, but there are practical questions that change. A post card mail out survey will include a
map that is easier to understand than if we were surveying by telephone and an invitation to a
website. Location data collected will help determine the location of use areas, activities and the
intensity of use. There was discussion of the need for potentially providing some incentives,
something like participants being entered in a contest for a lodge stay, or gift certificate for a
sporting goods store. Wayne Dyok (AEA) agreed to look into AEA’s procurement rules to see
what is permitted.
For winter surveys there was mention of going to a highly used location, like Turnagain Pass as
we might find some of those users recreate in the Susitna River valley. A key goal of the
recreation surveys is to get a better understanding of recreation demand. Jan Konigsberg (NHI)
suggested linking the survey on other sites such as dog mushing or snowmobile sites, but it was
noted that this would introduce bias in the survey.
Harry Williamson (NPS) asked if the licensing participants can help review the data once it is
collected. There was some discussion of what might be in the Initial Study Report to be
completed in early 2014 and if there would be time to have analysis of the survey results or just
reporting of the results. The report will summarize the data collected but the analysis of the data
will take more time. In response to a request from Joe Giefer (ADF&G), Wayne (AEA) said that
it may be possible to provide data before the report, but only after the data has gone through a
quality control review.
Donna explained more about the mail out survey, which would have about 10,000 mailings,
likely in two batches of 5,000. This survey will help get at resident’s uses of the area, not just
limited to recreation uses. A short telephone survey (400 individuals) would occur following the
mail survey to test for level of bias.
Donna also emphasized the need to limit the length and number of questions on both the
intercept and mail surveys for practicality, given a respondent will become impatient if the
survey is too long. Questions will need to be focused and limited in extent. Other methods of
Meeting Summary Page 4 of 6
Susitna-Watana Hydroelectric Project
September 20, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
collecting data should be explored if possible. In response to a question about the use of focus
groups, Donna noted that a focus group is not planned for the recreation study.
Discussion then turned more toward process and Cassie (NPS) expressed interest in further
developing a communication protocol perhaps or something that would help agencies know or
track what changes are being made to the study plans, or how and when participants could
review and contribute to the final products, outside of the formal comment periods. Ken Wilcox
(FERC) also suggested that AEA provide more clarity on its process to prepare the revised study
plans. David Turner (FERC) emphasized that this informal comment period is intended to help
find resolutions and identify areas of agreement and disagreement, rather than for participants to
merely comment on the Proposed Study Plan. Jan (NHI) suggested that AEA prepare a table that
reflects points of agreement and disagreement. Wayne (AEA) agreed to consider confer with the
AEA team to see how AEA might best identify agreements and disagreements.
Kirby (MWH) mentioned that each of the 58 study plans have their own process as each has
various needs for updates and revisions, but suggested that at each meeting, we could start by
going over the comments and revisions we are or have made to the study plans. He also
suggested that the Recreation Study many need more structure given the number smaller of items
relating to it and that for future meetings, materials could be made available prior to the meeting.
Socioeconomic Study Plan
Pat (NEI) provided an overview of efforts to assess socioeconomic impacts and NEI’s efforts to
coordinate with McDowell on the survey to collect information on spending activities. He noted
that quality of life will be considered in the socioeconomic study teams contributions to the
recreation survey, as well as in the subsistence survey.
Jonathan King (NEI) discussed the socioeconomic survey aspects regarding the expenditure
information the McDowell group is intending to help collect in their surveys as well as social
welfare information that will help inform the use of other modeling. Jonathan discussed the use
of a Random Utility Model (RUM) that may potentially be used to assess the economic impact of
the top four or five recreational activities within the study area. The RUM was added in
response to comments on the PSP. If developed using appropriate variables, the RUM would
enable modeling of the economic impacts of current and new site development. Cassie (NPS)
expressed interest in the model but emphasized the importance of including future management
regimes and different planning scenarios.
Dave Griffin (ADNR State Parks) explained he had not participated previously but was glad to
join the workgroup and mentioned several items of possible interest that State Parks has been
doing in the upper Susitna River Valley. Dave described they are working on developing a new
visitor center in Denali State Park, but do not have all the funding yet, however are planning on
developing a camping area (55 sites) near MP 135 on the Parks Highway. He also mentioned
they had done a feasibility study with some visitation information he could pass along. In
addition, they will be extending three-phase power supply up the highway from MP 101 to MP
Meeting Summary Page 5 of 6
Susitna-Watana Hydroelectric Project
September 20, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
121 and have plans to further extend three-phase power to MP 135 and then onto the Princess
Lodge. Wayne Dyok (AEA) gave Dave his contact information so Dave could send along the
reports and information which Wayne then could pass onto the study team. Dave also
recommended working with the Alaska Railroad for surveying along the Whistle Stop train.
River Flow Study Plan
John Gangemi (ERM) went over the river flow study plan surveys in terms of what was planned
for each of the three river reaches defined in the study plan( i.e., upstream of Watana, Watana to
Portage Creek and Portage Creek to the confluence). John described the targeted interview
method, along with an online survey for boaters and how the surveys are trying to get at flow
preferences and frequency of use among other things. John agreed he could provide copies of
draft or typical survey instruments to the participants in the next few weeks. Cassie (NPS) again
mentioned the need to understand river use patterns, river uses downstream of Talkeetna if flows,
winter ice, or fisheries are going to be affected by the Project. John noted that for summer
effects, he can apply the information gained from the reach upstream of Talkeetna to the reach
downstream.
Aesthetics Study Plan
Louise Kling (URS) briefly described the aesthetics study survey components. It was agreed she
would have more materials for review prior to the next technical focus group meetings on
recreation and aesthetics, including sound and methods/locations of tentative information
collection points, etc. Mark Storm was introduced as the lead for the Sound assessment. The
aesthetics study may piggy back on the time lapse cameras set up for the ice studies and cross
sections.
The meeting concluded that more follow up discussion would occur and Cassie was going to do
a Doodle Poll to confirm when a follow up meeting on the surveys could take place in the next
few weeks. It was mentioned that for those that cannot participate in some follow up meetings or
conversations, the study teams could recap at the scheduled October 16th TWG what changes
they have made to the study plans and the result of the smaller meetings.
Action Items
Evaluate adding more Intercept survey sites in Lower River locations and perhaps cutting
back a little on Richardson Highway locations/effort to make the adjustment.
Consider the merits of evaluating Susitna River bound boaters departing from Anchorage
as potential survey locations and follow up to evaluate significance/extent of such use.
AEA to consider if there is a potential gap in the mail survey for out of town land owners.
AEA to consider obtaining debriefs from AEA’s helicopter pilots travelling in the project
area.
Coordinate with Subsistence and Transportation studies on segmenting transportation
uses of river verses recreation uses of the Susitna River.
Meeting Summary Page 6 of 6
Susitna-Watana Hydroelectric Project
September 20, 2012
AEA Project Offices First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Wayne Dyok to follow up on AEA procedures regarding potential use of incentives in
survey.
Consider the potential of using popular day use areas for survey sites like Turnagain Pass
(for snow-machiners) to survey a group who may have some familiarity with use in the
upper Susitna River basin.
Outline the likely extent of survey results reporting in the first year report (Initial Study
Report due out Feb. 3, 2014) and consider a process to allow licensing participants to
review survey data prior to analysis.
AEA to consider producing a table to outline the process for working with licensing
participants to review study plan changes prior to finalizing for RSP December 14th ( and
prior to comment close November 14th).
John Gangemi to provide example or tentative Online and Executive Survey instruments
by end of next week.
Tracie to send John Gangemi a list of subsistence survey locations so he can determine if
additional questions should be added to facilitate the river flow study.
Tracie to post the subsistence survey online.
Louise Kling to provide more details on KOP selection and any survey instruments or
focus group plans within the next week.
Follow up with Cassie on scheduling a small focus group session in next couple weeks to
further go over the survey plans, consider adding Aesthetics and Noise survey plans,
work with Betsy and Kirby to schedule this meeting.
MEETING RECORD
Record of Meeting Page 1 of 3
AEA Team Member Other Party
Name: Charles M. Mobley, Cultural Resources
Program Lead Name:
Organization: AEA Organization: AEA
Study Area: AEA Office Phone
Number: 800-315-6338 code 3957#
Date: September 24, 2012 Time: 1:00 -3:00 pm
Meeting held by: X AEA Team Other Party
Others at meeting:
Present:
Taylor Brelsford, URS
Charles M. Mobley, Charles M. Mobley & Associates
Justin Hays, NLUR
Fran Seager-Boss, MatSu Borough
Kirby Gilbert, MWH
Betsy McGregor, AEA
Bruce Tiedeman, AEA
Richard VanderHoek, AOHA
Wayne Dyok, AEA
By Telephone:
John Jangala, BLM
Dara Glass, CIRI
Jim Kari
Chuck Sensiba, Van Ness Feldman
Becky Long, Coalition for Susitna Dam Alternatives
Subject: Cultural Resources Study Plan Workshop – revised APE map and other maps
Discussion: After introductions, NLUR’s Justin Hays presented five draft maps that NLUR has
prepared and revised using the direction received at the September 7th cultural resource meeting in
AEA offices. Similar to the September 7th meeting, the focus of this meeting was on defining the Area
of Potential Effect (APE) and associated aspects including where previous surveys have taken place
and likely level of effort associated with future surveys.
A new draft map was presented by Justin showing a revised Direct Impacts APE as well as an update
to the preliminary Indirect Effects APE. The direct impacts area was refined from 2,200 foot down to
the 2,050 foot contour around the impoundment area. The indirect effects APE was revised to follow
logical subwatershed boundaries around the reservoir. User made trails were added to the Indirect
Effects APE on the map, including those leading to the reservoir that were identified from several
sources including field observation and BLM geodatabase. The road and transmission corridors were
also included on the map using the current study area buffers for those corridors as the Indirect
Effects APE. The Direct Effects APE would be along the actual road and transmission line alignments,
once selected and those are within these corridors.
Ensuing discussion focused mostly upon details of the Indirect Effects APE and trails. John Jangala of
BLM pointed out that BLM’s data are incomplete, and that the recently created “Raptor Trail” was
omitted on these maps but should be added. Rich VanderHoek of AOHA urged clarity in applying trail
MEETING RECORD
Record of Meeting Page 2 of 3
information for use in reconstructing historic uses versus defining potential impacts. Jim Kari
suggested distinguishing foot-trails from other types, and Fran Seager-Boss recommended
researching historical maps including the 1906 Rumsey map to identify historic trail locations. Dara
Glass of CIRI stated that all trails on CIRI land were likely used by trespassers and voiced concern
that a map depicting trails in any context including cultural resource investigations could inadvertently
appear to legitimize those trails. Becky Long echoed concern about inadvertently affecting access.
It was agreed that a map legend stating what the trails were (designated or user-defined physical
features) and where the data came from would be appropriate and to consider somehow making
some notation on the maps or in a footnote that the trails mapped are not necessarily public access
trails but some trails could be on private lands not available to public access without permission. It
was further concluded that at least three layers of trails will be compiled: a BLM layer, a layer based
on actual field observations, and a layer depicting historic foot trails. The maps will be revised
accordingly.
A map of the legacy surveys from the 1980s was shown in overview and more detail formats. The
legacy surveys of the 1980s had several types of survey and the maps are intended to show the
spatial extent of the various types of surveys. The distribution and type of early 1980s survey data
was discussed. These maps also show the Direct and Indirect Effects APE (impoundment and three
road/transmission corridors), and the distribution of areas surveyed between 1979 and 1984.
Discussion included some explanation of the differences between the types of surveys. Discussion
also included the status of ANILCA 14(h)(1) sites in the area and there was some agreement the
status of sites need to be addresses and perhaps located on the maps if in the Project area. John
Jangala mentioned that most of these sites are awaiting transfer to ANCSA Regional Corporations
pending BIA archaeological surveys. The 14(h)(1) site near the mouth of Tyone River was tentatively
seven sections in size. Mobley indicated that BIA had been contacted about obtaining 14(h)(1) site
information (that data was acquired for the study teams consideration later in the day).
In further discussion it was suggested that the map title for the map of previous surveys be more
descriptive (“Legacy” doesn’t convey much), and that the legend be more explicit, as well.
Presentation of the 1980s survey zones on the map was truncated at the edge of the current
impoundment/corridors footprint and it was recommended that the missing portions of the polygons be
reinserted onto the map.
The map showing types of surveys proposed for 2013/14 was presented and discussed. This map
attempts to show how the Direct Effects APE will be surveyed in terms of primarily pedestrian
coverage, or primarily aerial coverage.
Discussion focused on ways to make the map more descriptive and accurate. The “Combo” category
is actually “not enough data,” and the aerial method also includes touchdowns for pedestrian scrutiny,
while the pedestrian coverage requires helicopter support. The proposed Indirect Effects APE shown
on the maps was not yet characterized according to which survey methods would be used and it was
felt more discussion was needed in the text as to the activities planned for those areas. In addition to
changes on the map legend there also was acknowledgment for the need for a developed explanation
of all survey methods in the text of the revised study plan.
The final map discussed was the Language Map, showing general Native language boundaries and
the Project area. This map shows the larger region and the approximate demarcation of traditional
Native languages in relation to the Project area. Discussion on this map included a request from Jim
MEETING RECORD
Record of Meeting Page 3 of 3
Kari that the Tanana label be changed to Lower Tanana. Bruce Tiedeman and Dara Glass both
recommended that Alaska Native Regional Corporation boundaries be included. Further discussion
revealed it might be more appropriate for the Regional Corporation boundaries to be placed on the
land ownership map which will be a separate map from the language and APE maps.
Summary. All five maps will receive some revision, with the intention that they appear in the RSP to
help present the details of the cultural resource study plan. Attendees at the meeting were reminded
that formal comments on the PSP are due to AEA before November 14 and AEA would be sending
out draft RSP sections around the time of the next TWG meetings in October for parties to consider in
formulating their comments.
Action Items:
• Add Raptor Trail to Indirect Effects APE
• Add a map of land ownership with Native Corporation boundaries
• Clarify where specific trail data comes from and make sure its clear what these trails mean
and also identify any formal designated trails verses any user created trails that are not
sanctioned by landowners.
• Update maps with minor adjustments as noted in meeting such as scale and format, etc.
• Update language map to show Lower Tanana verses just Tanana
• Provide detail text discussion of survey method, including quantitative metrics, to go with map
of methods.
• Update study plan with information about ANILCA 14(h)(1) sites.
• Provide additional narrative of the details of survey methods to go with the maps.
MEETING RECORD
Record of Meeting Page 1 of 1
AEA Team Member Other Party
Name: Michael Link Name: Jack Erickson, James Hasbrouck
Organization: LGL Alaska Research Associates, Inc. Organization: ADF&G
Study Area: Fisheries Resources Phone
Number: 267-2398
Date: September 25, 2012 Time: 11:00-12:00
Meeting held by: X AEA Team Other Party
Others at meeting:
n/a
Subject:
ADF&G Sport Fish Division’s comments on the 2013-14 Proposed Study Plans, Salmon Escapement
and Fish Genetics
Discussion:
Purpose of meeting: review ADF&G comments and additional input to the Salmon Escapement Study
Plan in preparation of the Revised Study Plan.
Reviewed the emailed comments from ADF&G (Klein) on August 23, 2012.
Specifically, we discussed the request for locations for weirs in the Yentna and Susitna rivers. This
material was in the PSP but additional emphasis/clarification was recommended.
Of greatest importance was to clarify that the coho salmon escapement estimates are not currently
requested by ADF&G (as was in an earlier Study Request in May 2012) for the entire Susitna River
but instead for the Susitna River above the confluence with Yentna River. This change was made in
the RSP and language was added to further clarify the scope.
Reviewed the PSP and made several modest edits to descriptions. All edits were made and retained
for the RSP by AEA.
Discussed the general feasibility of using genetic markers for mark-recapture based abundance
estimates in the Susitna River.
Discussed the utility of marking additional Chinook salmon at Devils Canyon area to increase sample
sizes in the Canyon for assessing fish passage and the distribution of fish above Devils Canyon. The
RSP contains a provision for additional tagging effort at Devils Canyon.
A productive 1-hr meeting and all of ADF&G’s comments and concerns were addressed in the RSP.
Action Item:
n/a
Version October 10, 2012 Page 1
Draft Meeting Notes
Fish and Aquatics Studies
September 27, 2012
LOCATION: AEA Project offices
411 W 4th Avenue
Anchorage, Alaska 99501
(Parking off 3rd Avenue; at Sunshine Mall)
TIME: 10:00 am – 12:00 pm (AKDT)
SUBJECT: Discuss Michael Buntjer’s comments raised after the 9/13 /2012 USFWS
meeting on the Fisheries Studies
Attendees: Betsy McGregor AEA, Michael Wiedmer ARRI, Chiska Derr NMFS, Dani Evenson
R2, Kathryn Toews LVA, Justin Crowther AEA, Michael Link LGL, Wayne Dyok AEA, MaryLouise
Keefe R2, James Brady HDR, Joe Klein ADF&G, Michael Buntjer USFWS, Jeff Davis ARRI
Following the 9/13/2012 meeting at USFWS, Michael Buntjer requested additional clarification
on aspects pertaining to the Fisheries Studies. This meeting was intended to address those
requests in a small working group.
A description of the tiered objective approach to the fish distribution and abundance studies
was explained as follows:
1. Fish presence/absence- requires less effort and less costly techniques. Because of this,
these data can be collected at more locations than data for the other objectives.
Methods may include 1 pass electrofishing, 1 pass snorkel and 1 pass minnow traps.
This objective is to characterize fish assemblage and may be used to weight sample
locations for other studies.
2. Relative abundance/density- samples at fewer sites than presence/absence with a
higher level of effort. Methods may include 4 set removal of drift nets for 90 minutes
each set, block netting, 4 pass minnow traps, 3 pass electrofishing. Dani Evenson
referred to a Bryant paper which explains protocol for minnow trapping.
3. Population estimates were initially proposed to be collected only in Focus Areas. Based
on feedback from ADF&G and further consideration, MaryLouise Keefe proposed
eliminating population estimating efforts, asking if the level of effort required was
worth the risks of providing insufficient data (due to being unable to reach the required
level of effort for population estimates in such a large system). Joe Klein requested that
if population estimates were removed from objectives, then effort be added to relative
abundance/density. It may be possible to answer population questions by collecting
sufficient relative abundance data.
Version October 10, 2012 Page 2
MaryLouise Keefe explained that the purpose of objective 1 is to characterize what fish are
present and how many of them are where, when. Jeff Davis highlighted the need to
concentrate on the “when” while addressing life stages of specific fish. He feels catch-per-unit-
effort should be tied to the targeted fish. MaryLouise explained the difference between
broadcast sampling (objective 1: fish distribution) vs. specific objectives; broadcast sampling
will be based on representative habitats and specific objectives will be added for species of
interest. These objectives may require more effort at certain times and locations specific to the
species of interest. Methods will also be limited/dictated by the habitat. Multiple methods
may be used at a given habitat to ensure that all life stages and species present are identified.
Jeff Davis is concerned that AEA will be repeating the mistakes in 1980s of using incorrect
methods. Betsy McGregor emphasized that AEA’s team will not be simply repeating the 1980s
studies.
Jeff Davis and MaryLouise Keefe agreed that the presence/absence data cannot be used to infer
relative abundance, expanded efforts and methods are necessary to understand relative
abundance.
MaryLouise Keefe explained the need to tie the objectives to the methods. She asked for
confirmation that population estimates are not necessary and asked if relative abundance
would be adequate for early life history. The feedback from the group generally confirmed that
population estimates are not necessary. MaryLouise suggested that early life history
population estimates be collected in Focus Areas. Is that worth the added effort, possibly
conducting mark-recapture for larger fish and using out-migrant traps or DIDSONs? This
question remains under discussion.
Michael Buntjer questioned the approach for sampling the Lower River (downstream of the
Three Rivers Confluence). His concern is based on the habitat classification being less specific
than the Middle River. MaryLouise Keefe explained that due to the videography and extremely
high number of channels, the Lower River is only feasibly mapped to the mainstem habitat
type. Dani Evenson elaborated by saying that the level of effort will not be changed, only the
level of strata that the study sites are distinguished by.
The discussion switched to the topic of stranding and trapping. Michael Buntjer asked how
sites will be chosen to best understand the possible Project effects on stranding and trapping.
Joe Klein requested that any historic data used for stranding be referenced and that all low
gradient areas, not only banks, of the Middle River be modeled. MaryLouise Keefe explained
that the varial zone model, to be presented at the upcoming 10/2/12 Instream Flow TWG
meeting, will explain in detail the stranding/trapping aspects of the Instream Flow Study.
Wayne Dyok stated that the up vs. down ramping have different effects, and Joe Klein said,
biologically speaking, the down ramping affects the fish more than the up ramping due to the
possibility of stranding and trapping.
Jeff Davis’ request to keep each species and their life stages in mind while choosing sample
locations and methods was agreed on by all. MaryLouise Keefe elaborated by offering a sub-
objective to compile available periodicity charts and available data (including from the 1980s)
Version October 10, 2012 Page 3
before finalizing locations and method details. Michael Buntjer requested that periodicity data
be referenced so it is possible to weigh the reliability of data.
MaryLouise Keefe mentioned that the habitat characterization study plan is being refined based
on available video (limited by the level of detail) and interim comments. Joe Klein mentioned
that many comments that ADF&G will be filing on the Fish Distribution and Abundance PSPs
may have already been addressed. Betsy McGregor informed all that the October 23-25, 2012
TWG meetings will include populated comment / response tables including discussion of all
significant comments received through all types of communication since AEA’s filing of the
PSPs. Study Interdependency figures and schedules will also be provided. This will provide
people with a current view of how AEA is addressing interim comments / discussions. The
Instream Flow Study draft RSP will not have every aspect finalized, but will include a schedule
showing when remaining study details will be addressed.
It was reiterated by all that terminology needs to be standardized.
Version October 10, 2012 Page 1
Draft Meeting Notes
River Productivity Study Subgroup Meeting
September 27, 2012
LOCATION: AEA Project offices – 1st Floor Conference Room
411 W 4th Avenue; Suite 1
Anchorage, Alaska 99501
(Parking off 3rd Avenue; at Sunshine Mall)
TIME: 1:00 pm – 5:00 pm (AKDT)
ATTENDEES: Michael Buntjer USFWS, Stormy Haught ADF&G, Justin Crowther
AEA, Kathryn Toews LVA, MaryLouise Keefe R2, Dani Evenson R2, Chiska
Derr NMFS, Brian Lance NMFS, Jeff Davis ARRI, Betsy McGregor AEA
ON PHONE: Tim Nightengale R2, AJ Keith Stillwater, Dirk Pedersen Stillwater, Matt
Cutlip FERC, Fred Winchell Louis Berger, Mark Winfrey UAF, Erik Schoen
UAF, Sue Walker NMFS
This meeting was held in order to:
address the feasibility of a trophic analysis to describe potential changes in the primary
and secondary productivity of the riverine community following Project construction and
operation;
discuss the concept of reference sites on the Talkeetna and Chulitna Rivers to monitor
baseline productivity, pre- and post-construction; and
discuss the need for/value of a literature/data search to identify existing river systems that
could act as surrogates in evaluating future changes to productivity in the Susitna River.
MaryLouise Keefe introduced Mark Winfrey and Erik Schoen of UAF. They will assist in
drafting AEA’s River Productivity RSP. Michael Buntjer requested documented feedback from
Mark Winfrey’s review of the PSP. Mark Winfrey explained that he had reviewed the PSP and
provided feedback through conference calls with R2 without documentation. Mark Winfrey
expressed his agreement with Tim Nightengale’s Before–After Control-Impact BACI design thus
far (details still pending).
What is productivity? The question was raised by MaryLouise Keefe. The definition of
productivity varies between resources and individuals, making the title of this study misleading
to some. MaryLouise’s proposal to change the title of the River Productivity Study is under
discussion. The river productivity study plan measures eco-responses including the food web
Version October 10, 2012 Page 2
and possible responses to Project effects. Mark Winfrey defined productivity as the production
of carbon.
Trophic analysis
Jeff Davis suggested that the river productivity study plan should be measuring primary and
secondary productivity by conducting stream respiration / metabolism studies. Mark Winfrey
suggested using emergent traps to assess river productivity. Emergent traps are tent like
structures which collect emerging macroinvertebrates in a preservative such as alcohol as they
emerge from a defined surface area of the aquatic habitat. This may allow one to assess how
consumers of periphyton are responding and how periphyton is affected. MaryLouise Keefe
reminded everyone that ultimately, the main concern is how the proposed Project could affect the
ecosystem’s ability to support fish. Emergent traps measure prey for fish and although they
don’t directly measure primary production, they will tell how lower trophic levels respond. Fish
are dependent on the lower trophic levels and will be directly impacted by any change in the
lower trophic level community. Jeff is concerned that the emergence traps do not account for
biomass taken by consumers within the river system (prior to emergence). Mark Winfrey agreed
that this is an inevitable limitation since there is currently not a sampling technique that is able to
measure all consumption of biomass.
Jeff Davis asked if there was any published work regarding emergence sampling. Mark Winfrey
said that he had conducted a study in the summer of 2011, and “it went very well”. Jeff Davis
asked how one would study emergence in times of ice, heavy flows and break up. Mark Winfrey
said that ice flows could be sampled in areas of partial ice and little to no flow, but most
invertebrates emerge after ice has left and often emerge in side channels with less flow (areas
easier to sample). Betsy McGregor added that many lateral habitats have open water leads
throughout the winter. Jeff Davis explained that by collecting spring emergence, one is
essentially collecting the biomass generated throughout the winter and can infer production
within the aquatic environment. Mark Winfrey agreed and added that the emerging species are
easily identified and can be confidently collected due to an abundance of knowledge regarding
emergence times linked to times of the year, temperatures and life histories. Jeff Davis asked
about plans to sample post-Project and MaryLouise Keefe said this is to be discussed at a later
date.
Jeff Davis asked why one would measure emergence rather than secondary productivity. Mark
Winfrey responded by saying that secondary productivity measures require expensive
techniques. The results are also variable and may be unreliable. Mark Winfrey suggested
sampling for benthic macroinvertebrates as well as emergence for a better understanding of
productivity. Jeff Davis asked to discuss emergence traps further and may consider them being
coupled with bioenergetics for sufficient understanding.
Bioenergetics modeling and isotope analysis
Isotopic analysis can allow one to differentiate pathways and is important in understanding the
riparian system. The riparian system is a large contributor to the aquatic environment
productivity with up to half of the prey of juvenile salmon coming from terrestrial habitats.
Another large source of nutrients in the Susitna River is marine-derived such as salmon and their
Version October 10, 2012 Page 3
eggs. Analyzing stable isotopes can help identify the amount of marine and freshwater/terrestrial
carbon utilized by individuals. MaryLouise Keefe asked if one could differential between
freshwater and terrestrial sources using isotopic analysis. Mark Winfrey said that it is possible,
but not guaranteed and he does not feel that the added costs are worth the risk of unreliable data.
Mark Winfrey asked Jeff Davis if he knew of any Susitna River studies with isotopic analysis.
Jeff only knew of studies on the tributaries (one brown water stream with heavily dissolved
organic carbon and one clear water stream), and summarized that benthic organic matter is
difficult to differentiate and that periphyton had little variation. He knows of no studies
regarding benthic invertebrates in the Susitna River or its tributaries.
Jeff Davis asked how bioenergetics is linked to the riparian habitat. MaryLouise Keefe said that
the link is not yet explained, but is being developed with Erik Schoen’s assistance. Jeff asked if
one can differentiate between periphyton. Mark Winfrey said that periphyton can be very
variable and therefore, not reliable when trying to differentiate. It may be possible to identify
how heavily fish are relying on salmon eggs and/or insects which prey on decomposing fish.
Mark also mentioned that the marine traces go away from consumers of fish eggs relatively
quickly. MaryLouise confirmed that it can be untraceable after 90-100 days. Jeff was happy to
see that bioenergetics modeling is being considered.
Stormy Haught reminded the group that this study could be the basis for a long term monitoring
project and therefore must consist of methods able to be repeated often. MaryLouise Keefe
showed concerns in studying the macroinvertebrates because they can start to show changes 25-
50 years after the environmental changes begin occurring. Stormy finds that geomorphology can
be the first change noticeable and may be the indicator of further effects. Jeff Davis mentioned
that hydrologic effects have been seen as the first indicator of Project impacts in some studies.
MaryLouise said that since the biologic community is affected by changes in all resources, using
the community as an indicator may be the best approach for observing change.
Erik Shoen explained that bioenergetics takes the amount of energy a fish gets from food and
turns it into a representative growth number. With what the study is currently proposing to
sample one can make “what if” scenarios and integrate with changes for growth. MaryLouise
Keefe mentioned that target indicator species need to be agreed upon. The following was agreed
upon by the participants:
Anadromous salmon – Chinook or coho salmon fry/juveniles
Non-anadromous salmonid – dolly varden or rainbow trout
Non-anadromous non-salmonid – stickleback or sculpin
Mark Winfrey expressed interest in stickleback, because they may be significant competitors of
salmonids. They are also potential salmonid prey and may benefit by warmer temperatures. Jeff
Davis prefers stickleback over sculpin. Stormy Haught supported choosing stickleback over
sculpin because there is an abundance of information on the Susitna basin stickleback. He did
warn that they might not be abundant in the Middle River, but Jeff mentioned that they could be
found in beaver ponds and backwater or in off channel habitats. MaryLouise Keefe said that
those habitats could be affected by the Project, agreeing in the choice of stickleback.
Version October 10, 2012 Page 4
Jeff Davis asked how the river productivity study relates to habitat suitability criteria and
instream flow studies. MaryLouise Keefe said that it is important to connect this with habitat
modeling and the riparian study, but the river productivity study is based on growth and not the
numbers of fish. She said that it may be possible to apply an algorithm to map high productivity
areas and use that information to weight sites. Jeff Davis added that productivity is more
important than the number of fish since fish are mobile.
Jeff Davis and Mark Winfrey discussed the influence of O2 in the Susitna River. Jeff Davis feels
that turbid waters are not O2 deprived. A single DO meter in the still water sloughs will not have
an issue regarding oxygen diffusion.
MaryLouise Keefe pointed out that turbidity in the Susitna River is not constant, varying with
location and time of year. Jeff Davis explained that the changes in turbidity affect primary
production by changing the light penetration. Jeff Davis referenced a Snyder and Minshall paper
when discussing the change from a heterotrophic community to autotrophic with less turbidity.
Mark Winfrey explained that one can expect minimal periphyton in turbid waters with more
primary productivity in off-channel habitats.
Reference sites on the Talkeetna and Chulitna Rivers to monitor baseline productivity, pre-
and post-construction.
Tim Nightengale reminded others that USFWS’ study request called for a pre-Project monitoring
program which included reference sites in the Talkeetna and Chulitna rivers. The group
discussed some differences and similarities of the two rivers relative to the Susitna. According
to USGS (Kyle and Brabbots 2001) the Chulitna is colder than the Susitna. The Talkeetna is
comparable in regards to temperature. Knot et. al. concluded that the Chulitna is also more
turbid than the Middle Susitna River. Tim Nightengale suggested using a site upstream of the
proposed Project inundation zone on the Susitna River since it experiences the same flow and
environmental effects. This area also has the same temperature as other parts of the Susitna, but
it lacks influences of tributaries. MaryLouise Keefe explained that the geomorphology study
crew collecting data this summer (2012) noted that the geomorphic processes don’t differ from
the middle and upper Susitna. Jeff Davis brought to everyone’s attention that there aren’t any
marine derived nutrients present in the upper Susitna and Tim Nightengale added the there is
also a difference of elevation. Tim feels that whichever location is chosen, if any, it must have
comparable annual flow variation and vegetation variability. Jeff Davis suggested a location
above the west fork of the Chulitna although lower Talkeetna has more similar species with
similar tributaries and habitat types. All agency representatives agreed that the biomass is most
similar in the lower Talkeetna. Tim proposed to choose a site for 2013 sampling and compare it
to the Middle Susitna to confirm or refute its representativeness. The upper Susitna will be
sampled regardless so it can become a reference site if needed. Betsy McGregor added that
when choosing a site, one must consider future development so it is important to choose a
location that will not be affected by any future growth of Talkeetna or other neighboring
communities.
MaryLouise Keefe began the discussion of what to monitor at this/these reference sites. She
suggested including macroinvertebrates since effects on them will be seen sooner than on fish.
Version October 10, 2012 Page 5
Jeff Davis suggested stable isotope analysis and periphyton samples at multiple locations which
are paired with sites on the Middle Susitna of similar habitats to reduce variability. MaryLouise
Keefe stated that more resources need to be sampled than just macroinvertebrates. Chiska Derr
suggested collecting riparian data. Betsy McGregor mentioned the extensive data that will be
collected in the Sustina River basin as part of the Riparian Instream Flow Study and that it
seemed unnecessary to conduct in depth studies of the riparian environment at a reference site in
another drainage.
MaryLouise Keefe proposed a single reference site on the Talkeetna River. Jeff Davis needs
confirmation on other studies’ Susitna site selection before deciding numbers or locations of
reference site(s). Stormy Haught feels two sites are necessary. Jeff Davis feels at least three
sites with five providing more reliable statistics.
Jeff Davis asked if reference sites would be located in the main channel. MaryLouise Keefe said
that they would not, which raised concern with Jeff since he believes productivity in the spring
may only be possible in the main channel due the lateral habitats being frozen. Sue Walker
added that the main channel of the Susitna would be more important from a productivity
perspective due to Project effects. Betsy stated that this was not known and added that the
Susitna River is not expected to convert to a single channel river in the spring and noted the open
water leads present during the winter in the lateral habitats.
MaryLouise Keefe asked if two years was ample time to define a system enough to apply a
BACI design. It is possible that only large differences will be detectable with such a short study
time. Stormy Haught answered with “the sooner, the better”. Tim Nightengale asked if it was
even possible to establish sites with Project effects as the only variable. MaryLouise questioned
the need for reference sites, and Michael Buntjer claimed that the risk is just as high when only
using literature as a reference. MaryLouise said that there are many studies throughout the world
to be referenced, and she expressed concern in the possibility of BACI being unreliable due to
interannual variability. Brian Lance asked what would be implemented if not BACI. Tim
Nightengale suggested a cluster analysis or ordination plots (which Brian Lance finds inferior to
BACI). Stormy Haught said that using reference sites is necessary at some point, but the timing
to begin sampling and number of sites is under discussion and may not be decided until after the
license is issued. MaryLouise Keefe added that these sites would come with a high price tag so
if implemented, one must reduce variability between a reference site and the middle Susitna site.
Jeff Davis asked when the agencies should expect details regarding reference sites, and
MaryLouise Keefe said this is under discussion.
Betsy McGregor stressed that this meeting is an open discussion and is not a commitment by
AEA and asked everyone to consider the goal of all studies; to collect the necessary baseline data
to be able to assess the potential impacts of the Project in support of a FERC License
Application.
Need for/value of a literature/data search to identify existing river systems that could act as
surrogates in evaluating future changes to productivity in the Susitna River
MaryLouise Keefe stated that a surrogate would need to be a glacial fed river with a lake/river
volume ratio relative to the proposed post-Project reservoir/river volume ratio.
Version October 10, 2012 Page 6
The Kenai River was ruled unfit as a surrogate due to its maritime climate. Sue Walker stated
that a proper surrogate would not be found in Alaska but possibly Canada or Finland. Canadian
hydropower projects are typically run-of-the-river projects and are therefore not comparable.
MaryLouise Keefe questioned the likelihood of finding a proper surrogate and asked if the
literature review would suffice, adding the proposal for writing a white paper (a synthesis of
similar projects and their effects). Jeff Davis added that the results of a white paper approach
should be used in the river productivity study site selection. MaryLouise ensured all that Tim
Nightengale’s study design reflects the literature due to his experience and expertise, adding that
modifications can be applied if found necessary.
Jeff Davis mentioned Alexander “Sandy” Milner as being the expert on glacial streams and their
invertebrate communities. He suggested contacting him for further information if needed.
Open Discussion
Jeff Davis provided draft comments from USFWS stating that they were still being finalized
internally.
Jeff Davis asked about the main channel site locations for macroinvertebrates. He asked for
random and repetitive sampling at uniform depth and velocity at each site. He also asked to have
repeated benthic sampling at each site in the same microhabitat. Tim Nightengale said that the
details may be dictated by sampling gear and he intends on sampling at uniform flows. Jeff
asked not to be limited by methods, rather choose what is to be characterized and find method to
achieve it. He wants to be assured that a representative number of sites are sampled and plans to
rely on habitat suitability criteria (HSC) curves for algae and macroinvertebrates. Jeff
recognized that the large size of the Susitna River makes it difficult to sample enough sites for
representation. Tim will use literature for habitat suitability curves and samples to assist in
developing the HSC. Jeff asked if the HSC is based on 1980s data. He was not aware if HSC
data was collected in the 1980s. MaryLouise Keefe said that the details will be explained in a
future HSC TWG meeting.
Jeff Davis asked the source of all data to be identified in the HSC curves. MaryLouise Keefe
will present a literature curve, new data curve and a hybridized curve created collaboratively
between AEA’s instream flow team and the TWG.
Sue Walker questioned about the possible negative effect that the recent flooding would have
upon sampling next year. MaryLouise Keefe explained that this is an uncontrollable variable
and can’t be avoided. Jeff Davis said that the flood may have reset the macroinvertebrate
community. He referenced Alexander Milner as having studied the reset of macroinvertebrate
communities. He mentioned that disturbance tolerant species seem to remain after extreme
events such as this flood, adding that Alaska has many disturbance tolerant species.
Michael Buntjer asked if marine clams were being studied. Betsy McGregor explained that the
Beluga Whale study is modeling the hydrology of Cook Inlet and after combining these
modeling results with the results of other models (e.g. sediment transport, water temperature and
other water quality parameters, fluvial geomorphology) the probability of the Project affecting
drivers to the clam community will be assessed. If it looks as though those drivers will be
affected, a clam study may be added in 2014.
Version October 10, 2012 Page 7
Betsy McGregor reminded attendees that AEA will be providing comment / response tables at
the upcoming October TWGs.
Version November 2, 2012 Page 1
Draft Meeting Notes
Instream Flow Study-Riparian
Technical Work Group Meeting
October 1, 2012
LOCATION: AEA Project offices – 1st Floor Conference Room
411 W 4th Avenue; Suite 1
Anchorage, Alaska 99501
TIME: 12:00 pm– 5:00 pm (AKDT)
SUBJECT: Instream Flow Riparian Study Plan & USFWS Comments
ATTENDEES: Bob Henszey USFWS, Chiska Derr NMFS, Steve Padula LVA, Kathryn Toews LVA,
Betsy McGregor AEA, Justin Crowther AEA, Jan Konigsberg National Heritage
Institute, Michael Lilly GWS, Marie Steele DNR, Bill Fullerton TetraTech, Kevin
Fetherston R2
ON PHONE: Becky Long Coalition for Susitna Alternatives, David Turner FERC, Paul McCowsky
FERC, Matt Love Van Ness Feldman, Hal Shepard CWA, Zoe Bigary Stillwater, Tim
Sundlov BLM, Paul Dworian URS, Aaron Wells ABR
This meeting was held to compare and contrast USFWS’ study plan request and the PSP by
presenting the current study plan and to provide an opportunity for questions and concerns of
the participants. Kevin Fetherston explained that the riparian study would identify
current/natural conditions and use models to show possible effects of the proposed Susitna
Watana Project (Project) on riparian resources below the Project. Kevin stated that very few
aspects of the current study plan are new (since the PSP), with the only changes being
additional details and the RSP format. A PowerPoint presentation which Kevin Fetherston
referenced throughout the meeting can be found at http://www.susitna-watanahydro.org/wp-
content/uploads/2012/09/IFS_Riparian_TWG_mtg_20120911_1500.pdf .
Synthesis of 1980s data and other literature
Bob Henszey requested literature to be included from other rivers both regulated and
unregulated by dams. Kevin Fetherston agreed to add studies on floodplains unaffected by
hydro-regulation to the literature review.
Focus Areas
Focus Areas are ~1-2 mile representative areas along the Susitna River where multiple
disciplines will be conducting integrated studies for a more complete understanding of the
ecosystem. Betsy McGregor highlighted that sampling was not limited to the focus areas and
that sampling would occur at other sites along the river, specific to the issues/concerns for each
resource area. Focus Areas are chosen to capture the riparian, aquatic and fish habitat
variability present in the identified geomorphic reaches for the multidisciplinary study. The
Version November 2, 2012 Page 2
candidate Focus Areas were chosen using best professional judgment by the consultant team
based on a review of the available data.
Study site design
Kevin Fetherston explained that classification of the river corridor into riparian process domains
(segments of the river with similar riparian disturbance regimes) would allow efficient sampling
and modeling of the entire Project area. The hierarchical riparian process domain approach,
with each process domain sampled using Focus Areas, will allow extrapolation of the modeling
data to the larger Project area.
Bob Henszey expressed a concern that the overall instream flow study effort seems to be “fish-
centric”, and he wants to be assured that riparian areas are not overlooked. Kevin Fetherston
explained that in regards to riparian, each Focus Area will include groundwater–surface water
modeling, historic geomorphology, sediment transport modeling, and vegetation and soils
mapping of the entire floodplain. There will be multiple replicates for many aspects of the
Focus Area sampling in the Riparian Botanical Survey however less for groundwater (due to
costs).
Fine sediment deposition can be a key factor in both colonization and the plant community
establishment. Sediment transport and surface water modeling will be 2D modeled in Focus
Areas to evaluate the Project effects on flow and sediment regimes. It was noted that one
option for collecting historic data is to determine the rate of sediment deposition using cesium
137 (a radioisotope deposited during nuclear testing in 1950s and 1960s. Carbon dating of
organic deposition is another option. Dating a number of core samples and combining the data
with tree core dating, one may obtain a thorough understanding of the age of riparian
communities. Sediment deposition rates throughout the Project area will be measured using
isotopic dating of fluvial sediments and dendrochronology.
Bob Henszey said in the methods section, exact study locations are not necessary in the study
plan. When selecting site locations, Bob Henszey asked to be sure to select some locations that
are predicted to be affected by the Project, including a site immediately downstream of the
proposed dam site.
Kevin indicated that the study area will be based on the flow routing modeling to determine the
down river extent of Project operational influence. Final Focus Area selection is expected to be
determined in collaboration with the TWG in early 2013. Candidate Focus Areas were
presented and the following locations were discussed as follows:
MR2 – The river reach MR2 (middle river 2) includes two Focus Areas.
o Upriver Focus Area
Less confined reach with greater floodplain and side channel complexity
Greater suite of vegetation types and ages
o Downriver Focus Area
Bob Henszey noted that the Focus Area excludes an emergent wetland
just upstream of border.
It was noted to include this emergent floodplain wetland in this Focus
Area, if selected as one of the study areas.
Version November 2, 2012 Page 3
Portage Creek Focus Area, MR-5
o Just downstream of Devils Canyon
o Not much floodplain
o Bob Henszey feels this could be eliminated as a Focus Area but that it could be a
site for specific aquatic resources of concern (not for riparian).
Indian River Focus Area, MR-6
o Beaver dams present with associated side channel and floodplain meadow
o Many features imply fish presence
o Moderately confined channel
o Has a range of plant community types
o Kevin Fetherston said the islands’ distinct plant variability may be influenced by
frequent ice floodplain shearing.
Gold Creek Focus Area
o Moderately confined
o Has a range of plant community types
o Includes terraces and side channel
o This Focus Area will be fairly straight forward to instrument with wells for both
fish and riparian needs
Slough 6A, MR-7
o Multiple beaver dams present
o Signs of significant ice influences
o Low density Poplar forest
o Mid-channel island
o Moderately confined channel
o Off-channel water body
o Floodplain peatlands
Slough 8A, MR-6
o Moderately confined
o Has a full range of plant community types
Whiskers Slough, MR-8
o Focus Area located upstream of the Three Rivers confluence
o Moderately confined channel
o Hydrologically unique due to Chulitna River influence and Susitna River
backwater effects
o Mike Wood has a home at this location and can provide observations on ice
formation
o Area was studied in the 1980s and Whiskers Slough has been relatively stable
since 1949, as illustrated in the comparative geomorphology study
o Ice tree scars indicate active ice floodplain interactions
Groundwater-surface water interaction study
Project effects on floodplain vegetation will occur through the interaction of groundwater and
surface water and sediment transport reduction. Bob Henszey noted his understanding that
Version November 2, 2012 Page 4
groundwater sampling is costly so the number of groundwater sampling sites will need to be
limited. Because of this, the Focus Areas need to be carefully selected to represent the range of
variability found within each Riparian Process Domain.
Michael Lilly explained that due to the lateral effects of changes in surface water the Focus Area
well locations will include adjacent hillslopes to help delineate the project hydrologic boundary.
As the river stage is low, groundwater is expected to discharge into the river. When the river
stage is high, river water is expected to recharge shallow floodplain aquifers. Surface water
affects groundwater by means of hydrologic pressure gradients and occurs underground
(where it cannot be seen and does not freeze) and therefore difficult to study. Modeling
groundwater (using MODFLOW software) provides a numerical representation of the effects
surface water pressure has on groundwater. Identifying how groundwater is affected by
changes in surface water can help anticipate the Project effects on groundwater and the
associated riparian vegetation. When modeling groundwater, the stage level is used as the key
influential factor rather than discharge. This is especially important in the ice season when
discharge may be low, but an ice jam may create a localized backwater flood with high
stage/added pressure. Michael Lilly identified precipitation as an influence on both
groundwater and surface water.
River stage changes can be used as a “natural pump test” by its direct pressure effects on
groundwater. Michael Lilly compared the interaction to a water ripple, where there is a delayed
effect with the magnitude and frequency dissipated the further from the event (change in river
stage). Understanding of the groundwater-surface water interactions is based on the number
of unique events observed rather than the number of years observed. Models can make up for
a lack of multiple years of data by using events in the modeling process.
Michael Lilly said that piezometers will be used along the Susitna River in lateral habitats such
as side sloughs. Shallow wells will be useful for the riparian study. With wells placed in specific
plant communities the relationship between groundwater-surface water and the plant
communities can be statistically described using the models. Michael Lilly added that some
species thrive in areas with precipitation as the only water source. The life history strategies of
dominant plants will be summarized with information available. Representative species will be
selected after identifying what species rely on what type of water source and specific condition
(such as geomorphology). Bob Henszey suggested creating a bell curve with groundwater level
on the X-axis.
Ice influences
Chiska Derr asked if isostatic rebound is a factor in the study area. MaryLouise Keefe answered
that it is not at a scale of reasonable influence for riparian concern.
Michael Lilly and Kevin Fetherston indicated that the study would include mapping out the
influence of ice processes based on scarring of trees.
Action Items
The literature review will include river floodplains in both unregulated systems and systems
regulated by dam(s).
Version November 2, 2012 Page 5
The RSP will include the process, criteria and schedule for final selection of Focus Areas.
Version October 31, 2012 Page 1
Instream Flow Study-Fish, IFS-Riparian, Groundwater, Ice, Geomorphology, Water
Quality
Technical Work Group Meeting Notes
2 October 2012
LOCATION: AEA Project offices – 1st Floor Conference Room
411 W 4th Avenue; Suite 1
Anchorage, Alaska 99501
TIME: 8:30 am – 4:00 pm (AKDT)
ATTENDEES: Kathryn Toews LVA, Dudley Reiser R2, Phil Hilgert R2, Bill Fullerton TetraTech,
Bob Mussetter TetraTech, Chiska Derr NMFS, Kevin Fetherston R2, Dirk Pedersen
Stillwater, Betsy McCracken USFWS, Jeff Davis ARRI, Mike Buntjer USFWS, Ron
Benkert ADF&G, Joe Klein ADF&G, Eric Rothwell NMFS, Matt Cutlip FERC, Stormy
Haught ADF&G, Bob Henszey USFWS Steve Padula LVA, Betsy McGregor AEA,
Wayne Dyok AEA, Justin Crowther AEA, Michael Lilly GWS, Scott Crowther
Ratepayers, Jan Konigsburg NHI/HRC, Hal Shepard CWA
ON PHONE: Matt Love VNF, Sue Walker NMFS, Laura Arendall R2, Mike Sondergaard, BLM
This meeting was held to prepare licensing participants for the site visit on October 2-4, 2012 to three
candidate Focus Areas. Dudley Reiser began the presentation “Instream Flow Methods Review October
2-4, 2012” (available at http://www.susitna-watanahydro.org/wp-
content/uploads/2012/09/TWGMeeting20121002.pdf).
Phil Hilgert explained that a number of Focus Areas will be selected to represent the habitats and in
which detailed, cross-discipline resource studies will be completed. After that, supplemental study
locations can be selected to sample additional areas of biological importance. Focus Areas are reaches
of the Susitna River where multiple disciplines will be sampling for a better understanding of the
ecosystem as a whole. Betsy McCracken asked if the Focus Area locations were decided before fish
distribution data were available. Dudley Reiser explained that the candidate Focus Area locations were
selected using best professional judgment and all available data. This includes information on juvenile
salmonids, gathered in previous studies completed in the 1970s and 1980s and recent studies
completed in 2012. The proposed fish distribution study results will be applied to refine study site area
selections, as necessary.
Matt Cutlip expressed concern that AEA assumes the site selection will be confirmed by March 2013
(slide 2). Phil Hilgert explained that without complete habitat mapping, one is unable to employ
statistics to ensure that a substantial ratio of all habitats are being sampled. Agreement is necessary
prior to initiating the 2013 studies and with incoming data, additional sites may be necessary for a
representative portion of all habitats to be studied. Matt asked for justification of the proposed 10
candidate Focus Area locations and Phil said that the Technical Work Group (TWG) meeting held on
9/14/2012 explained the rational for selecting the sites. Phil added that the potential need for lower
river site selection was not presented in the 9/14/2012 meeting, but will be included, with rationale, in
the Revised Study Plan (RSP).
Eric Rothwell suggested that randomization of site selection may be a better approach for extrapolating
the data than basing Focus Area site selection on incomplete data. Wayne Dyok said that a plethora of
Version October 31, 2012 Page 2
data from the 1980s is available to support site selection. Phil Hilgert explained how the 1980s data was
utilized, but confirmed the ability to refine sample site selection as additional data are collected. When
habitat mapping is completed, sites will be double checked to ensure the selected focus areas are
representative and enable the ability to extrapolate data. Dudley Reiser acknowledged that random
selection is one of several approaches to study site selection but that when strictly applied to a system
such as the Susitna River, there is a risk of missing important biologically relevant areas. He indicated
that randomization would likely factor into some elements of the study, such as selection of specific
habitat units for detailed study, or transect selection. Mike Buntjer suggested that some of the licensing
participants’ wariness in using 1980s data may be due to a lack of being presented a summarization of
the data and methods.
Eric Rothwell said that to see the Susitna River system as a whole, one must rely on the Focus Areas as
being representative. However he stressed the need for the data collected at the Focus Areas to be able
to be extrapolated to unmeasured areas. He felt that if AEA is selecting the areas based only on biologic
characteristics, it would be difficult to extrapolate to other disciplines. He said that if the only sites
sampled by multiple disciplines are the Focus Areas, they need to be representative of all resources so
that they can be extrapolated for all resources. Phil Hilgert explained that the candidate Focus Areas are
based on information from the 1980s, current information where available, as well as available
photography and 2012 field reconnaissance. From the photographs and field reconnaissance, a general
sense of the present habitat types was achieved and candidate Focus Areas are based on the
assumption that they are proportionately representative. The Focus Areas include habitat components
and other features (e.g. geomorphology, groundwater, riparian, ice, water quality) that will be evaluated
by other resource disciplines. The representativeness of these areas will be confirmed once the habitat
mapping is available in December 2012.
Bob Henszey suggested that all resources mark their proposed study locations on a map, and where
multiple disciplines overlap, deem that area a Focus Area. Betsy McGregor explained that in a sense,
that is how these candidate Focus Areas were chosen. The study locations were identified verbally by
AEA’s resource experts rather than marked on a figure. Dudley Reiser explained that this approach was
taken so that AEA could identify candidate sites and present them to licensing participants as a starting
point for comments or approval. He emphasized that the 10 proposed Focus Areas are candidates and
not finalized. Sue Walker requested written methodology of Focus Area selection. Betsy McGregor said
that site selection methodology will be included in the draft RSPs, as well as the RSPs to be filed with
FERC in December.
Eric Rothwell suggested not releasing draft RSPs until all comments were completed by licensing
participants and received by AEA. Betsy McGregor explained that the purpose of the draft RSPs is to
provide an updated PSP to comment on that reflected in the continuing consultation with licensing
participants since issuance of the Proposed Study Plan (PSP) in July 2012. Sue Walker noted that this is a
new addition to the Federal Energy Regulatory Commission’s (FERC) Integrated Licensing Process (ILP)
and said that NMFS will be filing comments only on the information provided in the PSP. Betsy
McGregor explained that one can comment on their preferred version (PSP or draft RSP). She agreed
that the draft RSP is an added step to the FERC process that informs one of the progress made since the
PSP and explained that draft RSPs were requested by other licensing participants. Matt Cutlip indicated
that FERC finds the production of draft RSPs useful.
As clarified in the Presentation: Process Overview (found at http://www.susitna-watanahydro.org/wp-
content/uploads/2012/10/IFS-TWGmtgs_Schedule_20120930.pdf), Dudley Reiser introduced a concept
for continuing instream flow TWG meetings to finalize study details beyond the filing of the RSP. He
proposed that an Instream Flow Study – Aquatic TWG meeting be held the third Thursday of every
Version October 31, 2012 Page 3
month. These would rotate between a full day in-person meeting or half day conference call. Focus
groups would meet as needed to discuss specialized details and present them at these TWG meetings.
The general consensus of the group was that everyone will think about this proposal and respond at a
later date.
Dudley Reiser began his presentation. Dudley described the purpose of the following day’s site visit as a
chance for those attending to see many types of Susitna River habitats and to discuss different
methodologies that may be applied for evaluating them, but that AEA was not looking for anyone to
confirm their agreement with Focus Area selection.
Dudley Reiser’s presentation provided an overview of the potential flow-related Project effects and
influential parameters of upstream migration, fish spawning, incubation and fry emergence, and
downstream passage (slides 7-12). He briefly explained the formation and functions of habitats and ice
(slides 13-14). A figure on slide 15 provides an overview of the riparian – flow interaction and slide 16
lists many factors involved in assessing instream flows. Dudley continued the presentation by explaining
the methods employed in the 1980s studies. In addition to the information on the slides (17-21) the
following details were discussed:
IFG4 and IFG2 (PHABSIM) – In the 1980s studies these methods were applied primarily to the
side channels and sloughs. These methods were not applied to the main channel.
DIHAB – This method was utilized because PHABSIM did not capture all fish habitat types nor did
it incorporate groundwater/upwelling as an influence. This method was primarily used to
characterize chum salmon spawning areas.
RJHAB – This method was used to characterize juvenile fish habitats by establishing a series of
grids to relate habitat to fish density using depth, velocity, substrate and turbidity.
Aerial Imagery and Habitat Mapping (Digitization) – This method was used to compare areas
over different flow conditions.
The 1980s studies were never integrated and evaluated fully due to the Project studies ending.
The bullets below list multiple candidate Focus Areas and discussions pertaining to them.
Whiskers Slough - Dudley Reiser proposed repeating the methods conducted in the 1980s at
Whiskers Slough to indicate changes, if any. He noted that Whiskers Slough includes an area
where chum spawning was identified in the 1980s as well as in 2012.
Slough 11 - Slough 11 is a candidate Focus Area but that permits for land access are currently
incomplete. The 1980s had studied instream flow – habitat relationships here. Sue Walker
indicated that she may have aerial photos from September 25, 2012. She asked if any aerial
photos had been taken after the recent flooding. Bill Fullerton said that photos were taken the
previous Sunday and Monday (9/30/12 and 10/1/12). Betsy McGregor clarified an early
comment made by Betsy McCracken, and pointed out that this area was studied for both
juvenile and adult salmon presence in the 1980s. Sue Walker asked if the current study plan will
be studying spawning in the main channel, and Dudley Reiser said it would, if spawning is found.
Jeff Davis hypothesized spawning habitat to be located in the lower side channel of this Focus
Area where Dudley indicated a beaver dam currently blocks upstream passage under most flow
conditions.
Indian River - Dudley Reiser suggested that chum salmon may use the lower portion of the
Indian River for spawning.
Slough 21 – Dudley Reiser feels that breaching flows may be an important factor in this
candidate Focus Area. Many isolated areas seem to be influenced by groundwater. It will be
Version October 31, 2012 Page 4
important to understand the breaching flows to these areas with respect to life stage
periodicities and how Project operations may influence these.
Eric Rothwell was pleased to see the current study plan relating flow to groundwater, as the 1980s
studies did not. Michael Lilly added that the 1980s provided good observational data but lacked the
modeling tools. With the current tools, the instream flow studies will be able to advance the
groundwater efforts for a better understanding of the surface water - groundwater relationship.
Joe Klein asked if pre-flood data were collected. Michael Lilly said that about 98 cross sections were
completed and that changes in the river system are being observed including mass wasting. The
helicopter pilot had taken oblique photos from his helicopter throughout the summer of 2012.
Jeff Davis voiced concern with the ability to correlate habitat and fish use, particularly juveniles and that
areas with fish may be missed. He feels it difficult to include all habitat characteristics that drive fish
distribution and fish growth. Dudley Reiser said that as many variables as possible will be studied.
The Fish and Aquatics Instream Flow Study leads will be working with the Water Quality studies lead to
create FLIR/TIR imaging. This will be scheduled for optimal implementation to identify upwelling areas.
Jeff Davis is concerned that a thermocline will not be identifiable using these methods. Dudley Reiser
said that hopefully, the mixing point of the temperatures will be identified and direct the team to the
location of upwelling. Dudley continued his presentation by explaining contemporary methods to assess
effects using the Sultan River Projects as an example of past implementation methods (slides 23-46).
PHABSIM – Dudley Reiser explained that PHABSIM addresses microenvironments:
1D Modeling - This method models physical parameters.
2D Modeling - This method models habitats spatially based on physical parameters. Allows one
to create polygons of different habitats.
Stranding/Trapping and Varial Zone Analysis
Phil Hilgert presented an example of stranding/trapping and varial zone analysis using the Baker
Hydroelectric Project. This project is located on the Baker River, a tributary of the Skagit River in
Washington. When compared to the Susitna River the Skagit River is similarly glacially influenced, but
has a lower gradient and 50 percent higher main channel flow. Coho and sockeye spawn in the
tributaries during clear water flow. The Baker Project causes tributary flows to vary between 4000 cfs to
80 cfs and flow routing models have been applied to compute the effects of this high flow flux. As flow
effects travel downstream the wave height and wavelength dissipate. The flow routing model being
developed by Stuart Beck, and anticipated to be available December 2012, will provide the same
information for the Susitna-Watana Project during ice free conditions. The ice model, which will be
developed by HDR, is anticipated to be available at a later date due to 2012-2013 winter data collection
inputs.
Spawning / Incubation Model
Phil presented the spawning/incubation model developed on the Baker Project noting a similar model
will be developed for the Susitna-Watana Project. The spawning/incubation model will characterize the
groundwater, surface water and temperature influences on spawning and incubation. When modeling,
if substrate is mobilized due to flow velocity, one will consider the eggs a complete loss. Mike Buntjer
asked if the model will take into account the change of temperature due to possible moving of fine
sediment and that a total loss may not be the case in such a scenario. Phil Hilgert answered that the
Baker Model did not. That model considered water hardened eggs without water for two days, as a
total loss.
Version October 31, 2012 Page 5
Ramping Rate Models
Phil Hilgert explained that ramping rate models indicate the survival of specific life stages of specific fish
species relative to flow and velocity. For example, salmon fry (<50 mm) are considered to have a
mortality of 100 percent when stranding occurs. Trapping is not considered to cause immediate
mortality of 100 percent. The mortality may increase with the duration of the time they are trapped
due to elevated water temperatures and increased predation. Another possible influence is the
difference of day versus night activity (steelhead have the same response for day and night flow
changes). Naturally the Susitna River experiences three annual stage drops. By using screw traps to
collect periodicity information, one can see when stranding and trapping are most critical. The river
productivity study will be looking at colonization rates which may be integrated into the ramping rate
models. Phil Hilgert explained that the models will initially be looking at two load following events a day
and can adjust time periods upon operations. Discussion ensued regarding slope gradient and
susceptibility to stranding. Joe Klein asked that areas within the Middle Susitna River where slopes are
less than 4 or 5%, where fish are more susceptible to stranding, be identified. Phil Hilgert confirmed
that would be done as part of the study. Joe also indicated that Hunter compared natural and regulated
ramping rates and asked for both to be incorporated into the IHA table.
Phil Hilgert discussed the Boundary Hydroelectric Project on the Pend Oreille River in Washington as an
example of ramping rate model use. A stranding index of less than 4 percent gradient was used. A
trapping index used in the Boundary Project defined breaching elevations for trapping areas. For the
Boundary Project, tools were modified as observations were made. For example, the presence of
macrophytes impacted stranding rates. The Susitna River does not have significant macrophyte
presence, but emergent vegetation, which is present may have a similar impact.
Betsy McCracken asked if any of these methods have been used on unregulated rivers. Dudley Reiser
stated that to his knowledge, these types of studies are typically conducted on regulated rivers. This is
because it has not been necessary/funded to study unregulated rivers in such detail.
Gradient will be presented as a GIS product with a range of colors representing percent gradients. This
will show trapping areas relative to different flows. Jeff Davis asked if ice layers, overflow and stranding
on ice or within ice are being considered as influences on stranding and trapping. He hypothesized that
increases in winter flow will cause breaching into lateral habitats and displace fish to these areas. Phil
Hilgert explained that an ice routing model should show the effects of added winter flow on ice and
lateral habitats. Jeff Davis is concerned that if the Project avoids stranding and trapping by increasing
load following, added velocity may dislocate fish. Dudley Reiser explained that vulnerable life stages will
be considered when determining load following. Jeff added the need to look at fish’s decreased ability
to swim in cold winter water. Joe Klein asked if it were possible to operate the Project in the early
winter with a more constant flow level in order to create stable ice cover. Robin Beebee recalled the
Peace River Project in British Columbia that operated in such a way to get rapid and stable ice formation.
The reasoning for this was to avoid ice jams for the sake of avoiding floods in towns downstream.
Method Selection
Dudley Reiser reviewed the factors that will be used in determining methods (slide 52). He said that the
process, criteria and schedule are to be agreed upon and that part of the process in determining
methods is applying professional knowledge and experience. The site visit the following day is intended
to help those participating to gain first-hand knowledge of the complexity of the environment and how
methods may be limited by the habitats and site logistics. Dudley explained the considerations when
choosing methods and wants everyone comfortable and accepting of methods and models. Matt Cutlip
said that at times, details may not be resolved. FERC can order specifics be added to a plan and has the
Version October 31, 2012 Page 6
authority to approve an approach regardless of a disagreement. He explained that the ILP includes a
mechanism for additional changes post-RSP filing if needed.
Dudley presented slide 53, a chart of proposed methods, and informed everyone that these were simply
candidate methods and changes may be necessary in the future. He asked all attending the site visit to
consider these methods while in the field. Eric Rothwell questioned if the instream flow team would be
sampling water quality. Dudley Reiser explained that certain water quality measurements may be taken
by instream flow and linked to the water quality study results. Michael Lilly said that the Water Quality
Modeling Study’s model will be at a larger scale than instream flows.
Joe Klein asked if PHABSIM 2D modeling was intended to be used for all study sites. Dudley Reiser said
that at every site, both 1D and 2D will be considered, and the most practical model will be applied.
Accordingly, Joe Klein requested “(2D)” to be changed to “(1D, 2D)” in the proposed habitat modeling
techniques table (slide 53). Dudley Reiser continued that the lower river is only practically modeled
using 1D. Betsy McCracken requested 2D modeling to be applied to tributary mouths. Dudley explained
that it depends on the question being asked as to which tool to use. Michael Lilly explained that
modeling everything at all times is not practical or scientifically defendable. Dudley mentioned the use
of 1D, 2D and habitat mapping for the Clackamas Hydroelectric Project in Oregon and that the results of
all three methods in the same stretch of river were generally similar. He mentioned that even though
there are advances in methodologies and modeling techniques all the time, these do not invalidate
earlier methods and they should not be dismissed outright if they provide reliable results. Thus, specific
methods and models will be selected based on a variety of factors including the types of habitats being
measured, logistical considerations, need for spatial depiction, etc.
Pilot Winter Studies
Resource discipline leads discussed an approach for completing pilot winter studies during the 2012-
2013 winter. These studies will determine logistical constraints such as safety and access, as well as the
practicality of using different sampling/monitoring techniques. The study objectives are presented in
slides 63-67. The following clarifications were discussed in the meeting.
With the use of videos and data from the 1980s studies, open water leads may be identified. Intragravel
dissolved oxygen (DO) and temperature conditions may be affected by the Project and have implications
on egg survival. Intragravel temperature probes will be installed at different locations and depths; these
will be coupled with DO meters to see if relationships between flow and temperature and DO can be
detected. Michael Lilly stated that there may be a need in using probes that remain on site and are
removed to retrieve the data as well as probes that are not disrupted when retrieving the data. He will
be looking into the best way of collecting DO in extremely cold waters (-0.2°C - 3.0°C). Underwater
cameras may be used to observe fish activities in different locations at different times. Joe Klein asked if
cameras can be deployed remotely. Michael Lilly said that he is looking into it. Dudley Reiser
mentioned the use of pressure transducers to understand the relationship of flow and stage with
temperature changes in reference to the main channel. Michael mentioned that piezometers may be
placed in shallow streambeds to observe hydraulic gradients. He explained that an increase of ice
causes an increase of pressure in the main channel. This may affect the groundwater level. An
understanding of these relationships is necessary when evaluating Project scenarios. Dudley proposed
the use of stand pipes and Bob Henszey mentioned that stand pipes may be difficult to maintain through
the winter. In regards to fish sampling, Dudley said that minnow traps, electrofishing if open areas are
present, trot lines (which the 1980s studies used), and other techniques may be used. Stormy Haught
reminded AEA that any winter instrumentation installation requires a fish habitat permit.
Version October 31, 2012 Page 7
Mike Buntjer asked if PIT tagging will be used this winter. Dudley Reiser said that it is not planned for
this winter. Jeff Davis suggested using a hand held antenna in the winter to track fish movement. He
suggested contacting Dan Renella of the University of Alaska Fairbanks. Mike asked if the plan would
continue for the winter of 2013-2014 and Betsy McGregor answered yes, as well as 2014-2015. Betsy
McCracken asked how these winter studies will be presented in the RSP. Dudley Reiser said that in
terms of the RSP, the pilot winter studies will be described with a note that additional studies will be
conducted in 2013/2014 and 2014/2015. Jeff Davis asked if the pilot winter studies will be targeting
areas of spawning, emergence and rearing. Dudley Reiser explained that the intent is to cover multiple
habitat types. He suspects that the open water leads will be in areas utilized by rearing juveniles but
they may also have resident adults. Jeff Davis suspects that sloughs will have less ice thickness but no
open water. Dudley explained that at Whiskers Slough Robin Beebee’s videography in 2012 had
captured what seems to be open water leads.
Matt Cutlip asked if the equipment is being placed before the ice cover begins. Michael Lilly said that
the plan is to start as soon as possible, but may not be able to beat the ice. He said that all will be done
as safety permits. Betsy McCracken finds the pilot winter studies a great addition and asked if they will
be included in the RSPs. Wayne Dyok said that they will but planning is already underway due to timing.
Meeting Adjourned.
Action Items
The group is going to consider holding Instream Flow and Water Resources TWG meetings every
third Thursday beginning in January 2013.
In the proposed habitat modeling techniques table (slide 53), “(2D)” to be changed to “(1D, 2D)”
to reflect that either technique will be used, as appropriate.
Michael Lilly is investigating the feasibility of using under water cameras that can be deployed
remotely.
Jeff Davis suggested using a hand held antenna in the winter to track fish movement. He
suggested contacting Dan Renella of the University of Alaska Fairbanks.
Meeting Summary
Susitna-Watana Hydroelectric Project Licensing
AEA Project Offices, First Floor Conference Room
411 W 4th Avenue, Anchorage, AK
Recreation and Social Sciences Survey Follow Up Meeting
October 3, 2012, 9:00 am – 12:30 pm
Attendees:
Organization Name
ADF&G Joe Giefer
ADNR (State Parks) David Griffin
AEA Wayne Dyok
AEA Betsy McGregor
BLM Denton Hamby (by phone)
FERC David Turner (by phone)
McDowell Group Donna Logan
McDowell Group Bob Koenitzer (by phone)
MWH Kirby Gilbert (by phone)
Northern Economics Pat Burden
NPS Cassie Thomas
NPS Harry Williamson (by phone)
URS Bridget Easley
URS Tim Kramer
URS Louise Kling (by phone)
ERM John Gangemi (by phone)
Louis Berger Group Lisa McDonald (by phone)
Introduction and Meeting Overview –Kirby Gilbert (MWH)
Kirby provided an overview of the meeting objectives which were to go over the plans for Key
Observation Points and process of analysis for aesthetic resources, river flow survey plan, and
have an opportunity for dialog on the recreation surveys and survey instruments as a follow up to
the September 20, 2012 meeting. This was followed by a brief discussion on the timing of
Revised Study Plan (RSP) it terms of a draft being available for review. Cassie Thomas (NPS)
asked when she might get to see a copy of the draft RSPs for recreation and aesthetics. Betsy
indicated that the plan was to have the draft RSP section for Recreation and Aesthetics available
toward the end of October but hopefully by the time of the next working group meeting (Oct.
17th).
Aesthetic Resources
Louise Kling (URS) provided an overview of the aesthetic resource study planned for the
2013/14. Two approaches will be used: 1) inventory of visual resources for the entire study area
based on BLM’s VRM & landscape level regions, 2) a more focused assessment of the direct
impacts to visual resources from features of the Project (reservoir, power lines, access corridors).
Louise indicated that the study area for the inventory will include river segments downstream of
Talkeetna.
Louise provided an overview of each visual resource landscape region within the Project area
and the potential views that may be affected within each region. She stated the goal was to
determine if changes will be detectable to users and to help inform the siting or design of
facilities early on in the engineering process.
Wayne Dyok (AEA) noted that the Aesthetics study effort will need to coordinate with the
Geomorphology study group in terms of looking at how turbidity levels might change leading to
changes in water color and clarity. Louise confirmed that this would be occurring and added that
further collaboration with the Geomorphology group would occur to determine if there might be
any changes in moving bedload that is currently audible to boaters during certain conditions.
David Griffen (ADNR) stated that the Middle Susitna river region will be a major focus for the
State Parks Division because Denali State Park in in this area and they will be interested in visual
analysis locations in this area. Dave noted that the Alaska Railroad would also likely be
interested in understanding any potential aesthetic changes resulting from the Project also.
Louise presented an overview of “Target Analysis Locations” that would include KOPs, and
discussed the different types of locations as well as the views and seasons to be assessed.
Further discussion followed with respect to how each location will be initially assessed in terms
of its nexus to the project and how each will be assessed by identification of the medium of
change (form, line, texture) rather than making scenic determinations. There was follow on
discussion of why the term KOP (Key Observation Point) was being replaced with “Target
Analysis Locations”. Louise stated that this was done to avoid confusion in terminology and
capture locations that characterize different aesthetic types or “observation areas” that might be
not really be “key” observation points. Louise explained that this is needed to capture impacts to
dispersed users that are not associated with standard views.
Harry Williamson asked if the use of “Target Analysis Locations”, rather than standard KOPs,
would complicate the BLM’s VRM process. Louise explained that this is similar to the direction
BLM is taking with the VRM process since it focuses on the continuum of users’ experiences,
rather than a static location within the “observation area,” or the area represented by the Target
Analysis Locations. Harry and Cassie Thomas (NPS) confirmed their support for this approach.
For winter area, Cassie asked if the study would include the analysis of night sky conditions with
respect to proposed facilities and inquired about a baseline analysis of current night sky
conditions. Louise confirmed that this analysis will occur, with a focus on facilities lighting.
Wayne asked for this to be referenced in the RSP.
Following a comment from Cassie about ensuring coordination with the biological and physical
resource groups, Louise explained that coordination was essential and when appropriate, Target
Analysis Locations will be paired with other study analysis points to take advantage of physical
and biological data being collected by other teams’ work (changes in river flows, ice formation,
gravel bars, etc.).
Louise summarized the process through which baseline data will be collected from users through
executive interview and the rationale behind waiting until 2014 to potentially use focus groups.
She emphasized that by waiting to use focus groups until project attributes are more fully laid
out, she hopes to avoid clouding place based values with “for/against” comments. Cassie
Thomas agreed with the concept of not using focus groups too early in the process if we could
not really pin-point or clearly outline the potential changes indicating it would be better to wait
until facilities are sited and likely flow regimes determined.
David Griffin asked if new recreational amenities will be provided by the Project, to possibly
offset impacts. Wayne and Kirby explained that the Project will have a recreation plan and that
would likely include provision for new facilities and management of recreation uses at the
Project, but management related to access is also a policy item that needs to be considered at the
larger State level, taking into consideration potential impacts. David Griffen mentioned that he
had some historical Susitna River trip reports from the 70s and 80s that he could make available.
In conclusion, Louise emphasized that many locations will be assessed but only a small subset of
points that will be simulated for future change using Project renderings. There are many factors
that will be considered in evaluating key observation points including seasons, and even things
like time of day issues such that points will likely be adjusted in the future.
River Flow Study
John Gangemi (ERM-Oasis) provided an overview of river recreation flow and ice processes
study and outlined objectives of the study, defined reaches, and discussed approaches that will be
used. He broadly summarized the goals of the study as determining: 1) who uses the river
corridor and for what purposes, 2) what flow levels users need for these experiences, 3) how
these users access the river. John then went over some study methods that will enable him to
assess users-based considerations.
There then was some brief discussion of the different reaches that have been defined for the flow
study and what attributes were used to define them. Cassie asked for more coordination with
other study areas that have defined different river reaches along the river and requested a table or
a figure that enabled for cross reference between other study reaches. Kirby specifically
requested an overlay of John’s River Flow reaches on top of the standardly defined reaches
(Upper, Middle, Lower). Following this, Cassie suggested the use of water class, rather than
access, could serve as a means to define reaches for the river flow study.
Joe Giefer (ADF&G) inquired why the analysis stopped at the Parks Highway Bridge, given
potential flow impacts downstream. John explained that he thought sufficient baseline data on
recreation flow levels would be collected below the three rivers confluence, south of Talkeetna,
to extrapolate impacts downstream of the Parks Highway Bridge. He emphasized that the
purpose was to determine flow levels necessary for recreational activities, not the levels of
activity.
Cassie suggested John Gangemi follow up on the 60 hunters who were stranded along Cash
Creek, which was recently described in an Alaska Dispatch article. Denton Hamby (BLM)
indicated that the BLM had a list of user groups that based on special use permits, are active in
this area and that he would make it available upon request.
There was much discussion on how the electronic survey would be utilized for different reaches
of the river, with a focus on how these users could be reached and be useful to help inform the
study team on how flow changes might affect their experiences. Cassie suggested that an online
survey should be specifically tailored for each reach based on the likely users of each reach.
This was followed by a discussion of survey methods that could be used to interview the small
number of people within the white water community (30 people) who have use used the Devils
Canyon reach, and how their flow needs differ from other users.
Kirby requested that the online survey methodology and protocol for executive interviews be
clearly laid out in the RSP and discussed by the river flow study reaches.
Cassie suggested that focus groups could serve to help acquire more detailed information from
user groups; however, John recommended that the use of focus groups be reserved until 2014,
after baseline data, executive interviews, and some initial flow management options have been
better defined.
Survey Instruments – Covering NPS Written Comments
Donna Logan (McDowell Group) led a discussion of NPS comments on the proposed survey
instruments and how each comment was going to be addressed. These included comments on
the study area boundary, intercept points to be added and removed, the need for adjustments in
survey content, definition of party size vs. group size, use of the online survey, and the reason
why the voter registration list was chosen for the mail survey.
Cassie asked the team to consider and layout more defined contingency plans for lost or missing
data, particularly in relation to the closure of the King salmon season and its impact on
recreational users. David Turner (FERC) indicated that it was extremely difficult to assess all
potential issues; however, this issue could be addressed by clearly indicating the process through
which data gaps would be addressed. Kirby indicated that while 2013 would be the major focus
for collecting data, additional data collection in 2014 could be used to fill in any identified gaps
and many studies are trying to use past information and data to help characterize the resource
conditions and trends.
In response to some discussion regarding how to introduce the Project to survey participants,
Wayne indicated that AEA currently has “fact sheets” that can be handed out to survey
participants and during executive interviews.
Pat Burden (NEI) discussed the recreation activities that would be the focus of a possible future
RUM model (boating, hunting, fishing, and snow machining), but indicated that riding ATVs
and sightseeing may also be added to the analysis. This was followed by a discussion of
displacement issues and how NEI is considering using the RUM model to address displacement
potential and more refined recreation demand.
In closing, Donna brought up the need to reduce the number of questions on the current intercept
survey. She emphasized that many questions will need to be dropped and shifted to the mail
survey, executive interviews, or collected using other methods.
Joe Giefer expressed concern that concerns of some ADF&G staff on the Study Plan were no
long relevant based on the discussions occurring and asked if the Revised Study Plan would be
available before the next technical working group. Betsy indicated that the draft RSP would be
available as soon as possible around the time of the next TWG meeting, along with a response
table for all comments received so far.
Action Items:
Distribute draft RSPs for recreation and aesthetics and comment-response tables in October
Aesthetics study group needs to makes sure inputs from geomorphology and coordination are depicted in
its interdependencies chart or in the text of the study plan
Louise to outline use of Target Analysis Locations and how KOPs fit into that plan
Louise to make sure night sky analysis is addressed in study plan with some analysis regarding potential
changes due to likely facilities lighting.
Louise to describe how some target analysis locations will be paired with other resource study sites.
David Griffin to provide Wayne historical trip reports which Wayne will then forward to recreation
planning team.
The river flow study plan needs to have a map that overlays the Project standard study reaches with their
specific river flow study reaches (map and table formats would be useful)
The recreation study group needs to check into the recent stranding of 60 hunters near Cash Creek to learn
of current access considerations (Alaska Dispatch article)
Denton Hamby of BLM to provide recreation study team with lists of user groups BLM has issued or
considered in Special Use Permits.
River flow study needs to create online survey for all three study reaches, not just limit it to Reach 2
(Devils Canyon). Provide specifics in how each reach will be handled differently both in questions asked
and methods used to reach out to potential users who might fill out surveys.
The recreation study should discuss how they might gather relevant information even if King salmon
closures continue.
The intercept survey needs to be looked at for number of questions and consider ways to reduce to combine
questions if we are reaching a limit, based on judgment and past survey efforts, to which a survey
responder will be willing to participate.
Version October 31, 2012 Page 1
Instream Flow Study-Fish, IFS-Riparian, Groundwater, Ice, Geomorphology, Water
Quality
Field Reconnaissance Debrief Meeting Notes - DRAFT
October 4, 2012
LOCATION: Northern Susitna Institute
22510 S. Talkeetna Spur Rd
TIME: 1:00 pm – 4:00 pm (AKDT)
ATTENDEES: Kathryn Toews LVA, Dudley Reiser R2, Phil Hilgert R2, Bill Fullerton TetraTech,
Bob Mussetter TetraTech, Chiska Derr NOAA, Kevin Fetherston R2, Kirk Pedersen
Stillwater, Betsy McCracken USFWS, Jeff Davis ARRI, Mike Buntjer USFWS, Ron
Benkert ADF&G, Joe Klein ADF&G, Eric Rothwell NMFS, Matt Cutlip FERC, Stormy
Haught ADF&G, Bob Henszey USFWS
ON PHONE: Steve Padula LVA, Betsy McGregor AEA, Wayne Dyok AEA, Matt Love VNF, Jan
Konigsburg NHI/HRC, Michael Lilly GWS, Sue Walker NMFS, Hal Shepard CWA
This debrief session was held to review the activities and impressions of those who attended the field
visit which took place on 10/03/2012 and the morning of 10/04/2012. Attendees were able to visit
three of the candidate focus areas for the Instream Flow Study: Whiskers Slough, Slough 8A and Slough
6A. All debrief attendees were present on the field trip with the exception of Kathryn Toews. Michael
Lilly attended the site visit on 10/03/2012 but was unable to attend the visit on 10/04/2012. The site
visit was conducted via boat along the Susitna River. AEA’s water resources contractors who organized
and lead the field visit and their respective responsibilities include:
Dudley Reiser - Instream Flow Program Lead
Kevin Fetherston - Riparian Instream Flow Study Lead
Phil Hilgert - Instream Flow Study Lead
Bill Fullerton - Geomorphology Program Lead
Michael Lilly - Groundwater-related Aquatic Habitat Study Lead
River conditions and flood effects
It was noted that the river flow on 10/4/12 was 15,800 cfs. The most recent flood (mid-September
2012) included flows as high as 78,900 cfs. River bed effects from the flood were observed by the
Mahay’s river boat captain at the three river confluence, with less bed changes noticed as he traveled
upstream.
Bill Fullerton and Dudley Reiser mentioned that wood seemed to play a larger role at Whiskers Slough
than Slough 8A with an extensive addition of large woody debris from the flood. Bill Fullerton also saw
fine sediment with vegetation removed by the flood at Slough 8A.
Kevin Fetherston noticed that at Whiskers Slough, the flood penetrated the willow/alder zones to a level
of at least two feet above the full bank. Dudley Reiser saw a geomorphic change in the area of Whiskers
Slough that was previously occupied by spawning chum salmon on September 13, 2012.
Round Table Discussion
Dudley led the group in a roundtable discussion to obtain initial impressions from those participating in
the field visit.
Version October 31, 2012 Page 2
Responses are summarized below:
Michael Buntjer – He was surprised to see less spawning fish in the sloughs, seeing only one sockeye
Slough 8A) and one coho salmon (Whiskers Slough). He speculated this may be due to the recent high
flows.
Bob Mussetter – Seeing the scale of the system was helpful in understanding the habitat modeling
challenges. 2D is the only practical approach at a complex site such as Whiskers Slough and Slough 8A,
while 2D modeling is not necessary at Slough 6A. He also mentioned it is important to differentiate
substrate variability relative to flow conditions. He said that the bed of Whiskers Slough did not appear
to have been mobilized in the recent flood but it was at Slough 8A. He feels that a 2D sediment transfer
model of both sites would help explain that process.
Ron Benkert – He was impressed by the system and how well the main tem handled the recent high
flows without signs of extreme changes and instability. Sediment deposition was seen high from the
current river levels, but the vegetation was not ruined. It was nice for him to see first-hand the sites and
likes the focus area approach being proposed.
Stormy Haught –Stormy Haught noted that all three visited focus areas were very different from each
other. He suspects that if we look at the 1980s transects where they found suitable spawning habitat,
we would currently not find the same conditions due to the recent flood impacts. This makes him wary
of using only 1980s data in selecting sites. Dudley Reiser explained the difficulty in identifying spawning
habitat. An area that may not look suitable for spawning as defined by depth/velocity/substrate
combinations may actually be. This is because the system may be more complex than what meets the
eye due to factors such as groundwater upwelling. Being out there made Stormy more aware of the
groundwater-surface water interaction importance and challenges in understanding the system’s
complexity.
Eric Rothwell – He expressed concerns of the ability to choose sites suitable for extrapolating data to
the river as a whole. He also noted that the three visited candidate focus areas were very different from
one another. Eric agreed with 2D modeling approach at Whiskers Slough and Slough 8A. While on the
river, Eric found it easy to see the multiple levels of habitats and how habitat classifications can change
with flows. He is unclear on how these changes will be addressed in the studies. When assessing the
Project effects on groundwater, Eric believes the first objective must be to understand the groundwater
– surface water interactions. Eric also requested a draft list of data collection techniques (methods and
parameters) at all fish study sites. Dudley addressed this by saying that detail will be added to the draft
RSPs and more so in the final RSPs with further details added continuously as they are available.
Betsy McCracken – Betsy indicated she had gained a more interdisciplinary understanding while on the
river. She was impressed by the habitat complexity and saw how the various areas were fitting into the
current classification system. While visiting the river, Betsy realized the importance of groundwater and
its strong role in the environment. She also was pleased to hear it confirmed that some focus areas will
include habitat suitability criteria (HSC) sites with other HSC sites being located outside of focus areas.
Bob Henszey – Bob appreciated this time of year for better viewing and navigation on ground. He
would have enjoyed more time at each site. He expected to see more changes in the channel from the
recent high flows. Ron Benkert noted that the most recent flood was the second highest on record. With
that being true, Bob Henszey wonders how the landforms are built in the Susitna system if such a
Version October 31, 2012 Page 3
significant flood did not considerably influence the existing landforms. He also noted that the trees in
the areas visited are uniformly aged, lacking the usual border of younger trees. Bob suspects this to be
due to stable channels. Bill Fullerton noted that these trees could be a useful way to age the landforms
that they grow on.
Chiska Derr – Chiska noted that Slough 6A included more established habitats which encompassed an
old beaver complex. In this complex, she saw moving water and asked how much through flow and how
much groundwater can be contributing to this movement. She also saw a floating bog at Slough 6A and
explained that the taxa on such a bog can help calculate how old the structure is due to the change of
vegetation associated with a timescale. Chiska also noted that according to the currently proposed
study plan, this floating bog is considered outside the study area and would not be captured as part of a
transect. She would like to see such structures included in transects. Kevin explained that off channel
water bodies, such as these, increase in age as one goes away from the river. The peat building systems
are the furthest from the river and these areas will be included in the studies. The lateral extent of the
study area will include areas that could be affected by Project-induced changes in the flow and sediment
transport. It is important to include lateral systems due to water flowing from the river to channel
areas. It is important to also consider hill slope vs. river input, and LiDAR will help us to evaluate this
input.
Matt Cutlip – Matt Cutlip noticed how sterile some habitats looked without fish being present where he
expected. He asked where fish are presently in the river, if not in these areas. If these habitats are not
being utilized now, when are they being utilized? Matt is interested in how the fish distribution study
will capture such variability. Dudley Reiser suspects that the fish may have been displaced from the side
channels to the main channel and that the habitats are used opportunistically at different times and
different flows.
Dirk Pederson – Dirk Pederson was impressed by the lack of bed load transport in the side channels
from this recent flooding event. He expressed that lower Whiskers Slough looked like ideal rearing
habitat and upstream seemed to have groundwater input without any productivity. Dudley Reiser
identified visually detectable upwelling at the north end of the slough as well.
Jeff Davis – Jeff Davis mentioned that he understands that resident fish are using the main channel in
the winter. He had seen “pockets” along the banks which looked like low velocity areas similar to where
he has seen fish in the Little Susitna River in summer months. Dudley Reiser indicated that he noticed
these structures at the southern end of the focus area of Slough 6A and confirmed that they are within
the currently proposed study areas. Jeff Davis feels that the river’s flow affects the water level in beaver
ponds in Slough 6A. Kevin Fetherston suspects this is due to a difference in pressure (relating to
groundwater) and this interaction would be modeled with MODFLOW. Bill Fullerton noted the
complexity of beaver dam water levels by explaining that beavers control the water level to their liking,
adding an additional influence to the water level.
Phil Hilgert stated he was curious regarding night time activity of juvenile fish and Dirk Pederson expects
many to be in the beaver ponds.
Jeff Davis also mentioned that the percent of fines in the riverbed influence its permeability. This may
be influenced by the Project and can be a factor in the groundwater – surface water modeling. Jeff
raised the hypothesis that if Project effects result in a coarsening of the substrates, permeability would
be increased, resulting in a quicker interaction with the groundwater. Eric Rothwell asked that if the
Version October 31, 2012 Page 4
Project changed sediment transport, the effects on hydraulic conductivity be looked at during the
studies. Ron Benkert mentioned the need for drilling to find layers and lenses when determining the
controls on downward movement of water.
Kevin Fetherston - Kevin saw evidence of flooding of plant communities and sediment deposition of
about 4 cm in certain areas due to this most recent flood. Kevin also noted higher elevation floodplain
forms with cottonwood. Cottonwood have a general life expectancy of 150 years, implying that the
river influences these areas within that time. Water levels could have reached these areas as a result of
ice jams since floods do not seem to go to such high elevations. The most recent flood laid sediment
occurred in alder and willow thickets, but not above. Kevin also explained that the smaller willows,
which seem to be only a few years old, based on their size, are actually much older and are unable to
grow very large since they are constantly laid down by winter ice. The root structures are characteristic
of much older plants.
Phil Hilgert - Phil Hilgert asked for all to consider the importance of stage as well as the flow. In winter,
ice jams cause the stage to increase while the flow does not, causing floods. Bob Mussetter mentioned
that most large floods occur June-August. The 2006 flood in late August saw flows around 60,000 cfs.
Joe Klein said that high water event history would be interesting to look at with the stage information.
This may be historically recorded in reference to property damage.
The meeting concluded with a request from participants for timely posting of meeting materials in the
future.
Summary
Whiskers Slough and Slough 8A were recognized as good candidates for 2D modeling. Most participants
expressed surprise of the little observed effects of the recent flood, and surmised the Susitna River to be
a resilient system accustomed to variable influences. Groundwater-surface water interactions play a
large role in the riparian and lateral habitats and are recognized as an important aspect of the overall
study effort.
Susitna–Watana Hydroelectric Project
Agency Consultation on Proposed Study Plan for Waterbirds
Thursday, October 4, 2012 — 10:00 A.M.–Noon
AEA conference room, 411 West 4th Avenue, Anchorage, AK
Invitees: Maureen de Zeeuw, USFWS; Bob Platte, USFWS; Catherine Berg, USFWS; Mark
Burch, ADFG; Mike Petrula, ADFG; Brian Lawhead, ABR, Inc.; Robin Reich, Solstice
Alaska Consulting; David Turner, FERC; Betsy McGregor, AEA
Goal: To understand and resolve differences between agency comments/study requests
and AEA’s Proposed Study Plan, as reviewed at the Terrestrial Resources Technical
Work Group meeting on Aug. 9, 2012, for incorporation into AEA’s Revised Study
Plan
Agenda Items:
Discussion and resolution of differences between USFWS study request (May 2012),
ADFG comments on AEA study request (May 2012), and AEA’s Proposed Study Plan
(July 2012):
Study-area extent (3-mile vs. 15-mile buffers around Project area & reservoir)
Breeding-pair & brood survey methods & relationship to standard survey protocols
- foot surveys vs. aerial platforms
- aerial transect spacing for breeding-pair surveys
- number and timing of surveys
Specialized surveys (Harlequin Ducks, tree-cavity nesters)
Migration surveys (visual and/or nocturnal radar sampling; Project area priorities)
Other topics?
Meeting Summary
Susitna–Watana Hydroelectric Project Licensing
AEA Project Offices, First Floor Conference Room
411 West 4th Avenue, Anchorage, AK
Waterbirds Study Plan, Follow-up Meeting
October 4, 2012, 10:00 a.m. – 12:00 p.m.
Attendees:
Organization Name
USFWS Maureen de Zeeuw
USFWS Robert Platte
ADF&G Mark Burch
ADF&G Mike Petrula
FERC David Turner (on phone)
AEA Betsy McGregor
AEA Justin Crowther
ABR, Inc Brian Lawhead
MWH Kirby Gilbert (on phone)
Solstice Alaska Consulting, Inc. Robin Reich
Van Ness Feldman Chuck Sensiba (on phone)
After introductions, Brian opened the meeting and said that the objective of the meeting was to discuss
and resolve differences between USFWS’s study request (May 2012), ADF&G comments on AEA’s study
request (May 2012), and AEA’s Proposed Study Plan (July 2012).
Waterbird Study Area
AEA proposed a 3-mile buffer around the Project area, whereas USFWS originally requested a
15-mile buffer around the Project area and reservoir. AEA proposes to modify the 3-mile buffer
area by extending outside the buffer in some places to include certain waterbodies that were
surveyed in the 1980s Susitna Hydro Project study, such as Clarence Lake and another lake south
of there, as well as several lakes north and east of the “Big Bend” of the Susitna River. In
addition, small “holes” between the Chulitna and Gold Creek corridors, which resulted from
applying the 3-mile buffer, would be eliminated and waterbodies in those areas would be
included in the study area. USFWS agreed that a 15-mile buffer radius was not necessary.
The USFWS requested that the minimum waterbody size, the spatial extent, and number of
waterbodies to be surveyed should be identified in the study plan.
The group agreed that the 3-mile buffer around the Project area (infrastructure area, access and
power transmission corridors, reservoir inundation zone) would be acceptable, with the
modifications discussed.
The group agreed that, within the 3-mile buffer, complete waterbody searches, rather than
sampling transects, would be flown, except in the easternmost portion of the study area (near
Meeting Summary: Waterbird Study Plans Page 2 of 4
Susitna-Watana Hydroelectric Project
October 4, 2012 10:00 a.m. – 12:00 p.m.
AEA Project Offices Conference Room
411 W 4th Avenue, Anchorage, AK
the upstream end of the reservoir inundation zone). It would be appropriate to fly breeding-pair
sampling transects in the easternmost portion of the study area because of the numerous
waterbodies that occur in the lowlands. An existing USFWS transect at the edge of the study
area has been surveyed annually each spring for about 50 years, so a long-term data set is
available for comparative data. The USFWS wants details on the waterbody surveys and
transect design to be specified in the study plan.
Waterbird Migration and Breeding Surveys
The PSP proposed weekly spring migration surveys starting on May 1, but USFWS expressed
concern that some birds could be missed in a year of early breakup and melt. The USFWS would
like the spring migration surveys to start earlier, by the last week of April. USFWS has reports
from migration studies that can provide insights on the timing of spring migration surveys.
Maureen stated that the study report should indicate that some peaks of waterbird migration
could be missed because of the proposed survey interval timing (7–10 days between surveys).
USFWS has concerns about the timing of breeding surveys. USFWS suggested that the surveys
be timed to match seasonal conditions and melting lake ice in each year, based on available
weather and breakup data. The USFWS is concerned because there are only two years to collect
data and they do not want to miss the onset of breeding in either year. Betsy said that the
results of river ice breakup surveys would be available to help determine survey timing.
Mike suggested that the distinction between spring migration and breeding surveys should be
dropped and the two periods should be combined, so that migration surveys would transition
into breeding surveys (late April to mid-June). The same survey method (complete waterbody
search in lake-to-lake pattern) would be used for both. He suggested that surveys occur every 5
days instead of every 7–10 days, as proposed in the PSP. The surveys would determine
abundance, which species are moving through the Project area, and which species remain in the
Project area to breed.
The group agreed to conduct aerial surveys for migrating birds and breeding birds every 5 days
from late April to mid-June. The survey timing for the breeding-pair transect surveys in the
eastern survey block would be determined based on the results of the lake-to-lake surveys.
The group agreed that a Robinson R-44 helicopter would be the best aerial survey platform to
use for migration and breeding-pair surveys.
Waterbird Productivity Surveys
The group agreed that brood surveys need not be conducted on foot surveys, but could be
conducted by helicopter instead.
Maureen said that the study plan should review the species list to ensure that the survey
methods are appropriate for all species because of differences in phenology and nesting habitat.
Meeting Summary: Waterbird Study Plans Page 3 of 4
Susitna-Watana Hydroelectric Project
October 4, 2012 10:00 a.m. – 12:00 p.m.
AEA Project Offices Conference Room
411 W 4th Avenue, Anchorage, AK
The group agreed that brood surveys should be conducted at least twice, with the possibility of
a third survey based on the results of the second survey. The surveys should start the second
week of July.
Harlequin Duck Survey Methods
The PSP proposed four stream surveys for Harlequin Ducks — two pre-nesting surveys in late
May–early June and two brood surveys in late July–early August. The group agreed that this
timing was acceptable.
The USFWS asked how the streams to be surveyed would be selected. Brian said that all of the
tributary streams flowing through the study area would be surveyed. Betsy mentioned that
video footage of all streams in the study area would be available from work done this year for
the aquatic resources program. The group agreed that review of those videos would be useful
to determine which streams to survey.
USFWS said that if Harlequin Ducks are seen in a stream, the entire stream should be surveyed,
not just that portion of the stream within the study-area buffer.
USFWS said that they want the study report to state that the survey would not be an exact
count of all Harlequin Ducks in the Project area, but would provide an index to numbers and
distribution.
Bird Migration Surveys
Maureen said that the USFWS is interested in actual migrating bird numbers to help understand
the level of migration through the Project area. The USFWS is interested in where birds might
be migrating through the Project area, so that transmission lines could be sited using the best
information. In addition, she said that USFWS is concerned about the risk of collision posed by
attraction of landbirds to lighting the Project facilities, including the dam.
Maureen said that later in the FERC licensing process, the AEA and the USFWS need to discuss
powerline design and placement based on existing information from the U.S. and elsewhere.
David suggested that the Project could look at topography and vegetation to assess whether and
where strike hazards might exist. He said that, by applying avian protection guidelines, the
Project should figure out which route(s) are most/least impactful to migrating birds. Betsy said
that other factors also will affect route selection for access road and power transmission lines.
Brian proposed a migration study near the dam site in 2013 to survey landbird and waterbird
migration through the Susitna River valley, using a combination of radar and visual survey
methods. Nocturnal monitoring would provide data on flight volume, distance, speed, direction,
and altitude. Visual surveys would be done during daylight to provide data on species
composition that would assist in interpreting the nocturnal radar monitoring results. The data
could be compared with other data from similar migration studies conducted in central and
Meeting Summary: Waterbird Study Plans Page 4 of 4
Susitna-Watana Hydroelectric Project
October 4, 2012 10:00 a.m. – 12:00 p.m.
AEA Project Offices Conference Room
411 W 4th Avenue, Anchorage, AK
southern Alaska (Tok, Gakona, Healy, Fire Island) to evaluate the magnitude of bird migration
through the Project area. Based on the 2013 results, it could be determined whether a second
year of monitoring is needed.
Maureen said that USFWS appreciated Brian’s proposal, but USFWS is not yet ready to
completely approve the migration study methods. Maureen said that they were much closer to
a workable plan, however.
Meeting Summary - DRAFT
Susitna–Watana Hydroelectric Project Licensing
Alaska Energy Authority Main Office
813 West Northern Lights Blvd., Anchorage, AK
Technical Workgroup Meeting on Terrestrial Resources
October 16, 2012, 8:30 a.m.-4:00 p.m.
Attendees:
Organization Name
ADF&G Wildlife Conservation Mark Burch
ADF&G Wildlife Conservation Louis Bender (by phone)
ADF&G Wildlife Conservation Joe Klein
Coalition for Susitna Dam Alternatives Becky Long (by phone)
Environ / Normandeau Sara Barnum (by phone)
Office of Project Management and Permitting (OPMP) Marie Steele
Natural Heritage Institute (NHI) Jan Konigsberg (by phone)
USFWS Bob Henszey (by phone)
FERC David Turner (by phone)
AEA Wayne Dyok
AEA Betsy McGregor
ABR, Inc. Terry Schick
ABR, Inc. Brian Lawhead
ABR, Inc. Alex Prichard (by phone)
ABR, Inc. Nathan Jones
ABR, Inc. Janet Kidd (by phone)
Cardno ENTRIX Lynn Noel (by phone)
MWH Kirby Gilbert
Solstice AK Jeff Randall
Van Ness Feldman Chuck Sensiba
Kirby Gilbert (MWH) facilitated introductions and gave an overview of the meeting objectives,
overall study plan schedule and updates on the Susitna-Watana Project engineering studies and
facilities plans. The objective of the meeting was described to provide an update on the status of
terrestrial resources revised study plans, focusing specifically on responses to comments received
(to date) on the July 14th study plans, and any outstanding or unresolved issues. The study plan
schedule was presented. Kirby noted that the Comment Response Tables are posted on the
Project Web site (http://www.susitna-watanahydro.org/meetings/).
AEA PSP and ILP Study Plan Process
The deadline for written comments to FERC on the Proposed Study Plan (PSP) is November 14,
2012. AEA has one month (December 14, 2012) after written comments on the PSP are received
to file the final RSP with FERC. Comments are due on the final RSP by January 18, 2013. FERC
Meeting Summary: Terrestrial Resources Workgroup Page 2 of 14
October 16, 2012 8:30 a.m. – 4:00 p.m.
will issue the Study Plan Determination by February 1, 2013. Revisions to the Revised Study
Plans (RSPs) are ongoing and will be posted to the Project website by the end of October 2012.
Jan Konigsberg (NHI) asked if the revised RSPs would be highlighted to show what has been
changed. Kirby explained the RSPs would not be red-lined because it would make the documents
too messy, but the Comment Response Tables have subsections for each study, and those could
be referenced to see what has changed in the RSPs based on the comments received.
Joe Klein (ADF&G) asked if AEA would hold meetings to address comments. He wanted to
know this to help with staff planning. Wayne Dyok (AEA) said one-on-one meetings may be
held as needed but no additional TWG meetings for terrestrial resources are planned prior to
filing the RSP in December.
Joe Klein said that in theory work could be done on the RSPs up until February 1, 2013. Wayne
said in theory that was true and some study plans such as instream flow may still need more
work and Wayne said that as issues are resolved AEA would let FERC know. David Turner
(FERC) said that in theory that was possible, but last-minute changes are not ideal.
Mark Burch (ADF&G) stated that some studies would have to begin in winter of 2013 for
practicality purposes, which means some studies would begin before they are approved. Wayne
said changes to the studies would have to be added as the studies move forward. Brian Lawhead
(AEA) said that furbearer work requires winter surveys and asked whether any study plan
disputes would hold up all of the studies. Wayne said AEA would likely move forward on
studies that are not disputed. David Turner said only the mandatory conditioning agencies can
dispute the study determination. He also noted that all other studies, not disputed should go
forward. If the studies are dependent upon one other, it becomes more complicated.
Jan asked if BLM lands were in the Project area. Kirby acknowledged there are state-selected
BLM lands within the Project area.
Project and Study Updates
Kirby went over a few updates to the Project. The 2012 geotechnical investigation led to a slight
shift in the location of the dam’s axis. The number of workers involved in the construction of the
Project is estimated to vary between 300 and 930. The railbelt utility load demand is being input
into operation models that can help understand both power and flow outputs from the Project.
The three corridors are being further refined and the new details will be presented in the RSP and
Terrestrial Study Plans but the same three corridors are still being evaluated.
Comment-Response Review for Wildlife Studies (Brian Lawhead, ABR)
Birds
USFWS had previously expressed the opinion that winter surveys were needed to confirm the
presence of small cavity-nesting owls, specifically Boreal Owl and Northern Hawk-Owl. Due to
difficulties and safety issues associated with nocturnal surveys in winter, however, the Project
will assume that these owls are present in suitable habitats in the study area, but specific surveys
Meeting Summary: Terrestrial Resources Workgroup Page 3 of 14
October 16, 2012 8:30 a.m. – 4:00 p.m.
will not be conducted because they would likely yield very little data for a substantial amount of
survey effort. No representatives from USFWS were present during the meeting, but it was stated
that this approach had been previously agreed to by USFWS at a meeting on September 6, 2012.
With regard to waterbirds, the intent is to include all of the approximately 65 waterbodies
sampled in the 1980s studies. The study area boundary, which is a 3-mile buffer around the
Project area, will be expanded as needed to include specific lakes that were surveyed in the
1980s. The PSP stated that the waterbird migration surveys would begin in early May, but the
plan has been revised to start the last week in April, based on comments from USFWS ad
ADF&G. Spring migration surveys will begin in late April 2013 and will transition directly into
the breeding surveys with no break between them. The survey interval will be five (5) days
rather than 7–10 days stated in the PSP. Wayne confirmed with Mark Burch that the timing of
the surveys was acceptable.
The majority of the waterbird study area is a high plateau, where waterbodies tend to be
clustered in groups, so a lake-to-lake survey pattern makes the most sense in those areas, as
suggested by ADF&G and agreed to by USFWS in a previous meeting. In a specifically
designated transect-survey block in the southeastern portion of the study area, southeast of the
Oshetna River-Susitna River confluence, however, the USFWS protocol for breeding-pair
transect surveys will be followed in early June because of the greater prevalence of waterbodies
in that lower, wetter area than elsewhere in the study area. USFWS has conducted breeding-pair
surveys along several transects in the general area of the eastern portion of the study area for
decades, which will provide good comparative data.
As requested by the USFWS, all streams in the study area that have suitable habitat for use by
breeding Harlequin Ducks will be surveyed during for pre-nesting and brood-rearing surveys by
helicopter.
Resolution is still needed on USFWS’s concern regarding the risk of bird collision with
transmission lines and nocturnal attraction of migrating landbirds to lighted Project structures. A
combination of visual monitoring during daylight hours and radar monitoring, both during the
day and at night, has been proposed to study the risk of collision with Project structures. Due to
the high cost of the radar study, the study is proposed to be conducted in the Susitna River
drainage near the site of the proposed dam (not in the mountains to the north). The Susitna River
drainage, especially with its east/west orientation in this area, is expected to be traversed by more
migrant birds than the mountainous areas. Mark was supportive of the radar/visual combination
sampling approach. David said that the reason for choosing to use radar survey over the river as
opposed to the neighboring mountainous areas should be clearly explained in the study plan.
Brian will follow up with USFWS to confirm whether they support this plan. The radar data will
not provide estimates of the number of birds, but will give the number and size of targets, the
speed at which they are flying, and flight altitudes, so the data can be used to infer which species
or groups of species are passing through the area. The numbers of birds passing through the area
(flock sizes) will be recorded from visual observations made during the day and at night using
night-vision goggles. Terry Schick (ABR) suggested that, since the radar survey will capture data
on all types of birds, the description of the study be presented only in one study plan and
Meeting Summary: Terrestrial Resources Workgroup Page 4 of 14
October 16, 2012 8:30 a.m. – 4:00 p.m.
referenced in others. Betsy McGregor and Brian agreed to this approach for documentation.
Brian suggested the radar/visual study be described in the waterbirds study plan.
AEA will employ the accepted best practices with regard to lighting of Project infrastructure
(e.g., red lights are better than white, and down-shielded lights are better). Wayne said the only
caveat would be where the safety of workers and aircraft is concerned and that OSHA and FAA
standards would have to be followed. Wayne also described that there were two phases to the
lighting concerns: construction and long-term operation; more lights will need to be used during
the construction phase.
For the landbird/shorebird study plan, there has been a lot of discussion regarding the specifics of
the point-count methods and analyses. The USFWS wants density estimates (e.g., to determine
how many breeding pairs are likely to occur in the inundation zone). The study plan has been
revised to note that density estimates will be derived from the point-count data. Both removal
and distance analyses will be employed, as suggested by the USFWS at a meeting on September
6, 2012.
Mark noted that it had been suggested to split the distance estimates for the bird observations
into bands and asked if that was being included in the plan. Terry confirmed that they will
categorize the observations into distance classes, but they have not yet defined those distance
classes in the study plan. More error in the distance estimates will be removed by using larger
classes or bands. Brian said that was a good point that had not been reflected in the meeting
notes, but that he would update them.
For the point-count observations, Mark noted that Dave Tessler (ADF&G) had emphasized that
he felt using a double-observer method was preferred. Betsy said the double-observer method
was discussed and it was decided not to be employed. Mark questioned if there were safety
concerns by sending out only a single observer. Betsy confirmed there would be two people
present during the surveys. Mark asked if both people in the team would be trained and it was
confirmed that they would. Kirby pointed out that only one of them would be recording data.
Terry stated, based on comments made by the USFWS, that the additional data from double-
observers was not believed to give much greater accuracy in detectability or density estimates
than data recorded by a single observer and that the extra data would require more analysis work.
Terry recalled that Dave Tessler, at the meeting on September 13, 2012, had been fine with a
single-observer approach when following Alaska Landbird Monitoring System (ALMS)
protocols and using removal and distance analyses to estimate densities. Mark said that data from
double observers would give an estimate of uncertainty, and he will confirm with Dave Tessler if
the single-observer approach is acceptable.
The USFWS is concerned about a subspecies of Rock Sandpiper found in the Cook Inlet in
winter and wanted to know if changes in flow would have effects on intertidal foraging habitats
at the mouth of the Susitna River. The USFWS wants to be sure that the physical effect on the
mudflat habitat is assessed. To make this assessment, data from the water resources and
geomorphology studies will be examined, including temperature, water quality, flow and
sedimentation rates.
Meeting Summary: Terrestrial Resources Workgroup Page 5 of 14
October 16, 2012 8:30 a.m. – 4:00 p.m.
At an earlier meeting, Maureen de Zeeuw (USFWS) expressed concern that point-count surveys
for breeding birds and habitat surveys for the wildlife habitat mapping study would be conducted
concurrently. It will be clarified in the plan that these surveys will be conducted separately.
In the point-count surveys, all bird species heard or seen will be recorded. The USFWS was
concerned about species that are present, but not detected. Species may not be detected if they
are non-singers or are found in riparian habitats where noise from running water may mask their
presence. Swallows and kingfishers are two types of birds mentioned in this regard. Another
study element has been added to the landbird/shorebird study plan to include surveys for swallow
breeding colonies along the Susitna River within the proposed inundation zone. The study plan
also now includes additional point-counts and walking surveys along streams (between point-
count sites) in the inundation zone to collect data on species that use riparian habitats.
A 2-mile survey buffer around the proposed Project components had been previously agreed
upon as the study area for the point-count surveys, and the study plan and map figure will be
updated to show this.
The USFWS agreed that additional point-count surveys outside of the Project area in places such
as Denali National Park and the Copper River Basin are not needed because existing detection
functions from previous studies can be used for the less common species (for which fewer data
are expected in the Project study area).
The landbird/shorebird studies will follow field protocols recommended by ALMS and the data
will be analyzed with removal and distance analyses to calculate densities. Based on comments
from the USFWS, the length of the point-count survey period has been doubled from 14 to 28
days. Point-count surveys will be conducted continuously from mid-May to mid-June.
Mist-netting had been suggested by USFWS in their original study request as a potential method
to study landbird and shorebird migrants in the inundation zone. This topic was not resolved at
the September 6, 2012 meeting, but ABR does not recommend mist-netting because it poses a
risk to the birds and requires intensive effort for relatively little information in return, when
compared with the radar/visual study proposed at a meeting on October 4, 2012; it is not an
appropriate method for a study area of this size. ABR’s recommendations will be discussed in
the proposed study plan. Final resolution has not been reached with the USFWS on the mist-
netting issue.
Brian will check with Sarah Bullock (BLM) to see if the response from ADF&G and UAF to her
comment regarding the proposed ptarmigan analyses addresses her concern.
Wood Frog
Wood frogs were discussed on September 13, 2012 meeting with Dave Tessler, who stated that a
major variable affecting the occurrence of wood frogs is the abundance of fish, because fish prey
on eggs, tadpoles, and adult frogs. Acknowledgment of this variable is being made in the revised
study plan. Fish occurrence data, if available, will be used as another variable to estimate the
likelihood of frogs occurring in waterbodies.
Meeting Summary: Terrestrial Resources Workgroup Page 6 of 14
October 16, 2012 8:30 a.m. – 4:00 p.m.
Some of the field study details for frogs were still unresolved. The problem faced with frog
detection is similar to the problem faced with the landbird/shorebird point-counts, in that frogs
may not be calling at the time of the surveys. This problem is more acute with frogs than birds,
however, because birds sing repeatedly and often during the peak of the breeding season. The
current frog study plan calls for two observers and two visits to sites at which frogs are not
detected on the first visit, to permit calculation of detectability and corrections to the observed
occupancy rate. If frogs are detected on the first visit, a repeat visit will not be needed because
these are occupancy surveys and occupancy will have been confirmed on the first visit.
Mark asked if ABR needed standardized protocols for surveying for frogs. Brian said he was
aware of a standardized USGS protocol for areas with road access, which involves acoustic
surveys at designated stops along a road route, but he needs to confer with Dave Tessler to see if
other standardized protocols may exist. Terry said he thought the USGS protocol was specific to
roaded areas and was similar to the Breeding Bird Survey (BBS) routes used for birds along
roads, and that those methods would not apply to this study since there are no existing roads.
Sampling for the chytrid (Bd) fungus will be done opportunistically during the wood frog
surveys when frogs are observed and can be caught. The details of the sampling protocols for
chytrid fungus need to be added to the plan and Meg Perdue (USFWS) will be consulted
regarding this. The goal will be to determine if the fungus is present currently in the frog
population in the Project area.
Moose
In response to Sarah Bullock’s (BLM) comment, the moose study will not attempt to validate the
1980s carrying-capacity model. The current plan calls for a more recently developed browse
removal method used by ADF&G. Sara accepted this approach in an earlier meeting.
ADF&G has decided to conduct a GeoSpatial Population Estimator (GSPE) survey within a
single year, as opposed to the two years stated in the PSP. This effort is currently planned for
November 2012, but if it is not conducted due to unfavorable weather conditions, it will be
conducted in 2013. By the time the RSP is finalized, it will be known whether the 2012 effort
was successful.
Caribou
In response to a question posed by Sarah Bullock (BLM) in an earlier meeting, a response in the
comment response table stated that the Nelchina caribou herd is known to cross in the proposed
reservoir inundation zone, but that the Delta herd is not expected to cross there because they
occur farther north. Mark stated that collars were being placed on caribou this week and those
are expected to provide empirical data to answer this question. He said what dictates which herd
an individual is assigned is where they calve, but that herds overlap at other points in time. Bulls
especially can be variable in their location. The language in the plan regarding the crossing of the
inundation zone by the two herds will be revised to state that this is not known conclusively.
Based on a comment submitted by ADF&G regarding their expected ability to estimate calf
survival, the plan has been revised to delete estimation of calf survival as an objective.
Meeting Summary: Terrestrial Resources Workgroup Page 7 of 14
October 16, 2012 8:30 a.m. – 4:00 p.m.
The frequency of relocations by radio-tracking flights has been changed from happening weekly
during the spring and fall to twice a month during the spring and fall, due to the length of time
required to track all collars, and once a month for all other months. The study plan will be
updated to show this change.
Dall’s Sheep
The study area defined in the plan was revised based on a suggestion from ADF&G to include all
suitable habitat in Game Management Unit 13E located east of the Parks Highway and south of
the Denali Highway.
ADF&G will conduct an aerial survey annually in late July or early August, after lambing but
before sheep hunting season opens.
Consideration had been given to potentially conducting genetic tests or radio-collaring sheep to
examine the degree of isolation of sheep north of the proposed inundation zone in the Watana
Creek Hills. At this time, this testing will not be added into the study plan; it is thought that
aerial surveys should provide enough information that genetic testing and telemetry are not
needed.
The study plan will be updated to reflect that ADF&G will conduct a single summer aerial
survey for Dall’s sheep each year. It was decided that there would be no value in conducting
camera monitoring of mineral licks or using telemetry.
* Lou Bender (ADF&G) and Alex Prichard (ABR, Inc.) joined the meeting via phone.
Large Carnivores
The study plan for large carnivores proposed using DNA and stable-isotope analyses from hair
samples to evaluate the minimum number and dietary composition of bears using salmon
spawning streams downstream from the proposed dam. Laverne Beier of ADF&G in Southeast
Alaska will be consulted about the feasibility of using hair traps that close after obtaining hair
from a single bear, as opposed to wire snags that will obtain samples from more than one bear.
The results of that consultation will be included in the RSP.
The study plan has been revised to include a recently developed method of analyzing existing
population data from line-transect surveys, which have been conducted in the region by ADF&G
twice since 2001, to derive spatial models of population density. Earl Becker of ADF&G will
work on this analysis with an expert, David Miller, from the University of Rhode Island. Text
describing this analysis has been added to the study plan and the estimated cost will be adjusted
accordingly.
Wolverine
The map figure in the PSP portrayed sampling blocks as being 25 square miles, but it should
have been 25 square kilometers (as was stated correctly in text). The plan and map have been
updated to show the correct area and to consolidate the shape of the study area, as suggested by
ADF&G in earlier meetings. The objective of obtaining habitat-use information was removed
from the study plan, as suggested by ADF&G, because a single survey would not be sufficient to
Meeting Summary: Terrestrial Resources Workgroup Page 8 of 14
October 16, 2012 8:30 a.m. – 4:00 p.m.
obtain this information. However, data on habitat associations can be derived from the
occupancy surveys proposed by ADF&G (see below), so that objective will be reinstated.
The wolverine survey needs to be conducted 12–36 hours after a fresh snowfall in February or
March. The logistics will need to be in place so the survey team can mobilize rapidly when the
conditions to conduct the survey are favorable. ADF&G is interested in conducting the survey
work with the expectation that a contractor could provide additional personnel if needed. Details
regarding the wolverine survey will be added to the RSP.
In addition to using a Sample-Unit Probability Estimator (SUPE) survey, ADF&G also proposed
conducting a less-intensive survey for use in occupancy modeling. At the end of the meeting,
Wayne announced that AEA had decided to use both survey approaches, as suggested by
ADF&G, so the study plan will be revised accordingly.
* Lou and Alex left the call after the portion on Occupancy Modeling was discussed.
Terrestrial Furbearers
The terrestrial furbearer study has been developed by Laura Prugh at the University of Alaska
Fairbanks and generally approved by ADF&G, with some minor suggestions for improvement.
Spatially explicit capture/recapture (SECR) methods for population estimation have been
incorporated into the study plan, as recommended by ADF&G.
Aquatic Furbearers
The USFWS is concerned the risk of post-construction bioaccumulation of mercury in
piscivorous (fish-eating) wildlife, including river otter and mink. ADF&G agrees that mercury
bioaccumulation is a concern. The study plan describes a proposed literature review of the food
habits of mink and river otters to gain insight for the mercury risk assessment study, and to
obtain hair samples for mercury analysis.
Winter tracking surveys by helicopter are proposed to obtain information on the presence and
relative abundance of these two species. The track surveys would estimate the minimum number
of otters and the plan was revised to deemphasize mink as a focal species. Efforts to record mink
tracks will be made during winter track surveys of otters. Mark said he thought the mink survey
should be more than casual observation and would like to revisit the matter after Brian consults
further with Merav Ben-David at the University of Wyoming regarding potential survey
methods.
The details of hair sampling are still unresolved, but sampling fur from individuals harvested by
trappers is a potential way to get samples, as is field deployment of hair-snag stations. The
difficulty is that the small number of trappers would result in a small sample size, and that the
low population density of these animals will reduce the probability of obtaining hair-snag
samples.
* David Turner left the call at this point.
Meeting Summary: Terrestrial Resources Workgroup Page 9 of 14
October 16, 2012 8:30 a.m. – 4:00 p.m.
Beaver surveys will be conducted in the fall when leaves have fallen by looking for food caches
and lodge locations. Data from the instream flow study will be needed to draw conclusions about
the potential Project effects on habitats used by beavers and other aquatic furbearers in the area
downstream from the proposed dam.
* Broke for lunch, 12:05–1:00 pm.
Habitat Evaluation
The wildlife habitat evaluation study has been revised to include a preliminary list of bird species
of conservation and management concern for the Project area, in keeping with the FERC–
USFWS MOU regarding migratory birds.
The study plan has been updated to note that, in the study report, more information will be
presented on how the rankings of habitat value were determined for each species. Individual
species-account sections of the study report will be prepared to help the reader understand how
habitats were ranked as being of high, moderate, or low value.
Per recommendations from ADF&G, the study plan also has been updated to note that a
“crosswalk” between the fine-scale habitats mapped in the Project area and the coarser scale
habitats mapped by the Alaska Gap Analysis Project (GAP) will be prepared. The habitat-value
rankings for birds and mammals in the Project area also will be crosswalked to the coarser scale
GAP habitats.
Wildlife Harvest Analysis
No comments have been submitted to date.
Little Brown Bat
Anabat ultrasonic detectors will be placed in the infrastructure and reservoir area to detect flying
bats, and searches will be conducted in an attempt to locate roost sites and hibernacula. These
detectors will not be placed in the access and transmission corridors.
The study plan has been revised to include seasonal adjustments in acoustic sampling periods to
account for changes in night length.
Kirby confirmed with Mark that ADF&G was in agreement with the sampling plan for bats.
Small Mammals
No comments have been submitted to date.
Extensive field sampling was done in the area in the 1980s. One new species, the Alaska tiny
shrew, has been described since then and the first specimen actually was taken in the study area.
Since it was described, the species has been trapped throughout the state, so it is widely
distributed, but does not appear to be abundant anywhere it occurs. Pitfall trapping is the
preferred method of sampling for small mammals, but it is almost always fatal to the animal and
Brian said he is not sure if the data to be collected in a new field effort will provide much new
information beyond the present knowledge obtained from the 1980s study and other regional
Meeting Summary: Terrestrial Resources Workgroup Page 10 of 14
October 16, 2012 8:30 a.m. – 4:00 p.m.
information. There is also not much that can be done to mitigate the effects of habitat lost once
the reservoir is inundated. For these reasons, Brian suggested that the small mammal study could
be changed to a “desktop” analysis, rather than undertaking field sampling that is likely to
confirm the results of the original study in the 1980s. Mark will inquire at ADF&G whether a
desktop study would be sufficient and Brian will confer with the USFWS and BLM to ask if a
desktop study is acceptable to them. Wayne stated that FERC has accepted desktop studies in the
past for other issues and it did not come up as an issue in the scoping document. Marie Steele
(OPMP) asked if mortality from pitfall surveys was really an issue as flooding the habitat will
kill them anyway. She said since the existing data was 30 years old there may be some climate
change effect that would not show up in a desktop study. Brian replied that climate change
effects would most likely be expressed in terms of habitat changes, which will be revealed by the
vegetation and habitat mapping study. Kirby advised that agencies be consulted on their
thoughts.
Terry said that, for all species of concern, habitat-loss and habitat-alteration assessments can be
done in the inundation zone and infrastructure areas, and habitat-alteration assessments can be
done in areas downstream of the proposed dam, using the results of the wildlife habitat mapping
study.
Comment-Response Review for Botanical Studies (Terry Schick, ABR)
* This portion of the meeting began earlier than scheduled, around 1:40 p.m. Bob Henszey and
Janet Kidd called in to join the meeting around 2:30 p.m., which was the scheduled time on the
agenda.
Vegetation and Wildlife Habitat Mapping Study
For the vegetation and wildlife habitat mapping study area, originally a 5-mile buffer was
proposed on each side of the Project footprint. This has since been reduced to a 4-mile buffer
study area, which is still double the area of the buffer being used in the landbird/shorebird and
wetland mapping studies.
In an earlier meeting, Bob Henszey (USFWS) had suggested a comparative analysis between the
1980s vegetation mapping data and current conditions. The Alaska Vegetation Classification
(AVC) system used in the 1980s has changed slightly from the final version (Viereck et al.
1992), but more importantly, a historical/current vegetation comparison will not help with the
primary focus of the study, which is to assess impacts from the currently proposed Project on
vegetation and wildlife habitats. Bob would like the data from the 1980s in case such a
comparison is needed in the future. Terry said that they do not have the aerial photography from
the 1980s, but they do have the GIS polygons for the 1980s mapping. Without the photography
used in the 1980s, however, they will not know if real changes have occurred or if the area was
just not well-delineated in the 1980s. Wayne is going to check Juneau to see if the aerial
photography is among the archives in Juneau. Terry said the comparative study would be
interesting, but that it would be time-consuming and could not be started until the current
mapping was complete, which is not expected until late in 2014. Terry indicated there are other
studies that should take precedence given the short timeline for this project. Wayne clarified that
Meeting Summary: Terrestrial Resources Workgroup Page 11 of 14
October 16, 2012 8:30 a.m. – 4:00 p.m.
he was not suggesting the comparative study be done, but he just wants to pull the information
together in case, down the road, if ever needed to be done. Bob agreed that was reasonable.
Concern was expressed over the classification system proposed for wildlife habitat mapping, and
Kessel’s (1979) bird habitat classification system for Alaska was proposed by the USFWS. One
primary difference between Kessel’s classification and the AVC (Level IV), which would be
used as the vegetation data for the Project habitat map, is in the definition of shrub types: Kessel
uses four classes (dwarf, low, medium, and tall) and the AVC uses three (dwarf, low, and tall).
Unfortunately, it is not possible to accurately map shrub habitats from aerial imagery using
Kessel’s system because the distinction between medium shrub types and low and tall types will
be difficult to map consistently. Kessel’s system will work fine for mapping small survey plots
on the ground, but it will result in lots of errors when attempting such a detailed shrub-height
discrimination from the interpretation of aerial imagery. Additionally, recent survey data in
Alaska indicate that the differences in use of low, medium, and tall shrubs by landbirds are not as
nice and clean as Kessel’s paper indicates. A crosswalk between Kessel’s habitat types the AVC
Level IV vegetation types that are likely to occur in the Project area will be prepared so that
ABR can discuss the proposed habitat classification approach for the Project and make sure it
addresses the concerns from the USFWS. The habitat classification approach does not rely solely
on Level IV vegetation data from the AVC, but will include data on physiography, surface
forms, disturbance level, and soil moisture regimes, as needed. The study will produce a wildlife
habitat map, not a vegetation map. Wayne confirmed with Mark that ADF&G was okay with this
approach. Terry will follow up with Maureen.
Riparian Vegetation Mapping Study
The lateral boundary for the riparian vegetation study needs to be determined. Originally, it was
proposed that the 100-year floodplain limit be used, but there had been concern from the
agencies over how this flood limit would be determined. In the RSP, it is noted that riverine
physiography will be mapped and used to determine the limits of the active floodplain of the
Susitna River downstream of the proposed dam. This then will be proposed to serve as the study
area for the riparian vegetation study. The mapping of riverine physiography will be done before
the study area boundary is described in the RSP. Once the riverine physiography mapping has
been done, the proposed boundary will go out to the agencies for comments. The timeframe is
short on this. The mapping is in progress now and is expected to be completed in late
October/early November 2012, and to be ready for agency review by mid or late November.
The downstream boundary for the riparian vegetation study area will be determined to be that
point at which the effects of the altered flow regimes in the Susitna River are no longer
considered significant. At some point downstream the altered flow regimes will not be
substantial because their effects will be overridden by the flow inputs from other streams and/or
the effects of tides from the Cook Inlet. This information will come from the modeling of stream
flow to be done in the 2012 instream flow study. Wayne said we need to define the
characteristics of what is considered “significant.” Jan said the changes in flow regime may have
a different effect in winter versus summer. Wayne said a freeze-up flow assessment is being
conducted. He said that some years have high flows naturally, and that those flows likely will be
tempered substantially with development of the Project. Robin Beebee (HDR) can speak to this
Meeting Summary: Terrestrial Resources Workgroup Page 12 of 14
October 16, 2012 8:30 a.m. – 4:00 p.m.
more next week. Terry said effects on riparian vegetation succession may be driven largely by
high summer flows. Wayne said springtime flows also can have substantial effects with large ice
pack jams that build up high backwater. Under a post-project scenario, these large ice effects
may be less common, but the ice processes study will address this.
Wetland Mapping
Wetland functions will be determined for all mapped wetlands in the study area.
Based on comments received, a spatially explicit wetland function component will be included to
show which waterbodies provide a fish habitat function. This will be accomplished using fish
occurrence data from the Project fish distribution and abundance studies.
The consumptive use function will be evaluated, if possible, with data from the recreation and
subsistence studies. Specific wetland polygons will be attributed, where possible, to identify
those specific wetlands that may be used currently for recreation and subsistence activities.
Similarly, wetlands adjacent to proposed roads and corridors that could potentially be used for
consumptive purposes will be attributed accordingly. Mark asked if any observations will be
made to see what people may be currently using in these areas. Kirby explained that no surveys
will be conducted to look for recreational or subsistence activities, but surveys will be conducted
to document areas known to be used, and the current uses documented in the area could give
insights into potential human activities following development of the Project. There was
discussion that there may be some consumptive use activities that may not be uncovered through
this process. Terry will revise the wetland study plan to indicate that fine-scale information on
consumptive uses for wetlands likely will not be available, but that the wetland functional
analysis will strive to indicate which wetlands are currently being used and which wetlands could
potentially be used in the future (within the limits of the data obtained from the recreation and
subsistence studies).
Wetlands will be categorized as being associated with permafrost or not. The functional
capacities of permafrost and non-permafrost wetlands will be addressed directly in the
classification of wetland types.
Interdependency Charts
New flow charts showing interdependency inputs and outputs between various Project studies
are being created, but are not yet posted to the website for terrestrial resources.
Terry showed the preliminary study interdependency flow chart for the wetland mapping study.
Some of the additional inputs needed on the wetland mapping study chart include upwelling and
spring data from the groundwater study as well as consumptive use data from the subsistence and
recreation studies (which was recognized by the group as possibly not being available at the
needed spatial scale). Brian pointed out that the wildlife occurrence information needed to be
added to this interdependency chart as well.
Bob suggested revising the title of the wetland mapping study or adding a supporting sentence to
the study interdependency chart to indicate that the wetland mapping required by the US Army
Meeting Summary: Terrestrial Resources Workgroup Page 13 of 14
October 16, 2012 8:30 a.m. – 4:00 p.m.
Corps of Engineers is specific to the inundation/infrastructure zone and the transmission
line/access road corridors (in the upper and middle Susitna basin). This is because there is
another flow chart, for the riparian study, which illustrates study interdependencies for the
wetland mapping that will occur downstream of the proposed dam. Kirby and Terry accepted this
idea.
The invasive plant study interdependency chart was reviewed. Janet said that, in that study,
common use trails in and near the Project area would be surveyed for invasive plants, and that
data on invasive plants from sites surveyed along the Parks Highway was available from the
Alaska Natural Heritage Program.
For the riparian study interdependency chart, the graphic showed the inputs needed by that study
were ice processes data in the Susitna River, fluvial geomorphology data, and riparian instream
flow data. Bob pointed out that groundwater flow data would also be helpful to have.
Wayne said to keep in mind that the charts were iterative. Kirby said he hoped the charts made
sense to everyone as they will be used a lot. The group recapped action items and closed the
meeting.
Action Items:
Wildlife
Determine the minimum size of waterbodies to be surveyed for waterbirds.
Clarify that the waterbird “eastern block” transect area is a separate survey block.
Confirm with USFWS whether the proposed bird migration study, using a combination of
radar and visual survey methods in the river corridor near the dam site, addresses their
concerns.
Include language as to why the river corridor, as opposed to the upland terrain, was
chosen for the radar/visual bird migration study.
Mark Burch to verify with David Tessler that having only a single observer record data is
acceptable for the landbird/shorebird point-count surveys.
Check with Sarah Bullock to see if her concerns regarding the ptarmigan study have been
addressed.
Distribute past meeting notes to ensure important issues were raised, keeping in mind that
meeting notes should be substantive and content-focused.
Determine with David Tessler if there is a standardized USGS protocol for frog
occupancy surveys that would be applicable to the Project area.
Obtain more details from Meg Perdue on the methods for sampling and analyzing the
chytrid fungus in wood frogs.
Revise the caribou study plan to clarify that it is not known conclusively whether the
Delta herd migrates through the proposed inundation zone.
Update the caribou plan to show the spring and fall capture frequencies have been
changed to twice a month during those migration periods, as opposed to once a week.
Update the Dall’s sheep study plan to clarify that time-lapse camera monitoring of
mineral licks and telemetry studies will not be included.
Meeting Summary: Terrestrial Resources Workgroup Page 14 of 14
October 16, 2012 8:30 a.m. – 4:00 p.m.
Follow up with Laverne Beier on the feasibility of hair traps as opposed to hair snags for
obtaining samples of bear hair.
Update the large carnivore plan to include information on the spatial density modeling by
ADF&G, working with the University of Rhode Island.
Update the wolverine plan to include sampling 12–36 hours after snowfall in February
and March.
Update the wolverine plan to state that ADF&G is interested in conducting the survey
with the expectation that contractors can provide additional personnel if needed.
Update the wolverine plan to show that occupancy modeling and a SUPE survey method
will both be used.
Consult with Dr. Merav Ben-David regarding survey methods for mink.
Confirm with the agencies that a “desktop” study for small mammals will be sufficient.
Botanical
Discuss with USFWS the crosswalk between the Viereck et al. (1992) AVC Level-IV
vegetation types and Kessel’s (1979) habitat types, along with a likely set of habitats to
be mapped in the Project area, and make sure that concerns regarding the classification of
wildlife habitat types will be addressed in the vegetation and wildlife habitat mapping
study.
Finish the mapping of riverine physiography downstream of the proposed dam to help
with defining the lateral boundary of the study area for the riparian study, and distribute
to the agencies for review.
Reconfigure the language for the consumptive use function in the wetland mapping study
RSP to describe the sources and types of information available.
Wayne to check with Juneau to see if aerial photography from the 1980s vegetation
mapping study is available in the event that a comparative vegetation study needs to be
done in the future.
Include the wildlife occurrence data as an input on the wetland functional assessment
interdependency chart.
Include groundwater flow data as an input on the riparian study interdependency chart.
Revise the titles of the wetland mapping study and riparian study to avoid the confusion
between the wetlands mapping that will be conducted in each study.
Version November 2, 2012 Page 1
Meeting Summary- Draft
Susitna-Watana Hydroelectric Project Licensing
Alaska Energy Authority Main Office
813 West Northern Lights Blvd, Anchorage, AK
Recreation and Social Sciences Technical Workgroup Meeting
October 17, 2012, 8:30 am – 4:00 pm
Attendees:
Organization Name
ADF&G Joe Giefer
ADNR-DMLW Wendy Steinberger*
ADNR Marie Steele
AEA Justin Crowther
AEA Wayne Dyok
AEA Betsy McGregor
Ahtna Bruce Cain
CIRI Dara Glass
Charles M. Mobley & Associates Chuck Mobley
Coalition for Susitna Dam Alternatives Becky Long*
DOWL HKM Maryellen Tuttell
FERC David Turner*
HDR Tracie Krauthoefer
Louis Berger Group Lisa McDonald*
McDowell Group Donna Logan
MWH Sarah Callaway
MWH Kirby Gilbert
National Heritage Institute/ HRI Jan Konigsberg*
Newfields Gary Krieger
Newfields Kathe Boucha
NLUR Justin Hays*
Northern Economics Pat Burden
Northern Economics Don Schug*
Northern Economics Jonathan King
NPS Cassie Thomas
NPS Harry Williamson*
SHPO Richard Vanderhoek
URS Patti Kroen*
URS Bridget Easley
URS John Gangemi*
URS Louise Kling*
URS Tim Kramer
URS Amy Rosenthal*
Van Ness Feldman Chuck Sensiba
Meeting Summary: Social Sciences TWG
October 17, 2012 8:30 a.m. – 4:00 p.m.
Version November 2, 2012 Page 2
Organization Name
URS Taylor Brelsford
*By telephone
Introduction and Meeting Overview
Kirby Gilbert (MWH) facilitated introductions and gave an overview of the meeting objectives,
overall study plan schedule and updates on the Susitna-Watana Project engineering studies and
facilities plans. The objective of the meeting was described to be a meeting to update parties on
the status of social sciences revised study plans, focusing specifically on responses to comments
received (to date) on the July 14th study plans, and any outstanding, or unresolved issues. The
overall Integrated Licensing Process (ILP) study plan schedule was presented.
Kirby described how the revised study plans (RSP) are going to include interdisciplinary
interdependency charts, to graphically depict how outputs from some studies are necessary
inputs for others.
Cassie Thomas (NPS) expressed a general frustration with AEA and consultants mentioning
dates for having documents available for review, but then not always having them available as
hoped. Regarding the upcoming revised study plan, Cassie noted she would need the draft RSP
by 10/25/2012, so she could use it to prepare her comments on behalf of the NPS, due to her
travel schedule.
Transportation, Air Quality and Health Impact Assessment (HIA)
Maryellen Tuttell (DOWL HKM) presented an update to the transportation study plans. Few
comments have been received to date, but those the study team have received to date focused on:
1) how to document existing river use for transportation, and 2) how to get useful information
from local landowners or others in the area knowledgeable about local transportation use. Those
considerations are addressed in the revised study plan. Some of the information that will be used
in the transportation analysis will come from the other studies (e.g. recreation).
No comments were received on the air quality study to date, but the study team has reached out
to EPA and ADEC staff, who indicated they would take a look at the PSP to see if they had any
comments.
Gary Krieger (Newfields) presented the status of the HIA study plan. He described how the
health-related data comes largely from the other technical studies, to avoid duplication and
maximize efficiency in data collection. There are some health-related questions integrated into
the subsistence study surveys. Field data gathering for the HIA, specifically, is typically
minimal. The Social Goods and Services study can perhaps help with demographic information
such information about consumer-durable assets in by household, as these kinds of statistics can
be predictive of wealth quintiles; which, in turn, are related to health. Gary described that there is
often a time lag between regulatory standards and the “science of today.” But standards are
standards, and that is what is used in the HIA analyses. From a health perspective, particulates
(PM2.5 particularly) are a focus.
Meeting Summary: Social Sciences TWG
October 17, 2012 8:30 a.m. – 4:00 p.m.
Version November 2, 2012 Page 3
Regional Economics and Socioeconomics Studies
Pat Burden (Northern Economics) – Pat went over the major comments received to date as
outlined in the posted comment response table. Pat noted that the NPS has requested a full
accounting of Project-related impacts on the social environment. Some effects are not
quantifiable, and limited to qualitative discussion, and thus will rely heavily on surveys.
Additionally, in response to a comment that noted there are some potentially, directly affected
residents along the Alaska Railroad north of Chase, a “railroad community” has been added to
the study area to try and characterize this community of people and possible effect mechanisms
resulting from development of the Project.
Pat also noted that there were a few comments on survey methodologies and reviews. The study
team has prepared draft protocols for the executive interview surveys which will be conducted,
and the team with AEA still needs to decide about other surveys and if a Random utility model
(RUM) will be used.
Lisa McDonald (Louis Berger Group) asked for definition of “knowledgeable person” to be
included, and also explanation of how the organizations/persons will be selected for interviews.
Pat noted that the list of persons and basic criteria will be in the Revised Study Plans.
Bruce Kane (Ahtna) asked if the studies assume there will be an intertie transmission line
between the Susitna-Watana Project and the Copper Basin. If not, it could be an important
consideration to evaluate. Bruce noted that power costs are three to five times higher in the
Copper Basin than elsewhere in the Railbelt. Wayne Dyok (AEA) stated that the feasibility and
cost of the intertie is being investigated as an independent effort within AEA; but at this time
such an intertie transmission line is not part of the Susitna-Watana Project. Wayne suggested a
follow-up meeting between Ahtna and Sara Fisher-Goad of AEA.
Pat noted that the effects of an intertie could be discussed in the cumulative effects analysis
within the license application and FERC NEPA analysis. But right now, the population of the
Copper River valley is not part of the socioeconomics study area. Study areas are those which
will receive the power benefit of the Project (i.e. the Railbelt).
Wayne Dyok (AEA) noted that the RUM model is very costly, and data intensive. He went on to
say that AEA is currently looking at how the information that might come out of the model
would be used in decision making. Wayne discussed that AEA wants relevant information
related to understanding the baseline but is interested in the type of information that really helps
understand potential Project impacts and is most usefulness in decision making. AEA is
determining what level of analysis is appropriate and has not made a final decision on the use of
the RUM model at this time, and it will not be reconciled by the time the draft Revised Study
Plans are posted next week. It will be reconciled by the 12/14/2012 deadline for filing the RSP.
Cassie Thomas (NPS) asked how the power- and non-power uses of the river will be balanced
without fully understanding its economic value. David Turner (FERC) replied that putting an
economic value on resources (like a dollar of energy equals x amount of fish habitat) is difficult
and so the analysis may need to be more qualitative in some instances.
Meeting Summary: Social Sciences TWG
October 17, 2012 8:30 a.m. – 4:00 p.m.
Version November 2, 2012 Page 4
Lisa McDonald (Louis Berger Group) stated that the RUM may not be the only option; at this
point it is difficult to judge whether the RUM is the appropriate path. Jonathan King (NEI) stated
that the RUM model is very data intensive. It requires an understanding of where people are
going and why, and over a period of time. It is also important to understand where they fit into
the broader, regional picture of recreation for the whole population. The RUM is powerful
because it incorporates data that is collected from the individuals using the area, while they’re
using it, over a period of time. Also the RUM output helps to understand how distance, site
attributes, trip experiences all fit together, and the tradeoffs that individuals are making
compared to recreational site choices. The RUM can give a “picture” of recreation in the study
area in the context of the broader choice of recreational opportunities and choices, beyond the
Railbelt. The RUM can also help inform choices on Project road corridors based on recreation
attributes, not just how the different alternatives might affect users.
Subsistence Study
Tracie Krauthoefer (HDR) presented information on updates to the subsistence study plan. She
noted that not many comments have been received to date. As with other social sciences studies
they were asked by FERC in previous meetings to include survey instruments, so those have
been added. The other comments that the study team has noted are in regards to traditional
knowledge (TK) interviews and how that information could be integrated into the HIA. Bruce
Cain (Ahtna) stated that it will be important to have elders in the TK interviews. Tracie noted
that the interviewees are selected by the community working with the study team.
Tracie reviewed the subsistence study schedule, which begins in January 2013. She noted for
Bruce that household surveys for Copper River communities will be conducted in the first
quarter of 2014 but TK interviews will actually occur in first quarter of 2013. The 10-year
mapping studies will be conducted in first quarter of 2014.
Recreation, River Flow, and Aesthetic Studies
Bridget Easley (URS) provided an update on the status of the recreation and aesthetic studies.
She noted that over 100 comments were received. She summarized some of the main comments
as follows:
There were comments about the need to identify interdependencies with other disciplines
and timing of results so they can be used by other disciplines
Comments regarding the timing of surveys and study implementation with respect to the
desire for participants review and input during the study process. Bridget noted that the
draft RSP now makes note of how the study team expects the technical workgroup
meetings to continue and plan to meet quarterly to get input and reviews of study
progress.
There were comments about the study areas along with recommendations for adjustments
that have been mostly incorporated into the updated study plan.
There were comments about the survey methodology and survey instruments. Bridget
noted the survey is planned to consist of 10,000 mail out surveys to Alaska residents and
coupled with the intercept survey program and executive interviews
Meeting Summary: Social Sciences TWG
October 17, 2012 8:30 a.m. – 4:00 p.m.
Version November 2, 2012 Page 5
o Dara Glass (CIRI) inquired about who the surveys would be sent to. She noted
that as a majority landowner, CIRI is very concerned about who will be included
in the survey, as well as potential trespass issues. Donna Logan (McDowell
Group) stated that the (mail) survey will include a random sample from voter
registration lists. For the intercept survey, there are several locations (e.g. Parks
Highway, Denali Highway, Talkeetna). These are directly targeting area users
across all seasons, so it could be Alaska residents or visitors.
o Cassie Thomas (NPS) noted that if the Project moves forward, it is assumed that
there will be a recreation management plan and that could be a means to help
manage trespassing issues (using the information gathered from the surveys).
There were questions about how the study team will select key observation points and
soundscapes in the Aesthetics study.
There were also some comments related to making sure the studies addressed the quality
of experience in addition to the quantitative information being gathered with respect to
recreation uses.
Bridget noted that the revised study plan includes a draft boating survey. John Gangemi (Oasis)
stated that the October 3rd, 2012 meeting resulted in a revised survey instrument that includes
recreation reaches 1, 2 and 3. The draft survey is currently a bit little lengthy and may be revised.
He noted this is not intended to be a random survey because the user group is so small, it will
need to be “pushed onto” as many users as possible based upon word of mouth and networking.
Cultural Resource Study
Chuck Mobley (Charles M. Mobley & Associates) provided an update to the cultural resources
study plan. He noted the comments and revisions mostly centered on the definitions/extent of the
preliminary direct and indirect areas of potential effect (Direct and Indirect APE).
Chuck noted after many meetings and much collaboration the Direct APE is focused on what it
proposed as the Project “footprint” including the impoundment area up to elevation 2,075 feet. It
also is to include the Watana Dam construction site as well as the Chulitna, Denali and Gold
Creek access/transmission corridors.
Chuck described the Indirect APE as the area just outside of direct APE in areas that may
experience Project-induced recreational or other increased human activity, such as: existing
trails, ATV trails and popular hunting areas as well as areas determined to be of high cultural
resource potential that are near the trails, recreational areas, or areas near or related to known
cultural sites.
The basic premise for defining the indirect APE is that areas that have seen historical use are
more likely to see future use possibly increase with the Project in place and areas of higher
cultural site density can be more easily impacted than areas with lower cultural site density.
Chuck presented revised maps. Wayne Dyok (AEA) recommended that 1980s mass wasting data
be utilized to help identify locations around the reservoir susceptible to disturbance.
Meeting Summary: Social Sciences TWG
October 17, 2012 8:30 a.m. – 4:00 p.m.
Version November 2, 2012 Page 6
Regarding study interdependencies, Chuck stated that a lot of data will be collected in the
cultural resource studies, but not a lot of it will be “distributed” to other study areas. Most of the
other studies do not need the detailed cultural resources information, and much of the
information collected will be restricted from distribution.
Bruce Kane (Ahtna) stated that Ahtna’s elders could be valuable in implementing this study plan,
as they have lived an annual migratory lifestyle. He noted that it may save some work on radio
collaring wildlife by gathering anecdotal information directly from native elders who know
wildlife migration patterns. This could also help narrow down locations, or potential locations,
for cultural sites. Dara Glass (CIRI) stated that CIRI elders have this type of valuable
information as well. It was noted that this information would also be used for the wildlife and
subsistence studies. Tracie Krauthoefer (HDR) noted that elders would likely be interviewed in
the TK interviews associated with the subsistence study plan.
Action Items
Air quality – add modeled emissions to interdependencies chart
Update the river boating survey instrument to reduce length
Regional Economics & Socioeconomics
o Revise draft survey instruments
o Pat Burden (Northern Economics) – define knowledgeable persons criteria
o Determine if the RUM or benefit transfer method will be included in the RSP.
Fix a small edit need on the Cultural resources comment response table where
“ANILCA” should be “ANCSA”.
Version November 5, 2012 Page 1
DRAFT Meeting Summary
Geomorphology, Fluvial Geomorphology, Ice Processes, Water Quality,
Mercury Bio Accumulation, Geology/Soils
Technical Workgroup Meeting
23 October 2012
LOCATION: Alaska Energy Authority Main Office
813 West Northern Lights BLVD
Anchorage, AK 99503
TIME: 8:30am – 4pm (AKDT)
SUBJECT: Water Resources Studies & Geology and Soils Study Plan Updates
ATTENDEES: Rob Plotnikoff Tetra Tech, Harry Gibbons Tetra Tech, Paul Dworian URS, Felix
Kristanovich ENVIRON, Charlie Wisdom ENVIRON, Roy Ireland DNR, Kathryn Toews
Long View Associates, Dave Meyer USGS, Mike Buntjer USFWS, Bill Fullerton Tetra
Tech, Marie Steele DNR, William Ashton DEC, Tim Bailey Stephan Lake Lodge, Brian
Bjorkguist AGO, Jan Konigsberg Hydropower Reform Coalition, Michael Lilly GWS,
Dave Brailey Brailey Hydro, Dudley Reiser R2, Robin Beebee HDR, Laura Noland
ENVIRON, Eric Marchegioni USDA, Bryan Carey AEA, Catherine Berg USFWS, Justin
Crowther AEA, Matt Love VNF, Betsy McGregor AEA, Keith Fetherston R2, Brian
Carey AEA
ON PHONE: Richard Leo Coalition for Susitna Alternatives, David Turner FERC, Stormy Haught
ADF&G, Bob Mussetter Tetra Tech, John Haapala MWH, Fred Winchell Louis
Berger, Ken ? Louis Berger, Dirk Peterson Stillwater, Jay Stallman Stillwater, Paul
Makowski FERC, Eric Rothwell NMFS, Gary Vandervine NHC, Wayne Dyok AEA,
Becky Long Coalition for Susitna Alternatives, Sue Walker NMFS, Steve Padula Long
View Associates, Hal Shepard CWA
AEA PSP and ILP Study Plan Process (Matt Love, VNF)
The purpose of today’s meeting was to provide an overview of to-date revisions made to select PSPs.
Matt Love reviewed the RSP schedule, Project updates and today’s purpose as explained in the
“Overview of AEA Draft Revised Study Plans” presentation (available at http://www.susitna-
watanahydro.org/wp-content/uploads/2012/10/AEA_overview_revised_study_plans_Geo.pdf). He
informed everyone that a spreadsheet of the status of each study plan is available on the AEA website
(http://www.susitna-watanahydro.org/wp-content/uploads/2012/10/Study-Table.pdf). This sheet
informs the reader whether a draft RSP is available for review or changes to the PSP have not been
significant based on comments received to date and thus only the original PSP is available. Live links to
these documents are imbedded in the spreadsheet. Within each draft RSP is an updated schedule, a
figure showing interdependencies amongst studies and a consultation table showing comments to-date
along with AEA’s responses.
Ice Processes in the Susitna River Study (Robin Beebee and Bob Butera, HDR)
Robin Beebee began her presentation discussing changes made to the Ice Processes PSP. The
presentation can be found at http://www.susitna-watanahydro.org/wp-
Version November 5, 2012 Page 2
content/uploads/2012/10/Susitna-Watana-TWG1023-Ice-1.pdf. Robin reviewed three comments and
the responses associated with them in subsequent slides. In response to a question, Robin indicated
that the ice processes modeling results would not be available in 2013 and therefore would not be
incorporated into the Focus Area site selections. When discussing study deliverables (slides 5-7) Robin
explained that data from the 1980s and the data from the Ice Study will be compared to capture any
differences in observed ice processes. She presented a sample diagram of ice cover and photographs
from the Susitna River showing recent frazil ice formations. An interdependency diagram was provided
on slide 10 showing the data required from other studies to complete deliverables for the Ice Study. It
also lays out which other studies employ particular deliverables of the Ice Study. An input to be added to
the diagram is the Water Quality Study providing modeled outflow temperatures from the reservoir.
The Ice Study presentation was followed by questions from the licensing participants:
Gary Vandervine asked if there was enough data to develop reliable 1-D modeling after one season
of data. Robin Beebee said that data from the 1980s may be incorporated to add years for
parameters such as temperature, meteorological data and ice cover. Break up and freeze up
information will be continuously collected and added to the model as available. Robin will adjust
the schedule to represent this extension of data input. Gary questioned the variability observed in
the 1980s and Robin explained that in the years when data were collected, one was colder than
average, one was warmer than average and the other three years were generally average. Data was
collected from 1979 to 1985, with detailed data collection beginning in 1980.
Felix Kristanovich asked if climate change would be considered in the model. Robin Beebee said
that such detail is out of the current study scope. Richard Leo suggested Glen Juday of UAF be
contacted regarding climate change in the Susitna Valley. He would like to see climate change
consideration included in the ice modeling.
Geomorphology Study/Fluvial Geomorphology Modeling (Bill Fullerton, Tetra Tech)
Bill Fullerton began his presentation discussing changes to the Geomorphology Study and Fluvial
Geomorphology Modeling below Watana Dam Study (Geomorphology Modeling Study) PSPs. The
presentation can be found at http://www.susitna-watanahydro.org/wp-
content/uploads/2012/10/Geomorphology-TWG-2012-10-23.pdf. Bill found that many comments from
multiple licensing participants were similar so he grouped alike comments into eight categories (slide 2).
Geomorphology work began in 2012 so other studies could use the data in considering 2013 site
selection. Currently ten candidate Focus Areas are being considered. With the updated LiDAR and 2012
aerial images (available in December, 2012) updated habitat mapping can be applied in final site
selection. The focus for 2013 is to collect data for the 1-D/2-D models and hydraulic model. 2014
provides an opportunity for the Geomorphic Study to collect more data if needed. While reviewing the
integration figures, Bill agreed to add Water Quality (Geomorphology included in Water Quality
Interdependency Table) as a resource using the Geomorphic Study deliverables.
Slide 15 shows the five hierarchical levels applied to habitats for mapping. The first two levels are
geomorphic related while the remaining three levels are habitat related. The river segments are
separated by distinct hydrologic features. Separating the upper and middle segments is the proposed
dam. Separating the middle and lower segments is the Three Rivers confluence of the Susitna River,
Chulitna River and Talkeetna River. At this location, the Susitna River flow approximately doubles and
the Chulitna influences the Susitna River with high sediment contribution.
Version November 5, 2012 Page 3
Bill Fullerton explained that 1-D modeling is currently being proposed from the Project dam site
downstream to river mile 75 while 2-D modeling will be utilized in smaller sections referred to as Focus
Areas. Based on results of 1-D modeling in 2013, the downstream extent of Project effects will be
reevaluated by early 2014, and if it is found that the Project may substantially affect geomorphology
downstream of river mile 75, AEA is open to reconsidering the downstream extent of the
geomorphology and other related studies. Bill presented aerial maps on slide 23 of river mile 75. He
explained that this area acts as a buffer for sediment transport. This is one of the main reasons, along
with the relatively small proportion of sediment load contributed from the Susitna compared to the
Chulitna, for the modeling portion of the Geomorphic Study to initially be limited to above river mile 75.
Bill Fullerton continued the presentation and reviewed some field data collection methods in Focus
Areas (slide 27-28). Some methods are condition specific. Depending on the environmental conditions,
the field crew may choose the equipment that will best suit the study needs.
Felix Kristanovich requested more detail on the parameters used both in water quality and
geomorphology studies. A complete list of water quality parameters for each type of monitoring
program are included in the RSPs Section 5.5 through Section 5.7 and also included in the QAPP/SAPs.
When viewing the maps on slide 31, Bill Fullerton explained that the red lines represent cross sections
for the hydraulic routing model. The sediment transport model requires more cross sections than
shown currently on this slide. After evaluating existing cross sections, the study leads will determine if,
and where, more cross sections are necessary.
Bill Fullerton discussed the request for 2-D mesh size specifications. He explained that each site may
consist of multiple mesh sizes. Depending on the processes present in a specific area, the mesh size
varies depending on the detail needed/requested of that area. More specifics on mesh sizes will be
available in 2014 (after field observations). An example of mesh sizes over Whiskers Slough was
presented on slide 34. Bob Mussetter mentioned that the model flexibly allows for mesh size
refinement as needed.
Baseline Water Quality Monitoring/Modeling (Rob Plotnikoff and Harry Gibbons, Tetra Tech)
Baseline Water Quality Monitoring
Rob Plotnikoff explained that the changes to the Baseline Water Quality Monitoring / Modeling PSPs
were in response to a data gap analysis of historic data as well as comments provided by licensing
participants. Rob reviewed the goals and objectives of the Baseline Water Quality Study. He then
presented a selection of comments and AEA’s responses. The information provided by Rob is
available in the Baseline Water Quality presentation (http://www.susitna-watanahydro.org/wp-
content/uploads/2012/10/Baseline_WQ_Monitoring_TWG_2012_10_23.pdf).
In slide 5, Rob mentioned the use of a combined QAPP/SAP to ensure defensible data. These
documents were combined for efficiency since they both address many similar topics. In areas reliant
on pending data, such as specific site selections, a place holder will be present in the QAPP/SAP. Rob
asked the licensing participants if they preferred the state or federal guidance addressing this
document, and it was a general consensus of the group that state guidance is acceptable (Alaska
Department of Environmental Conservation QAPP Guidance Manual).
Version November 5, 2012 Page 4
Charlie Wisdom asked if study efforts would be intensified during pulses of ice flowing through the
system, for example an ice jam breaking loose. Paul Dworian explained that water quality data will be
collected continuously via permanent sensors (temperature probes), and crews will be collecting data
as soon as safely possible after break up. Harry Gibbons explained that the models will simulate
activity during the times that it is unsafe to manually sample. Rob Plotnikoff added that through-ice
sampling for water quality may risk contaminating the sample. He said that winter sampling is
planned, but may be opportunistic depending on conditions. Frazil ice restricts most boat access, light
is limiting and ice thickness can be deceiving, making falling through the ice a risk.
The two final slides briefly describe the accomplishments of the Water Quality Study 2012 field
efforts. For all MET stations, data streams live for easy access and backup (telemetry system
capability also serves as a check that stations are operating properly). Some in-channel temperature
monitoring sites are being winterized to avoid ice encasement and the risk of probes traveling
downstream with that ice. The September 2012 flood caused the loss of only 4 (out of 39)
temperature probe stations. Catherine Berg asked if pop-up tags were considered as a sampling
apparatus. These instruments collect the data and once complete, a tag pops up and relays the
information via satellite. Rob Plotnikoff mentioned the need to regularly visit sites for precipitation
measurements, maintenance and to ensure that equipment is in good working condition obviate the
need to use pop-up tags.
Water Quality Modeling
Rob Plotnikoff began the presentation (available at http://www.susitna-watanahydro.org/wp-
content/uploads/2012/10/Baseline_WQ_Monitoring_TWG_2012_10_23.pdf) which covered the
study’s goals and objectives and any significant changes thus far to the Water Quality Monitoring
Study PSP.
For all toxicity modeling, the QAPP/SAP will address specifics to the detail of algorithms, calibration
information and clean hands/dirty hands procedures, as examples. Toxic modeling will be conducted
and include a pathways analysis based on EPA’s recommended methods. Collection of mercury data,
in multiple forms, was added to the water quality studies. Maya Singer asked if the models can
produce an hourly output if calibrated on a longer time frame. Rob Plotnikoff explained that if
calibration issues arise, they will do so within a relatively short time frame. This allows time for
additional data collection in 2014. Harry Gibbons added that there will be no way to generate direct
information for calibrating a model for the proposed reservoir, but using input data upstream and
within the proposed reservoir will enable construction of a “virtual” reservoir.
Determining toxicities (slide 6) will be performed by using Alaska state criteria. However, this does
not address all screening levels so SQuiRT tables will be used to fill in gaps. Models (slide 7) will be
used with a finer resolution throughout the Focus Areas and may identify groundwater input.
Charles Wisdom asked if toxicity of mixtures (synergistic/additive effects) will be evaluated. Rob
Plotnikoff explained that synergistic/additive toxicities can be determined by using mixtures in lab
bioassays. However, results have a great deal of associated uncertainty. He added that bio assays
examining synergistic effects are beyond the current study plan.
Rob Plotnikoff presented a pathways analysis example on slides 10-11. Figures show possible paths
for movement of mercury throughout the system and reservoir. Although it is not possible to predict
Version November 5, 2012 Page 5
the pathway details of an entire virtual reservoir, Paul Dworian said that this analysis can inform site
selection within the inundation zone for monitoring. Charles Wisdom agreed it is important to use
pathways to identify locations for mitigation and monitoring. Rob explained in detail the capabilities
of the EFDC modeling in relation to a virtual reservoir. He said that the model can take into
consideration wetlands, bathymetry/topography, climate data, and upstream input to create a virtual
reservoir. It can also address inputs from the terrestrial environment into the aquatic environment.
Interdependencies were reviewed at the final slide of this presentation. It was agreed that sediment
modeling from the Water Quality Monitoring Study would be added to the figure as an input. Dudley
Reiser also corrected the Hydraulic Routing Model date as 1st quarter of 2013, rather than 4-Q 2013 as
stated in the presentation. Also, wetlands and riparian studies will be added as an input for the
reservoir modeling.
Mercury Assessment and Potential for Bioaccumulation (Paul Dworian, URS)
Paul Dworian reviewed updates to the Mercury Assessment and Potential for Bioaccumulation Study
PSP. Paul reviewed these changes in a presentation available at http://www.susitna-
watanahydro.org/wp-content/uploads/2012/10/Mercury_presentation_October_23.pdf. Modeling was
also added to the Mercury Study to supplement the modeling already proposed by the Water Quality
Modeling Study.
Paul Dworian explained that the Harris and Hutchison Model can be applied relatively early in the study
process. Paul also stated that Phosphorous Release Modeling calculates the maximum concentration of
mercury in fish (the peak seen in graphs on slides 7-8).
Paul presented the interdependency chart on slide 9 and added that the detailed ADEC mercury data
(regarding human consumption and health risks focusing on mercury in resident and anadromous fish) is
pending. He currently has been provided averages, but needs the size, age and location of fish to apply
the data accurately.
Project Hydrology (Bryan Carey, AEA)
Bryan Carey presented some new information regarding predicted post-Project Susitna River flows and
stages (available at http://www.susitna-watanahydro.org/wp-content/uploads/2012/10/Downstream-
Stages-TWG-Oct-16-2012-R1-pptx.pdf). The first group of stage slides are based on a conservative
assumption that the Project would be utilized to provide all the load following capability needed for the
entire Railbelt. This is a very conservative assumption as it is likely that other hydroelectric projects in
the Railbelt system will be utilized to meet portions of load following needs. When viewing these graphs
one must take into consideration that they are based on USGS gages placed in constrained areas of the
Susitna River and during ice-free, open water conditions. The stage effects are more extreme in the
confined reaches where the USGS gages are located and would dissipate in wider neighboring reaches.
The second group of slides shows daily stage and flows with load following at various gage locations;
stage changes are less than one foot at each location. The August flows and stages at locations on the
Susitna, Talkeetna, and Chulitna Rivers show that the rivers are currently seeing daily stage swings from
snow/glacial melt. Last group of slides shows the stage with and without the Project using 1984 flow
data.
Additional Discussion
Version November 5, 2012 Page 6
Sue Walker indicated that she does not agree with AEA’s distribution of draft RSPs. She said that this is
a change in the FERC ILP protocol. She added that many agencies have internal comment review
processes that prevent them from reviewing and providing comments on the draft RSPs and still meet
the November 14th deadline for comments. David Turner said that comments on the PSP will be
accepted until November 14, 2012 and addressed by AEA in the RSP, to be filed by December 14, 2012.
David encouraged those who can to take into account the additional information contained in draft RSPs
in their November 14th comments. Draft RSPs allow licensing participants to view changes in study plans
prior to the RSP filing in mid-December, which should help with resolution of any remaining
disagreements. Comments on the RSP will be accepted until January 18, 2013. A detailed calendar can
be found at http://www.susitna-watanahydro.org/project/schedule/ and an update schedule is on slide
3 of the “Overview of AEA Draft Revised Study Plans” presentation (available at http://www.susitna-
watanahydro.org/wp-content/uploads/2012/10/AEA_overview_revised_study_plans_Geo.pdf).
Action Items
Revise the Ice Processes Study interdependency figure to add data input (modeled outflow
temperatures from the reservoir) from the Water Quality Study.
Revise the Ice Processes Study schedule to reflect that break up and freeze up information will be
continuously collected and added to the model as available.
Revise the Geomorphology Study interdependency figure to add data output (sediment modeling) to the
Water Quality Study.
State guidance (Alaska Department of Environmental Conservation QAPP Guidance Manual) will be used
as guidance addressing the QAPP/SAP for the Water Quality Study.
Revise the Water Quality Study interdependency figure to add data input from the Wetlands Study, the
Riparian Study, and sediment modeling from the Geomorphology Study.
Revise all of the interdependency figures to include RSP section numbers and include a narrative in the
RSP explaining each the figure.
Version November 2, 2012 Page 1
Draft Meeting Summary
Instream Flow, Riparian Instream Flow, Groundwater, Glacial Runoff
Technical Workgroup Meeting
October 24, 2012
LOCATION: Alaska Energy Authority Main Office [Note New Meeting Location]
813 West Northern Lights BLVD
Anchorage, AK 99503
TIME: 8:30am – 4:15pm (AKDT)
SUBJECT: Instream Flow, Riparian Instream Flow, Groundwater, Glacial Runoff
ATTENDEES: Rob Plotnikoff Tetra Tech, Harry Gibbons Tetra Tech, Paul Dworian URS, Roy
Ireland DNR, Kathryn Toews Long View Associates, Dave Meyer USGS, Mike Buntjer
USFWS, Bill Fullerton Tetra Tech, Marie Steele DNR, Brian Bjorkquist AGO, Jan
Konigsberg Hydropower Reform Coalition, Michael Lilly GWS, Dudley Reiser R2,
Robin Beebee HDR, Eric Marchegioni USDA, Bryan Carey AEA, Justin Crowther AEA,
Matt Love VNF, Betsy McGregor AEA, Kevin Fetherston R2, Hannah Ramage ARRI,
Gabe Wolken DGGS, Michael Barclay HDR, Stormy Haught ADF&G, Joe Klein
ADF&G, MaryLouise Keefe R2, Sandie Hayes AEA, Dave Brailey Brailey Hydro, Scott
Crowther Ratepayers
ON PHONE: Richard Leo Coalition for Susitna Alternatives, David Turner FERC, John Haapala
MWH, Fred Winchell Louis Berger, Dirk Peterson Stillwater, Terry Schwarz DNR,
Paul Makowski FERC, Eric Rothwell NMFS, Gary Vandervine, Wayne Dyok AEA,
Becky Long Coalition for Susitna Alternatives, Sue Walker NMFS, Steve Padula Long
View Associates, Hal Shepard CWA, Phil Hilgert R2, Kim Sager DNR, Chiska Derr
NMFS, Bob Henszey USFWS
Action items are underlined
AEA PSP and ILP Study Plan Process Matt Love, VNF
The purpose of the meeting was to provide an overview of to-date revisions made to select PSPs. Matt
Love reviewed the RSP schedule, Project updates and meeting purpose as explained in the “Overview of
AEA Draft Revised Study Plans” presentation (available at http://www.susitna-watanahydro.org/wp-
content/uploads/2012/10/AEA_overview_revised_study_plans_Geo.pdf ). He informed everyone that a
spreadsheet of the status of each study plan is available on the AEA website (http://www.susitna-
watanahydro.org/wp-content/uploads/2012/10/Study-Table.pdf ). This sheet informs the reader
whether a draft RSP is available for review or changes to the PSP have not been significant based on
comments received to date and thus only the original PSP is available at this time. Live links to these
documents are imbedded in the spreadsheet. Within each draft RSP is an updated schedule, a figure
showing interdependencies amongst studies and a consultation table showing comments to-date along
with AEA’s responses.
Fish and Aquatics Instream Flow Dudley Reiser, R2
Phil Hilgert, R2
Version November 2, 2012 Page 2
Dudley Reiser presented information on the Fish and Aquatics Instream Flow Study (IFS) (presentation
available at http://www.susitna-watanahydro.org/wp-content/uploads/2012/10/TWG20121023DR.pdf).
Throughout slides 3-31 Dudley presented an overview and photos of the recent site tour. Three
candidate Focus Areas were visited by multiple water resource study leads and licensing participants.
Those Focus Areas are located at Whiskers Slough, Slough 8A and Slough 6A.
There have been 48 comments directed towards the IFS. Dudley Reiser grouped many of them in 5
recurring themes as presented on slides 33-37. The themes are listed below with a brief explanation of
AEA’s response.
1. Habitat Site Selection. The IFS is incorporating three approaches in site selection. A number of
representative sites will be chosen to characterize habitats. Critical sites will be chosen based
on all available data and information suggesting that specific areas are important from a fish use
perspective; additional sites may be added as more data become available. Random site
selection may be used to select sites within specific mesohabitat types.
2. Habitat Model Selection. The proposed modeling techniques are explained briefly in the
consultation tables and in more detail in the draft RSP.
3. Study Integration. Phil Hilgert explained the two types of integration as 1) integration of results
for different water resources within a Focus Area to get effects analysis and 2) integration within
the study area (including results from terrestrial studies).
4. Winter Fish Habitats. The 1980s studies put substantial effort into winter studies and the results
provide important background information on fish use and behavior during the winter periods.
The Focus Areas at Whiskers Slough and Slough 8A will be studied in a winter pilot study this
winter (2012-2013) with the possibility of expansion in later years. Joe Klein suggested that fish
tagging may be useful in evaluating fish winter behavior. Dudley indicated there were a number
of fish sampling and observation methods being considered including tagging. Information
obtained from the winter pilot studies will be used to refine methods and techniques applied in
subsequent years and will also provide important information regarding site access and
sampling logistics. Stormy Haught (ADF&G) mentioned that a Habitat Use permit will be
required from ADF&G for installation of any instruments in the river and indicated he would
provide R2 with the necessary permit application.
5. Stranding and Trapping. Dudley referred to Section 8.5.4.5.4 in the draft RSP.
Slides 39-43 list the IFS section headings in the PSP with newly expanded sections contained in the draft
RSP in green text. Dudley noted that overall; much more detail is included in the draft RSP than was
presented in the PSP.
Jan Konigsberg asked if Habitat Suitability Criteria (HSC) will be considered for all species throughout all
life stages. Dudley Reiser explained that although the RSP will consider all species, there will be specific
target species for which HSC criteria data will be collected and analyzed. It is simply not logistically
feasible to cover all species and all life stages throughout the entire year. The RSP will discuss data
collection, a schedule and the process used for selecting target species. Data collected in the 1980s will
help in the selection of target species. Joe Klein agrees with that approach and added that applying HSC
curves from other areas may not be applicable.
Version November 2, 2012 Page 3
Dudley Reiser reviewed the revised schedules on slides 45-53. Joe Klein requested that the application
of models be decided prior to data collection. Matt Love suggested that “Preliminary and final review of
weighting factors” be added to the schedule. Dudley added that an additional TWG meeting could be
scheduled to discuss the area weighting process and Sue Walker agreed. Phil Hilgert said that a dashed
line will be added to “study area selection” and “model selection” to represent the opportunity for
follow-up. Dudley will also add a dashed line to “Identify need for additional data” in Hydraulic Routing
for follow-up.
Joe Klein asked what time steps are being proposed for the routing model. Phil Hilgert said that the
model will be developed with analysis possible at three minute time steps. He said that a one hour time
step is common practice for presenting the model output, and Joe mentioned that something shorter
than a one hour step may be necessary when evaluating stranding and trapping.
The IFS integration figure is on slide 55. Slide 56 includes the integration of models originally presented
in the PSP. This figure will be included in the RSP as well.
Dudley Reiser continued the presentation and explained the stratification approach with a map of the
geomorphic reaches and candidate Focus Areas in the Middle River. The Lower River will likely contain
at least one Focus Area, but the specifics are still under discussion.
Riparian Instream Flow Kevin Fetherston, R2
Kevin Fetherston presented the changes made to the Riparian Instream Flow Study (Riparian Study).
The presentation is available at http://www.susitna-watanahydro.org/wp-
content/uploads/2012/10/V_3_Riparian_IFS_TWG_Presentation_10_24_2012.pdf. After reviewing the
meeting objectives (slide 2), Kevin presented the interdependency figure for the Riparian Study (slide 3).
The line showing input from the Riparian Botanical Study represents the strong relationship between
the studies. Kevin agreed to add the Large Woody Debris component (6.5.4.9) of the Geomorphology
Study and the River Productivity Study as recipients of data from the Riparian Study.
Kevin Fetherston reviewed the section headings of the draft RSP which were reorganized from the PSP
to better represent the study request of USFWS (slide 5). Throughout slides 6-7 Kevin reviewed the
components of the Riparian Study.
Slides 8-38 addressed some comments received since AEA’s filing of the PSP and AEA’s responses to
those comments. Pseudoreplication was referenced in slide 10 in response to USFWS’s comment
regarding replication. Kevin Fetherston explained that pseudoreplication is addressed in the Riparian IFS
with sampling conducted at the Focus Area modeling sites. Also, riparian plant community and soils
sample replicates are being taken throughout the entire Project Area as the primary objective of the
Riparian Botanical Study. Although groundwater characteristics will not be measured throughout the
entire Project riparian area, but will be at Focus Areas. Bob Henszey asked how the data will be
extended to other areas with confidence. Kevin said that the Focus Area modeling results will be used
to “scale up” to the larger riparian process domain and Project Areas. Michael Lilly said that with
groundwater process and scale understood, one may infer those data elsewhere within the Project Area.
Kevin added that if the relationship between riparian plant communities and groundwater-surface water
regime is identified, one may be able to assume that those relationships are consistent in similar
conditions.
Version November 2, 2012 Page 4
Kevin Fetherston addressed USFWS’s comment on slides 12-17 regarding seedling establishment by
explaining seedling establishment requiring specific timing, surface and groundwater conditions, and
sediment type. By applying fluvial geomorphology sediment transport, groundwater / surface water,
and ice process models, and operational projections, one may obtain an understanding of the possible
Project effects on seedling establishment. An approach to addressing study length limitations is to age
established seedlings, using dendrochronology techniques, and statistically model the hydrologic,
sediment type and establishment relationship.
USFWS questioned the sensitivity of MODFLOW in quantifying hydroperiod relationships for seedlings
(slide 14). Michael Lilly said that data will be evaluated for accuracy and wells will be added if deemed
necessary for calibration and validation of models. Kevin added that wells will be located in specific
riparian plant communities, including sites critical to riparian vegetation establishment and recruitment.
Bob Henszey requested that a schematic diagram of proposed well placements be included in the
Riparian Study Plan as well as the Groundwater Study Plan.
Kevin presented photographs of the Susitna River on slide 24-30 to show the sediment deposition from
ice and/or flooding with the river location identified on each slide.
Jan Konigsberg asked if nutrients will be evaluated in sediment depositions. Kevin Fetherston said that
nutrients are not a parameter proposed to be studied. Slides 33-36 explained what will be characterized
of sediment depositions.
Kevin Fetherston concluded his presentation with an updated schedule on slides 39 and 40.
Groundwater – Related Aquatic Habitat Study Michael Lilly, GWS
Michael Lilly reviewed comments to the Groundwater-related Aquatic Habitat Instream Flow Study
(Groundwater Study) PSP as well as AEA’s responses, an updated schedule, an interdependency figure,
and recent field observations. Michael’s presentation is available at http://www.susitna-
watanahydro.org/wp-
content/uploads/2012/10/Groundwater_IFS_TWG_Presentation_10_24_2012.pdf.
All notable comments requested more detail in particular topics. Those topics are listed on slides 3 and
4 with checks representing that those comments were addressed and detail was added to those
sections. Michael Lilly explained that the completed consultation tables, located in the draft RSP, will
include an overview of AEA’s response with an associated section number to reference for further
detail.
Michael Lilly said that groundwater wells will be placed at Focus Areas and data from functioning private
water source wells will be collected as permitted by well owners. He predicts that private water-source
wells are generally drilled to depths to be unaffected by relatively low winter stages. This will be
confirmed as wells are incorporated into study efforts and water levels will be measured. Bob Henszey
asked if raw data will be provided for use in other studies. Bob wanted to ensure that Michael was
responsible for the quality control. Michael explained that he will evaluate the quality of the data before
providing it to the other studies. Joe Klein asked if piezometers will be placed to confirm that upwelling
is occurring where it is visually identified. Michael said that piezometers will be used as much as it is
practical, but additional visual data and observations will be collected as possible from all relevant field
crews. Joe asked how field crew will be confirming the presence of upwelling if piezometers are not
applied to those locations. Dudley Reiser explained that temperature readings may be taken. He said
Version November 2, 2012 Page 5
that visual observation will be the means of identifying upwelling outside of Focus Areas. With an
understanding of upwelling and the associated habitat conditions, one may be able to confirm upwelling
by relating it to the conditions in which it is visually observed. Joe Klein asked if upwelling would be
considered not present if not observed or only weak signs are observed. Michael Lilly said that the
surface observation of upwelling is only the “tip of the iceberg” so if any signs are observed in sloughs
and other surface-water bodies, one must assume it is present in the area. He also added that if visual
signs are not observed, it cannot be concluded that it is not present.
Slide 5 explains additional changes to the PSP including the updated schedule and interdependency
figures (slides 6-9). Michael Lilly noted a correction to be made on slide 6. A “7” must be added to the
beginning of “.5.4.5 Riparian Vegetation….”. Also, the “•” needs to be added to the schedule’s legend.
Michael Lilly presented his interdependency figure over three separate slides (7-9) focused on separate
elements of the study. Michael Lilly clarified that the “Watana Dam/Reservior” element feeds into the
construction aspect of the proposed Project in that any underground water exchange between the area
of the proposed reservoir and river downstream of the Project would be reduced to stop leakage, which
is meeting the intent of the engineering designs.
Michael Lilly finished his presentation by updating licensing participants of recent field observations on
slides 10-22.
Glacial and Runoff Changes Study Paul Dworian, URS
Gabe Wolken, DGGS
Brian Carey explained that all current comments pre-date the PSP filing, and he anticipates further
consultation with agencies fairly soon.
Gabe Wolken provided background of the Glacial and Runoff Changes Study (Glacial Study) in a
presentation available at http://www.susitna-watanahydro.org/wp-content/uploads/2012/10/Glacier-
and-Runoff-Changes_Susitna-Watana_10-24-2012.pdf. Gabe explained that the main purpose of the
Glacier Study is to analyzing the potential impacts on flow into the reservoir due to glacial reactions to
climate change. A model will be utilized to evaluate the surface mass balance of glaciers on an annual,
decadal and century time scale. Gabe explained that approximately 40 glaciers are in the Susitna
watershed, but this study focuses on 5. This is the largest scale of this type of study yet to be conducted
in the state of Alaska.
In 2012, crews were able to install all off ice stations, with on-ice stations being added in 2013. A map of
the stations can be seen on slides 9 and 11. The field season started in April 2012 and due to the large
study area, the Glacier Study is expanding beyond traditional field methods and employing high tech
options such as ground penetrating radar from a helicopter for the first time in Alaska. This has proven
successful, and the apparatus as well as results can be seen on slide 12. The results are graphed on slide
13 (X axis being elevation). Gabe Wolken pointed out that the Maclaren glacier (pink) has been shown
to have a higher snow depth although it is located at a lower elevation than the other surrounding
glaciers.
Slide 14 consists of photos of ablation stakes (upper left and lower right) as well as tundra weather
stations (upper right and lower left). The tundra weather stations provide data on surrounding non-ice
terrain which can be used to calibrate the hydraulic model.
Version November 2, 2012 Page 6
Gabe Wolken explained the WaSiM model on slide 16 saying that it is physically based and considers
changes in glacier size over time. Application of the model is presented on slide 18; the model must be
calibrated with in situ data. Gabe explained that when a model is developed and calibrated, future
scenarios to year 2100 can be created with different assumed climate conditions.
The final slide of Gabe Wolken’s presentation (slide 19) shows the Glacier Study’s schedule. Gabe said
that it is a work in progress and updates will be provided periodically.
Gabe Wolken’s discussed the current status of Upper Susitna glaciers. He said that a reduction of glacier
volume is apparent when comparing historic and current data. The Glacier Study is utilizing information
retrieved from historic photos. Paul Dworian noted the time gaps between years photographed. Gabe
confirmed that there are four time stamps on photos prior to year 2000 and about three time stamps
after that. Earlier photos are basin-wide.
Sue Walker asked the current state of the studied glaciers in regard to their water retention capabilities
(the Run-off section of the graph on slide 6). Gabe Wolken said that this detail is not within the Glacier
Study’s scope.
Project Hydrology Bryan Carey, AEA
Bryan Carey presented some new information regarding predicted post-Project Susitna River flows and
stages (available at http://www.susitna-watanahydro.org/wp-content/uploads/2012/10/Downstream-
Stages-TWG-Oct-16-2012-R1-pptx.pdf ). The first group of stage slides is based on a conservative
assumption that the Project would be utilized to provide the entire load following capability needed for
the entire Railbelt. This is a very conservative assumption as it is likely that other hydroelectric projects
in the Railbelt system (Bradley, Eklutna and Cooper lakes) will be utilized to meet load following needs.
When viewing these graphs one must take into consideration that they are based on USGS gages placed
in constrained areas of the Susitna River. This implies that the stage effects are most extreme in these
areas and would dissipate in wider neighboring reaches. Second group of slides shows daily stage and
flows with load following at various gage locations. Stage changes are less than one foot at each
location. The August flows and stages at locations on the Susitna, Talkeetna, and Chulitna Rivers show
that the rivers are currently seeing daily stage swings from snow/glacial melt. Last group of slides shows
the stage with and without Project based on 1984 flows.
Additional Discussion
Sue Walker asked where differences between the study requests and PSP are being identified. David
Turner responded by explaining that the PSPs should have addressed all concerns stated in the study
requests. Comments should be provided to address specific differences in the two so they can be
discussed and resolved. David promoted the sharing of informal comments as soon as they are
conceived for maximum time available to reach a resolution. Sue Walker stated that it is difficult to
compare the two documents because the organization changed from the study requests to the PSPs.
Sue Walker requested a crosswalk to be provided to compare organization of the study requests and
PSPs. David said that a crosswalk would be helpful, but if unavailable, one must identify differences by
thorough review. Betsy McGregor located a crosswalk previously created to compare the fisheries study
requests and PSPs, which were substantially reorganized. She forwarded that document to Sue Walker.
Action Items
Version November 2, 2012 Page 7
IFS Fish and Aquatics
Joe Klein finds fish tagging beneficial in the winter season. Dudley will consider adding this to the RSP
Section 8.5.4.5.1.1.
Joe Klein requested that the application of models be decided prior to data collection. Matt Love said
that “Preliminary and final review of weighting factors” would be added to the schedule. Dudley
added that an additional TWG meeting would be scheduled to discuss the area weighting process.
Regarding the IFS Fish and Aquatics schedule: Phil Hilgert said that a dashed line will be added to
“study area selection” and “model selection” to represent the opportunity for follow-up. Dudley will
also add a dashed line to “Identify need for additional data” in Hydraulic Routing for follow-up.
Riparian
Kevin agreed to add the Large Woody Debris component (6.5.4.9) of the Geomorphology Study and
the River Productivity Study as recipients of data from the Riparian Study.
Bob Henszey requested that a schematic diagram of proposed well placements be included in the
Riparian Study as well as the Groundwater Study.
Groundwater
Schedule: A “7” must be added to the beginning of “.5.4.5 Riparian Vegetation….”. Also, the “•”
needs to be added to the schedule’s legend.
Version November 2, 2012 Page 1
Draft Meeting Summary
Fish and Aquatic Resources
Technical Workgroup Meeting
October 25, 2012
LOCATION: Alaska Energy Authority Main Office
813 West Northern Lights BLVD
Anchorage, AK 99503
TIME: 8:30am – 4pm (AKDT)
SUBJECT: Water Resources Studies & Geology and Soils Study Plan Updates
ATTENDEES: Dudley Reiser R2, Betsy McGregor AEA, Kathryn Toews LVA, Joe Klein ADF&G,
Hannah Ramage ARRI, Michael Barclay HDR, MaryLouise Keefe R2, Justin Crowther
AEA, Sandie Hayes AEA, Bill Fullerton Tetra Tech, Leslie Jensen ARRI, Rob Plotnikoff
Tetra Tech, Harry Gibbons Tetra Tech, Dani Evenson R2, Keri Lestyk HDR, Brian
Bjorkquist AGO, Jack Erickson ADF&G, James Brady HDR, Mike Buntjer USFWS, Eric
Marchiegioni USDA, Tim Sundlov BLM, Stormy Haught ADF&G, Michael Lilly GWS,
Jan Konigsberg HRC, Marie Steele DNR, Mandy Migura NMFS, Brian Lance NMFS
ON PHONE: David Turner FERC, Fred Winchell Louis Berger, Dirk Peterson Stillwater, AJ Keith
Stillwater, Chuck Sensiba VNF, Kim Sager DNR, Steve Padula LVA, Ethan Bell
Stillwater, Wayne Dyok AEA, Sue Walker NMFS, Angela Percival Stillwater, Mark
Birch DWC, AJ Keith Stillwater, Tim Nightengale R2
AEA PSP and ILP Study Plan Process (Dudley Reiser, R2)
The purpose of today’s meeting was to provide an overview of to-date revisions made to select
PSPs. Dudley Reiser reviewed the RSP schedule, Project updates, and today’s purpose as explained
in the “Overview of AEA Draft Revised Study Plans” presentation (available at http://www.susitna-
watanahydro.org/wp-content/uploads/2012/10/AEA_overview_revised_study_plans_Geo.pdf). He
informed everyone that a spreadsheet of the status of each study plan is available on the AEA
website (http://www.susitna-watanahydro.org/wp-content/uploads/2012/10/Study-Table.pdf).
This sheet informs the reader whether a draft RSP is available for review, or, if changes to the PSP
have not been significant based on comments received to date, only the original PSP is available.
Live links to these documents are imbedded in the spreadsheet. Within each draft RSP is an
updated schedule, a figure showing interdependencies among studies, and a consultation table
showing comments to-date along with AEA’s responses.
Habitat Characterization Study (MaryLouise Keefe, R2; Michael Barclay, HDR)
MaryLouise Keefe introduced the Habitat Characterization Study (Habitat Study) presentation
available at http://www.susitna-watanahydro.org/wp-content/uploads/2012/10/Aquatic-Habitat-
Characterization.pdf. Many of the comments received to date and responses are included in Slides
2 and 3. MaryLouise explained that many comments received on the Habitat Study ask for further
Version November 2, 2012 Page 2
detail. AEA has been working on additional details which are provided in the draft RSP. One
commenter inquired why the USFS protocol will be used to characterize the habitat. MaryLouise
explained that this is a standard protocol used widely in Alaska, and it generates a comparative data
set based on a consistent set of parameters to characterize riverine habitats. AEA has also added
the edge habitat concept to the Susitna-Watana habitat classification system for use in this study.
Michael Barclay said that lessons-learned from 2012 field efforts have prompted some detail
changes to the PSP. On Slide 6, Michael Barclay showed that the red text indicates items not
included in the PSP but present in the draft RSP.
Michael Barclay explained that the advantage of using aerial video is the ability to access areas that
would not be accessible by foot or by boat. The 2012 videography efforts took place in excellent
conditions and the result is good quality video at approximately 100-400 feet elevation above the
ground and traveling about 15-40 miles per hour, depending on stream size. Michael Barclay
explained that generally at these speeds and elevation, habitat will be sampled about every 80-150
feet. These samples will be taken from the video using a frequency analysis where habitats are
characterized along systematically delineated video transect habitats. Hannah Ramage asked if the
mesohabitat characterization will be accurate when sampling at only one flow. Michael Barclay
explained that when mapping mesohabitats, a low to moderate flow is ideal because the driving
factors of underlying channel morphology can be identified to infer the habitat at that location. If
the river flow is higher than average, the mesohabitats may become uniform and cannot be
differentiated. If the river is at an especially low flow, the aquatic habitats may not be present and
only substrate may be seen. MaryLouise Keefe added that low flow often is considered a limiting
condition for fish populations and thus low flows have additional value when characterizing aquatic
habitat. Michael Barclay said that the fish sampling would be conducted at a low to moderate flow,
so mapping at a similar flow is most useful. Bill Fullerton added that the Geomorphology Study will
be delineating habitat at three flows.
Michael Barclay explained the process of characterizing mesohabitats. Multiple (approximately 5-
12) photo examples of each mesohabitat will be used as a type index and referenced when
determining a particular sample’s classification. There will be variability within each habitat type
and that variability will be captured in the type index photographs. Slide 8 lists all tributaries and
mainstem river miles videoed in 2012. Michael Buntjer asked about the differentiating feature
between a cascade and rapid, and Michael Barclay identified it to be primarily the slope. The
specifics are available in the draft RSP.
Slides 9-13 consist of photo examples of numerous mesohabitat types in the Susitna River. Slide 13
shows the results of a test to see if it is feasible to map the lower river using aerial video. Michael
Barclay said that to contain the entire main channel and lateral habitats, one would need to fly at
over 2,200 feet above the ground. If traveling at the preferred 400 feet, at least five passes would
be required to cover the entire river width (including lateral habitats), adding room for mistakes in
overlapping the images. MaryLouise Keefe said that because of the complexity it is not practical to
map the lower river to the mesohabitat level; instead, the lower river will be mapped to mainstem
habitat level using aerial imagery.
Slides 14 and 15 show a revised nested habitat type classification system for tributaries. Some areas
will be sampled using aerial video as well as ground sampling to verify mesohabitat types. Slide 17
includes a similar classification system for the Susitna River mainstem. MaryLouise Keefe agreed to
Version November 2, 2012 Page 3
add “rapids” to the mainstem classification system. She explained that if encountered, additional
mesohabitat types can be added. Per Joe Klein’s request, Michael Barclay will be looking into the
necessity of differentiating between alcove and backwater habitat types.
A sample of line mapping is included in Slide 18. Michael Barclay said that a new identification
number will be given every time the habitat changes along the river. The results for the middle river
will be available to the Instream Flow Study prior to 2013. In addition, he noted that edge habitat
would be quantified from the video. The length of edge habitat will be calculated as double the unit
length but may be refined once the Geomorphology Study creates polygons for each segment, by
calculating the actual edge length. Bill Fullerton said that the actual edge length will not be available
prior to 2013 so the current numbers will remain as placeholders until refinement is possible.
Slide 19 shows an example of how data could be presented. Hannah Ramage mentioned the
difficulty of classifying habitats that may change with changes in flow/stage and asked how that will
be addressed. In particular, Hannah mentioned a side slough becoming a side channel at higher
flows. Dudley Reiser clarified that the Habitat Study will be identifying such a situation as a side
slough that is overtopped at high flow, as opposed to changing the nomenclature under different
flow conditions. Michael Barclay added that the video was taken at 10,000-11,000 cfs which will be
the reference condition for habitat mapping and characterization. MaryLouise Keefe mentioned
that distinctions between sloughs and side channels will also be verified by field crews during
sampling. Betsy McGregor indicated that the video will be publicly available at DNR’s website in
multiple files (total play time combined is three to five hours). Also, in the draft RSP, a link is
provided to Michael Barclay’s preferred video viewing software for free download.
Fish Distribution and Abundance Middle/Lower River (MaryLouise Keefe and Dani Evenson, R2)
MaryLouise Keefe introduced the Fish Distribution and Abundance in the Middle and Lower Susitna
River Study presentation, which is available at http://www.susitna-watanahydro.org/wp-
content/uploads/2012/10/Fish-Distribution-and-Abundance.pdf. She explained that there were
many comments addressing both upper and middle/lower river studies, so the comment/response
tables were combined. MaryLouise summarized some of the key comments and AEA’s responses in
Slides 3-10. She explained the habitat-based sampling approach in sites randomly selected within a
habitat classification. She said that graphics and detailed text had been added to the draft RSP to
further explain the study.
MaryLouise Keefe explained that AEA has added an objective (black text on Slide 12) addressing
salmon early life history, timing, and movements. This objective links directly with the varial zone
modeling in the Instream Flow Study. Also, MaryLouise explained that an objective was added for
the winter-spawning species such as burbot. She added that it is no longer proposed to sample for
population estimates based on discussion with USFWS and ADF&G. This decision was made at a
workgroup meeting where licensing participants found it more advantageous to add effort to other
objectives of the fish distribution and abundance studies.
Dani Evenson reviewed PSP revisions in Slides 13-18. Emergence timing sampling (Slide 13) will be
conducted in areas known for chum and sockeye spawning. These areas will be sampled monthly
until temperatures reach a level associated with emergence, when sampling will increase to bi-
weekly.
Version November 2, 2012 Page 4
When reviewing Slide 14, Jack Erickson questioned if DIDSON will capture individuals less than 50
mm. Dani Evenson said that will be determined in the pilot study this winter. Joe Klein said that this
size criteria may be too limiting and larger individuals may be at risk of trapping/stranding equally to
those less than 50 mm. Dudley Reiser explained that fish smaller than 50 mm are known to burrow
into the gravel as down ramping occurs. This makes them very susceptible to stranding and
trapping. He added that other size classes will not be ignored if observed.
When discussing day/night activity of fish (Slide 15), MaryLouise Keefe explained the lack of
previous studies in ice-prone areas regarding salmon activity.
MaryLouise Keefe explained that prior to field work, periodicity charts will be created using existing
data for all species. Dani Evenson added that all 1980s procedure manuals will be reviewed as well
as information from ADF&G regarding successful and failed methods to gain a better understanding
of how to approach fish collection.
Slides 21-24 provide a visual representation of site selection by strata. MaryLouise Keefe explained
that it is currently unknown if all mesohabitats are present in each reach of the river. The number of
sampling sites (in parentheses) may be redistributed at the mesohabitat level to a ratio
representative to the applied reach. MaryLouise said that the goal is to have six sample sites at each
main channel habitat with the sampled mesohabitats distributed proportionately.
Jack Erickson asked how “hard to catch” species, such as lamprey and sculpin, will be addressed and
if specific gear will be chosen to focus on them. MaryLouise Keefe said that with the extensive
sampling program planned, over 150 sites sampled monthly, she would expect they would
encounter all fish present even if only in small numbers.. She said that the planned intensity of
sampling is high, and the crews will be in the water most days of the year, making the collection of
such species probable. However, if a certain species warranted specific consideration, it should be
brought forth and a specific objective considered, similar to the winter spawning species objective
mentioned earlier.
While reviewing the schematic for lower river site selection (Slide 24), MaryLouise Keefe explained
the limitations of habitat classification in the lower river. She said that there is less understanding of
potential Project effects in this area and that the mapping is less precise due to the area’s
complexity. MaryLouise said that because of this, it may be better to focus sampling sites in lateral
habitat in the upper portion of the lower river. This aspect of the plan is still under consideration
but will be made clear in the RSP.
Dani Evenson explained that sampling is proposed in the upper river in 25% of the accessible
tributaries, with an initial preference for those sites being within the known as Chinook salmon
distribution. She added that if spawning areas in the inundation zone are identified, species-specific
efforts may be added as necessary. Radiotelemetry will be conducted in the Upper River.
MaryLouise Keefe added that there may be a need for smaller, shorter-life tags for seasonal tagging
efforts. Currently, multiple tagging events are proposed for both the upper and lower river sections.
Mike Buntjer asked the value of tagging fish in the Upper River since that habitat will be converted
to a reservoir post-Project. MaryLouise added that the Fish Passage Feasibility Study will use
information from telemetry studies conducted above the Project.
Tim Sundlov asked if lamprey should be included as a targeted rare species. He explained that
electrofishing can be used to target lamprey if that need occurs. Hannah Ramage said that an
Version November 2, 2012 Page 5
objective may be needed to address the presence of lamprey. Little is known of them, and because
they seem to require specific sampling methods, they may be overlooked with more general fish
collection. MaryLouise Keefe said that the need for lamprey-specific sampling will be considered by
AEA.
Slides 1 and 2 of the fisheries interdependency flow chart (available at http://www.susitna-
watanahydro.org/wp-content/uploads/2012/10/Fisheries-Interdependnecy-Flow-Charts.pdf)
include the interdependency figures for the fish distribution and abundance studies. It was agreed
that for both figures, “Mercury Assessment and Potential for Bioaccumulation Study” should be
added to the bottom right as a recipient of fish distribution and abundance data. It was also agreed
that “Cross Disciplinary Studies” on the top row should be replaced with “Fish and Aquatics Instream
Flow Study”.
Jan Konigsberg asked if an estimated mortality of egg-to-fry and fry-to-smolt will be calculated
based on Project effects. MaryLouise Keefe explained the purpose of this study is to provide
baseline data and it does not include such an objective. She added that it would be very
complicated and likely not possible to develop a specific prediction of mortality by life stage.
River Productivity (MaryLouise Keefe and Tim Nightengale, R2)
MaryLouise Keefe introduced the River Productivity Study presentation (available at
http://www.susitna-watanahydro.org/wp-content/uploads/2012/10/River-Productivity.pdf). She
explained that Mark Wipfli of UAF will assist AEA with the River Productivity Study Plan. MaryLouise
summarized comments and responses on Slides 2-9.
MaryLouise Keefe explained that the use of a surrogate system had been requested. A surrogate
system is one which would later represent the Susitna River as if the Project were present. After
much consideration and research it has been concluded that a system does not likely exist in Alaska
with the necessary characteristics to allow it to be considered as a surrogate to the Susitna River.
Synthesis of existing literature will cover this concept.
Study of the stream’s metabolism was requested. Although stream metabolism is not being directly
studied, MaryLouise Keefe explained that a rigorous approach will be undertaken to evaluate river
productivity, including bioenergetics modeling and isotopic analysis of prey species.
Tim Nightengale explained AEA’s response to ADF&G’s request for reference sites on Slides 10 and
11. Reference sites are sites similar to areas in the Project-affected area of the Susitna River that
can be monitored before, during, and after Project construction. Parameters of a reference site can
be compared to an associated site on the Susitna River to monitor possible change. He explained
that the Talkeetna River includes areas most like the middle river portion of the Susitna River. Tim
explained that these sites will studied in the spring, summer, and fall using the same methods that
are applied to the Susitna River. Discussion ensued regarding the request for a Before After Control
Impact (BACI) design. MaryLouise Keefe explained that BACI designs are now requiring many more
years of data than originally thought to be reliable. She added that sample sites in the upper river
area of the Susitna River will also be sampled and may continue to be sampled as reference sites if
needed. Rob Plotnikoff indicated that the proposed design would be adequate if a BACI approach
was desired.
Version November 2, 2012 Page 6
Tim Nightengale presented Slide 13, which explains the growth rate potential (GRP) model. Stormy
Haught suggested changing northern pike to sculpin. He said that northern pike may be difficult to
locate in the middle river area due to a velocity barrier downstream that limits their distribution.
MaryLouise Keefe said that she would consider that and noted the need to review available
literature for whatever species is chosen.
Tim Nightengale explained that stable isotope analysis can identify the contribution of marine-
derived nutrients as well as freshwater-derived nutrients. This analysis can be conducted on
terrestrial drift, algae, fish, and possibly fish stomachs. Stormy asked if tissue plugs will be taken
from juvenile fish and if so, AEA should consider mortality and permitting requirements.
MaryLouise Keefe agreed to look into that.
Emergence traps are explained on Slide 14 with a photo. Tim Nightengale explained that this
instrument collects emerging aquatic insects, a product of aquatic insect production from the
stream, which will serve as a surrogate measure for actual production. Checking and resetting the
traps monthly from April through October is proposed.
MaryLouise Keefe explained that the number of stations changed from nine in the PSP to six in the
draft RSP due to a shift in focus on more rigorous sampling at fewer stations. Joe Klein asked what
UAF’s perspective on the fewer stations was. MaryLouise said that Mark had indicated that sampling
four sites (two above the proposed Project and two below) would be sufficient. Stormy Haught said
that he may prefer more stations below Devils Canyon due to the added presence of fish there.
MaryLouise asked if it would be adequate to conduct community-based sampling only, and Stormy
agreed it would be adequate.
Stormy Haught asked how the crew would conduct benthic sampling in high flows. Tim Nightengale
explained that newly inundated areas are not colonized immediately and sampling would wait until
that area is inundated for the necessary time for colonization (estimate is one month until site
specific colonization rates are available). MaryLouise Keefe said that details will be added to the
RSP.
Cook Inlet Beluga Whales (Keri Lestyk, HDR; Michael Link, LGL)
MaryLouise Keefe summarized the comments addressing the Cook Inlet Beluga Whales Study
(Beluga Study). She said that most comments request a reevaluation of the study area, additional
and more frequent aerial surveys, and passive acoustic monitoring for beluga presence in the
winter. Keri Lestyk said that passive acoustic monitoring may prove difficult because the equipment
would need to be installed far from the belugas due to ice scour. She said that during the winter,
belugas will be assumed as present and foraging.
Keri Lestyk explained that the objectives of the Beluga Study (Slide 3) have not changed since the
PSP, but many details have been added to the draft RSP. Keri explained that the study area has
been reduced to the Susitna River delta (Slide 5 provides a map showing that area), based on
previous meetings held with NMFS and ADF&G. She specified that the Beluga Study will be
collecting data up to river mile 50. By reducing the study area, Keri explained that survey times
were shortened. The survey frequency was increased, allowing for additional surveys in critical
months for belugas. These times include May/June for feeding as well as July/August for calving and
breeding. Keri explained that four-hour surveys will be broken up with two hours during high tide
and two hours during low tide, if possible.
Version November 2, 2012 Page 7
Slide 8 addresses the remote live-feed camera system. Keri Lestyk explained that these cameras
provide information on an individual’s behavior and feeding activities, while aerial surveys focus
more on the group behavior. These cameras may capture group composition better than aerial
surveys in regard to calves. Aerial surveys will be conducted simultaneously for cross-checking.
Aerial surveys will be conducted visually at a 1,000-foot elevation above the ground. A camera and
camcorder will be available if found necessary and multiple passes may be needed for large groups.
Keri Lestyk introduced a proposed model presented in the draft RSP on Slide 9. She explained that
the Ezra model, which had been previously considered, is not predictive. Mandy Migura asked if the
proposed model would address potential Project effects to the substrate in the delta. She explained
that beluga whales utilize channel morphology to ambush their prey and could potentially be
affected by changes in the channel. Bill Fullerton said that the sediment transport model will be
using river mile 75 as the downstream boundary. He added that if effects are seen to possibly
extend past river mile 75, the model may be extended as well. Bill explained that the Chulitna River
and Talkeetna River have such high sediment input that any changes in the Susitna upstream of the
Three Rivers Confluence may have a relatively small effect, especially as far downstream as the
delta. This is why the current downstream boundary of the modeling effort for Project effects on
sediment is just downstream of the Three Rivers Confluence. Also, the geomorphology in the delta
relied on by the belugas may be due to a localized phenomenon such as tides, which will not be
affected by the Project.
Keri Lestyk presented the interdependency chart for the Beluga Study (Slide 13 of the fisheries
interdependency flow chart available at http://www.susitna-watanahydro.org/wp-
content/uploads/2012/10/Fisheries-Interdependnecy-Flow-Charts.pdf). Mandy suggested adding
the Salmon Escapement Study as an input.
Angela Percival suggested that Keri Lestyk reference Hansen and Hubbard (1999) and Rugh (2000).
Keri agreed to look at those papers.
Hydrology Update (Bryan Carey, AEA)
Bryan Carey presented some new information regarding predicted post-Project Susitna River flows
and stages (available at http://www.susitna-watanahydro.org/wp-
content/uploads/2012/10/Downstream-Stages-TWG-Oct-16-2012-R1-pptx.pdf). The first group of
stage slides are based on a conservative assumption that the Project would be utilized to provide all
the load following capability needed for the entire Railbelt. This is a very conservative assumption as
it is likely that other hydroelectric projects in the Railbelt system will be utilized to meet portions of
load following needs. When viewing these graphs one must take into consideration that they are
based on USGS gages placed in constrained areas of the Susitna River and during ice-free, open
water conditions. The stage effects are more extreme in the confined reaches where the USGS
gages are located and would dissipate in wider neighboring reaches. The second group of slides
shows daily stage and flows with load following at various gage locations; stage changes are less
than one foot at each location. The August flows and stages at locations on the Susitna, Talkeetna,
and Chulitna Rivers show that the rivers are currently seeing daily stage swings from snow/glacial
melt. The last group of slides shows the stage with and without the Project, using 1984 flow data.
Action Items
AEA Consultants will add “rapids” to the mainstem classification system.
Version November 2, 2012 Page 8
Michael Barclay will look into the necessity of differentiating between alcove and backwater.
AEA will consider the need for lamprey-specific sampling.
AEA Consultants will add “Mercury Assessment and Potential for Bioaccumulation Study” to the
bottom right of the interdependency figure for both fish distribution and abundance studies as a
recipient of fish distribution and abundance data.
AEA Consultants will replace “Cross Disciplinary Studies” with “Fish and Aquatics Instream Flow
Study” at the top of the interdependency figure for both fish distribution and abundance studies.
AEA will consider replacing northern pike with sculpin in the growth rate potential (GRP) model.
The Salmon Escapement Study will be added as an input in the interdependency figure for the
Beluga Study.
AEA requested a meeting be scheduled with licensing participants regarding the Eulachon
Distribution and Abundance in the Susitna River Study and the proposed model to evaluate
potential Project effects in the delta. Mandy Migura requested it be on Friday, November 2.
Version November 2, 2012 Page 1
Draft Meeting Summary
Fish and Aquatic Resources
Agency Meeting
November 2, 2012
LOCATION: Alaska Energy Authority Main Office
813 West Northern Lights Blvd
Anchorage, AK 99503
TIME: 10:00 am – 12:00 pm (AKDT)
SUBJECT: Cook Inlet Beluga Whale (CIBW) and Eulachon Revised Study Plans (RSP).
ATTENDEES: Betsy McGregor (AEA), Keri Lestyk (HDR), Michael Link (LGL), James Brady (HDR),
Michael Barclay (HDR) and Mark Burch (ADF&G)
ON PHONE: Mandy Migura (NMFS), Kate Savage (NMFS) and Matt Love (VanNess Feldman)
Materials distributed before meeting: Agenda and Presentation.
The meeting began with introductions and a brief review of the CIBW and eulachon study
plans (SP). Originally, eulachon studies were incorporated into the CIBW SP because
eulachon are a PCE prey species for belugas. The SPs were subsequently separated for the
Proposed Study Plans (PSP) that were filed with FERC in July 2012. Since the PSPs were
filed, there have been several internal AEA conversations regarding the most effective
methodology to address baseline data needs. AEA believes that the proposed changes to the
RSPs will collect data which will be more relevant and easier to interpret for the Impact
Analyses and Biological Assessment.
Mandy commented that NMFS has not reviewed the draft RSP and that written comments
submitted November 14th will be on the PSPs.
Mandy commented that she and Kate are marine mammal biologists, and therefore, will only
comment on beluga whale issues and that comments given during this meeting are
preliminary and may not reflect the written comments on the RSP. In addition, since fisheries
biologists and hydrologists were not present at the meeting, NMFS would not provide
comments on these topics.
Eulachon Revised Study Plan
In the Eulachon PSP, Objective 3 included collecting data on eulachon densities because of
agency comments that density of fish may be important to beluga foraging success. To
address this issue, it would be best to obtain density information on the foraging grounds.
However, this would be extremely time consuming, expensive and not very practical given
that the “ambush” terrain may be changing drastically due to the large tidal influence on the
mudflats. Therefore, the PSP proposed to measure density on the spawning grounds as a
Version November 2, 2012 Page 2
proxy for the densities in the mudflats (foraging grounds). After many conversations, AEA
decided that this was not the most appropriate method for determining potential Project
effects on eulachon densities.
In the RSP, directly measuring eulachon densities was removed. Instead, a modeling effort to
evaluate the tidal influence on the mudflats was included in the CIBW RSP (see below).
Cook Inlet Beluga Whale Revised Study Plan
To address potential Project effects to eulachon densities in the beluga foraging grounds, a
Water Surface Elevation (WSE) model was added to the CIBW RSP. Since direct
measurements of eulachon densities are not practicable, this model will help assess indirect
impacts to the mudflats which may affect fish densities. If the model shows that the tidal
influence is much stronger than river input, there is less potential that the Project would
impact the mudflats, and by extension, fish densities.
NMFS expressed concern that WSE was the only metric being used to address impacts to
fish densities. AEA explained that data from several other studies will be used in the beluga
whale assessment including geomorphology, water quality and instream flow studies. AEA
reminded NMFS about the Interdependency figures that are included in the RSPs and were
presented at the Technical Workgroup Meeting in October.
NMFS acknowledged that they understood the concept behind the WSE model, but it is not
the responsibility of NMFS to determine which methods AEA should use during their
baseline studies.
Passive Acoustic Monitoring (PAM)
Mark asked to revisit the topic of using PAM in combination with aerial and live-feed video
studies to collect information on CIBW presence in the delta and behavior.
AEA explained that PAM has been considered as a method to document CIBWs. However,
as previously discussed, several factors would limit the efficacy of an acoustic array,
including sufficient range/coverage of the survey area, high in-water noise, and, most
importantly, a high probability of false negatives regarding presence of whales.
AEA believes that the data collected through aerial surveys and video studies are sufficient to
document the distribution, movement patterns and behavior of CIBWs in the delta to
effectively assess potential Project impacts.
AEA requested literature from ADF&G pertaining to PAM being used to document behavior,
in particular feeding behavior.
Miscellaneous
Mandy informed the group that recent NMFS ESA training has advised personnel that during
the Section 7 consultation process, it is the applicants’ responsibility to prove that the Project
will not jeopardize the conservation and/or recovery of CIBWs rather than NMFS deciding
whether there is jeopardy or not.
Version November 2, 2012 Page 3
There was a brief discussion on what would be considered “significant” impacts to CIBWs.
The group collectively decided that this would be difficult to determine prior to collecting
and analyzing the baseline data. AEA and NMFS agreed to keep an open dialogue about
significance throughout the baseline studies and impact analyses.
Agenda_Beluga_Eulachon-20121102.docx
Agenda and Schedule
Beluga and Eulachon Meeting
Agency Meeting
November 2, 2012
LOCATION: Alaska Energy Authority– Aspen Room
813 West Northern Lights Blvd.
Anchorage, AK 99503
TIME: 10:00 am – 11:00 am (AKDT)
SUBJECT: Beluga Whales and Eulachon Revised Study Plans
GoTo MEETING: https://www2.gotomeeting.com/join/688012946
Call-in number: 1-800-315-6338 Code# 3957
Agenda Items
Beluga Whale - Impact Assessment
Habitat
Forage Fish Abundance
Eulachon Study
Overview
Water Levels
Modeling Water Levels
Susitna-Watana Hydro Project
Cook Inlet Beluga Whale and Eulachon
Revised Study Plans
November 2, 2012
Goals of this Meeting
Describe and seek input on modified approaches to parts
of the RSPs for Cook Inlet beluga whales (CIBW) and
eulachon
Obtain agreement in principle on the approach to provide
information for the impact assessment
Approach to Impact Assessment
Principal Constituent Elements (PCEs) for CIBW that may
be affected by the Project:
1.Tidal flats of salmon bearing rivers for feeding on salmon and
forage fish
2.Forage, including eulachon and juvenile and adult salmon
Mechanisms to affect PCEs and the recovery of CIBW
1.Physically alter habitats to negatively affect CIBW foraging
success
2.Alter the abundance of forage fish by changing habitat
Physically Altering Foraging Habitat
What are the changes in the physical features of the
foraging habitat in the lower river and adjacent Susitna
mudflats due to Project operations?
Baseline information
Characterize Project effects on daily and seasonal
water levels in the lower river and adjacent mudflats
Altering Abundance of Forage Fish
Salmon: Effects on adult and juvenile salmon are being
addressed via numerous studies in the upper, middle,
and lower river
Potential project effects on eulachon:
Alters access to spawning habitat
1.Stage height and water velocity
- Ability to reach spawning habitat; timing of access
Alters spawning success and subsequent recruitment
2.Reduce quality and quantity of spawning and incubation
habitat
Eulachon Baseline Study
Characterize the timing and distribution of eulachon migration,
spawning, and incubation
This feeds into the impact analysis via predicting Project impacts on
eulachon recruitment from the Susitna River (i.e., abundance)
Will the Project significantly* reduce or increase quantity and quality
of spawning habitat, and thereby eulachon abundance?
•Eulachon work documents current eulachon spawning distribution
and the key habitat features potentially affected by the Project
(depth, velocity, substrate)
•MWE model predicts changes in stage height and velocity
(access, habitat quantity, incubation success)
Model the Effect on Water Levels
•The model must be predictive of daily and seasonal water levels over the
range of possible instream flow alternatives under Project operation;
•The model must be predictive of water levels under Project operation
accounting for the temporal and spatial complexities and interaction of tide
and discharge in the lower Susitna River and estuary;
•The model must be based on empirical, site specific data;
•The model must extend up the Susitna River to the upper limit of tidal
effect;
•The model will not only predict changes in channel depth, but other
hydraulic parameters such as channel wetted width and water depth over
substrate types that may be important to eulachon migration, spawning,
and incubation.
Example Discharge/Tidal Hydrodynamics from Skagit River Estuary Study
(this location was at the lower end of the estuary)
Example Model Output from Skagit River Estuary Study
How the WSE approach affects RSPs
Change: Characterize effect on foraging habitat in CIBW study
plan and eliminate Objective 3 in eulachon study plan.
•In the Eulachon PSP, we had planned to estimate eulachon spawning
ground density as an indicator of forage density.
•In the CIBW RSP, we added a way to directly assess effects on
habitat in the CIBW forage zone.
•We thus removed the Eulachon density in spawning habitat
(Objective 3) from the Eulachon RSP.
•The Eulachon RSP focuses on delineating and characterizing
spawning habitat, the value of which is greater by the addition of the
forage habitat objective to the CIBW RSP.
Significantly affect habitat, eulachon, and CIBW
recovery?
From a study design and analysis perspective, it is
important to clarify that we are attempting to
characterize a reasonably large effect on beluga forage
fish abundance and availability
Two Key Assumptions
1.A forage fish with significant inter-annual and inter-
decadal variability
2.A schooling fish and therefore effects on predation
success will not linearly decline with fish abundance
(may be able to test with data collected)
“Significance of Effect”
1. Power to detect an effect.
Impossible to accurately predict small effects on
eulachon abundance (technically infeasibility).
2. More importantly, we are interested in a meaningful
effect on the recovery of CIBW (jeopardy)
What effect on Eulachon abundance might have a
significant effect on CIBW?
Not 5-15%
Probably on the order of 20-30% or more?
Project
Impacts to
CIBW?
Flow regulation at
RM 180
May through July
Alter CIBW
foraging success
Water Surface Elevation
modeling (WSE) to
quantify how foraging
habitat changes
Alter abundance of forage fish
(eulachon and salmon)
Eulachon:
Characterize timing,
spawning
distribution, and
habitat
Salmon:
Numerous studies in
upper, middle, and
lower river
APPENDIX 4
INFORMAL CONSULTATION DOCUMENTATION
GENERAL / GLOBAL
EMAIL RECORD
Record of Email Page 1 of 3
From: Klein, Joseph P (DFG) [mailto:joe.klein@alaska.gov]
Sent: Thursday, September 06, 2012 1:58 PM
To: Betsy McGregor
Subject: RE: Follow up Meeting Notes-additional comments
Betsy- Per a follow up to our River Productivity comment below, we wish to revise our statement to read:
We support the effort to provide a means to evaluate future changes in the Susitna River under different
operation scenarios and also recommend identifying a reference reach in a similar Alaska river for using a BACI
design monitoring program to assess post project impacts.
Regards, Joe
From: Klein, Joseph P (DFG)
Sent: Thursday, August 23, 2012 2:48 PM
To: McGregor, Elizabeth A (AIDEA)
Cc: Benkert, Ronald C (DFG); Burch, Mark E (DFG); Erickson, Jack W (DFG); Fair, Lowell F (DFG); Fink, Mark J
(DFG); Giefer, Joe (DFG); Haught, Stormy B (DFG); Holen, Davin L (DFG); King, Kimberly N (DFG); Miller,
Monte D (DFG); Michael_Buntjer@fws.gov; Betsy_McCracken@fws.gov; Eric Rothwell
(Eric.Rothwell@noaa.gov); Hill, Melissa E (DNR); Schwarz, Terence C (DNR); Sager, Kimberly R (DNR); Ashton,
William S (DEC)
Subject: RE: Follow up Meeting Notes-additional comments
Following are additional comments
Baseline Water Quality
5.5.4.3.2 In-Situ Water Quality Sampling The sampling protocol currently calls for monthly in-situ water
quality monitoring for the 4 summer months. It should be revised to include continuous (hourly or so) water
quality measurements for basic parameters (pH, DO, conductivity, turbidity), year-round if possible using in-situ
semi-permanent sensors (e.g. sondes). The technology is readily available and would provide very useful
baseline information to assess any post project impacts.
River Productivity
7.8.4.4 Conduct a literature/data search to identify existing river systems that could act as surrogates in
evaluating future changes to productivity in the Susitna River. We recommend supplementing or
substituting this section using a reference reach in a similar Alaska river using a BACI design monitoring
program in order to assess post project impacts.
From: Klein, Joseph P (DFG)
Sent: Thursday, August 23, 2012 10:42 AM
To: McGregor, Elizabeth A (AIDEA)
Cc: Benkert, Ronald C (DFG); Burch, Mark E (DFG); Erickson, Jack W (DFG); Fair, Lowell F (DFG); Fink, Mark J
(DFG); Giefer, Joe (DFG); Haught, Stormy B (DFG); Holen, Davin L (DFG); King, Kimberly N (DFG); Miller,
Monte D (DFG); Michael_Buntjer@fws.gov; Betsy_McCracken@fws.gov; Eric Rothwell
(Eric.Rothwell@noaa.gov); Hill, Melissa E (DNR); Schwarz, Terence C (DNR); Sager, Kimberly R (DNR); Ashton,
William S (DEC)
Subject: Follow up Meeting Notes
Betsy-
Thank you for the opportunity to discuss the proposed study plans for the Susitna-Watana Hydroelectric project.
We look to further discussions to continue to clarify study plan details.
EMAIL RECORD
Record of Email Page 2 of 3
To assist in you and your consultants in this process, below are brief notes by ADF&G staff. We may have
additional comments/or clarifications. Please feel free to contact me if you have any questions.
Regards, Joe
Fish Distribution and abundance in Upper, Middle and Lower Susitna River
Trot lines should considered during the winter to target appropriate fish species.
Minnow trapping under ice should be used during the winter, in all habitat types.
Should evaluate the feasibility of under ice videography.
Salmon Escapement
Identify locations of adult fish weir locations described on tributary streams (7.7.4.1.5, page 7-39).
Consider placement of adult fish weir upstream of the proposed dam on prominent Chinook salmon
streams.
Instream Flow
What is the sampling strategy (e.g. representative reach, mesohabitat typing) for the defined habitat
types?
How many and at what range will discharge-calibration sets be collected for each sampling method?
Will 2D modeling include side channels and sloughs within study area?
o Based on comments at the meeting it was my understanding it would.
What criteria will be used to identify cover types and substrate sizes?
For PHABSIM, will transects be independent, dependent or a combination and accordingly, what WSE
models and composite suitability index will be used?
What criteria will be used to select and weight transect-derived models?
Per the description of study sites for fish passage/off-channel connectivity (§6.5.4.5.5), what criteria
will be used to identify "a representative number" of different habitat types?
HSI data is needed for identified target species for each defined habitat type, over 2 years.
How will the data be aggregated to evaluate single flow recommendation?
Will a DSS-type program be available to review study results and if so, information is needed on it.
How do you envision the "collaborative process" will work? When will major decisions be made (e.g.
site and transect selections) and how often do you envision the work group will get together?
What equipment will be used and how will they be calibrated?
For the eulachon and boating studies, similar information is needed on what is the study area, what
sampling strategy will be used, how many and what range of calibration-discharge sets if appropriate,
and how will HSI curves will be developed?
Varial zone modeling, may need more defined time steps during analysis phase (possibly down to 15-
minute increments) depending on the rate of flow change over time.
Groundwater
What are the monitoring well placement sampling approach (e.g. equal spacing along linear transects,
etc.) and location (e.g. for instream flow, in all habitat types?) for the various resource studies (i.e.
EMAIL RECORD
Record of Email Page 3 of 3
instream flow, riparian instream flow, water quality). Also, a description of sampling intensity would
be helpful (i.e. for instream flow purposes, will the objective be to characterize entire gw/sw
interaction throughout entire intensive study site or only at select microhabitats).
What is the duration for monitoring (I believe at the meeting it would be from installation until winter
2013-14?)
How often will monitoring wells be calibrated for various parameters to be sampled pre- post- and
during field monitoring?
For each resource discipline, what parameters will be sampled and what are range of accuracies (e.g.
for water level +/- 0.1 ft?, water temp +/- 0.2 C?, etc.).
Water Quality
Information on availability of the Sampling and Analysis Plan and Quality Assurance Project Plan is
needed.
GW Quality in Selected Habitats (Section 5.5.4.7) - need more information on study. For example,
sampling intensity/number of site measurements per slough or criteria for how they will be
determined. Will ground water level monitors be installed if so, what is the sampling intensity
(numbers per habitat type) and duration of monitoring (e.g. continuous year-round/ point samples
during field visits, etc.). If not, it is strongly recommended groundwater monitoring be performed
concurrently with water quality monitoring in this study.
Any monitors should be calibrated pre- and post-monitoring along with multiple field measurements
for post monitoring calibration.
EMAIL RECORD
Record of Email Page 1 of 6
From: Betsy_McCracken@fws.gov [mailto:Betsy_McCracken@fws.gov]
Sent: Friday, September 07, 2012 4:02 PM
To: Betsy McGregor
Cc: Bryan Carey; 'Fullerton, Bill'; Betsy McGregor; Bob_Henszey@fws.gov; eric Rothwell; 'Klein, Joseph P
(DFG)'; 'Kevin Fetherston'; 'Matthew LaCroix'; 'Laura Arendall'; 'Mike Buntjer'; 'MaryLou Keefe'; 'Michael R. Lilly,
GW Scientific'; PHilgert@r2usa.com; rob.plotnikoff@tetratech.com; 'Benkert, Ronald C (DFG)'; susan walker;
'William Rice'; matt.cutlip@ferc.gov; Lori_Verbrugge@fws.gov; Catherine_Berg@fws.gov;
Jennifer_Spegon@fws.gov; dreiser@r2usa.com
Subject: Follow up comments from August 15-17 ILP meetings
Hi Betsy,
Thank you and AEA for hosting the August ILP meetings. We all gained a lot of insight from the meetings, and
we were pleased to be updated. Like others, as a result of the meetings, the Service has a few comments and
concerns to share with the group.
In addition to these below, other staff from the Service may provide comments relative to their study area
expertise. We hope that our collective comments will be helpful toward gaining concurrence on proposed
studies, and as we move forward with the review process of the proposed Watana dam.
Thank you,
Betsy
_________________________________________________________________________________________
_________________________________
September 7, 2012
Notes from ILP Formal Study Meetings August 15-17, 2012:
At the request of AEA and its consultants, the USFWS (Service) submits this brief summary of concerns
regarding the Susitna-Watana hydropower dam formal ILP Formal Study meetings that were held August 16-17,
2012. The Service’s concerns in this informal correspondence, along with other remaining concerns will be
further articulated in the Service’s formal response letter on AEA’s ILP Proposed Study Plan (PSP) review, due
to FERC October 15, 2012. Additional informal comments from the Service may be provided under separate
cover before the October due date.
FWS concerns highlighted during meetings relative to Instream Flow, Habitat Utilization and the
Geomorphology proposed study plans:
Overall, the Service finds that AEA’s proposed study plans for instream flow, habitat utilization and
geomorphology do not fully address agency’s resource management concerns. During the three days of ILP
study meetings, sequencing and integration of the proposed biological resource studies and the physical
process studies was not described and is still a significant outstanding information need. It is necessary to
describe the integration of these inter-related studies and how that integration will result in a comparison of the
baseline biological information and the resulting effects to biologic resources caused by the proposed project
operations. Study results must be quantifiable in order to assess potential losses to aquatic resources and their
habitats, to review the project under our relevant fish and wildlife resource conservation authorities, to inform
fishway prescription authority under Section 18 of the Federal Power Act, and to eventually develop
recommended protection, mitigation, and enhancement for the project license. We do not believe that the
current study plan proposals will yield sufficient information to allow us to adequately assess proposed project
impacts to the Nation’s fish and wildlife resources and develop adequate PME’s.
EMAIL RECORD
Record of Email Page 2 of 6
The Service has repeatedly articulated concerns about the lack of study sequencing, connectivity and
integration between the biological studies and the other proposed engineering and physical processes studies.
We reiterate and highlight the need for the collection of adequate temporal and spatial baseline biological and
fish habitat data to provide direct input to some of the proposed physical modeling efforts. Many of our
concerns, below, are related to the temporal mismatch of biological data collection with the forward momentum
of the physical modeling efforts.
-Habitat Mapping
Hierarchially-nested aquatic habitats- HDR stated at the meeting that the “habitat mapping” will be started in
September; and that the sampling will be stratified by meso-habitat type as identified in the 1980’s study reports.
The 1980’s studies did not hierarchically nest the habitat types. The Service specifically requested hierarchially
nested habitat mapping (e.g., Frissel et al, 1986). We are concerned with the proposal to use the 1980’s study
sites, which focus on the side sloughs, and do not consider the full breadth of fish habitats, which is currently
unknown and the subject of ongoing study that has not been completed or submitted for agency review and
comment. We do not endorse the use of the 1980’s sites without out first completing and then applying a
hierarchal assessment of the river reaches as a study framework. The hierarchally nested aquatic habitats
framework is needed to structure fish distribution surveys, the instream flow study and other physical process
studies. Without it, the fish surveys will be too narrowly constrained and the instream flow studies will not
represent all habitats that may be affected by the proposed project. The Service recommends the following
habitat hierarchy for the Susitna River be used for habitat mapping purposes and integration of studies:
Large River Floodplain Habitat Hierarchy
1. Geomorphic units: Large-scale geomorphic and hydraulic controls.
a. Bedrock controlled, single-channel units with shallow hyporheic exchange and thermal homogeneity.
b. Unconfined, multiple channel floodplain units with expansive hyporheic exchange and thermal
heterogeneity.
2. Macrohabitats: Primary, flood, and spring channel networks.
a. Primary channels—Perennial channels.
b. Flood channels—Seasonally connected channels.
c. Spring channels—Disconnected sloughs that discharge groundwater.
d. Floodplain ponds—Ponded spring channel networks.
3. Mesohabitats: Bed and bank morphological controls; hydraulic features.
a. Riffle-pool sequences—Run, riffle, pool, glide, tailout.
b. Backwaters, alcoves, shallow meander margins.
4. Microhabitats: Hydraulics, water quality, substrate, cover.
a. Water depth, velocity, bulk flow characteristics (e.g. Reynolds and Froude #’s).
b. Vertical hydraulic exchange (ground and surface water exchange).
c. Bed, or intragravel temperature and dissolved oxygen.
d. Substrate size, heterogeneity.
EMAIL RECORD
Record of Email Page 3 of 6
e. Elements of wood, vegetation, and rock structure.
-Fish distribution: A first step is to assess the seasonal distributions of target species and life stages and the
physical habitat criteria that influence habitat selection and suitability. As a first step, target species have to be
identified, agreed upon, and their life history and habitat use similarities to other, unstudied species (i.e., non-
target species) need to be determined and described. In the study requests of the Service and other agencies,
we recommended studying the baselines of all affected fish species and life stages, including all five species of
anadromous salmon and all resident fish.
Fish distribution data are needed to describe the baseline data to support and compliment other proposed study
objectives, including those related to fish habitat selection and utilization. A first step to acquiring adequate fish
distribution is to assess the full lateral and longitudinal profile of seasonal fish distribution, life stage periodicity,
and suitable used and unused habitats that are influential in fish habitat site selection. The fish distribution data
is needed to provide the base data layer that will support and compliment other proposed study objectives,
including those related to fish habitat selection and utilization, and instream flow (ISF) needs. This information
is also needed for resource agencies’ fishway prescription decisions under the Federal Power Act. Baseline
biological information is critical input necessary for integration with physical studies. Accordingly, the Service is
reiterating the need for multiple and continuous years of biologically relevant data in order to provide robust
integration with the physical modeling studies, and decision-support relative to fish and wildlife resources of the
Susitna River basin.
-Habitat site selection criteria: Criteria that influence habitat selection and suitability need to be identified
using statistically powerful and robust methods and current models of fish distribution including bioenergetics
and not exclusively physical habitat models (Lovtang 2005). The Service remains opposed to the proposal to
repeat the 1980’s approaches to fisheries studies. The 1980’s studies do not determine the habitat criteria
influencing fish habitat site-selection, they simply report utilization functions for water depth and velocity, or
depth and substrate. They also lack a fundamental baseline assessment of all available fish habitat and instead
focus on study of habitats that had high fish use density. The habitats that were apparently suitable but
unoccupied or underutilized by fish need to be assessed, and the entire range of habitat availability and habitat
use data need to be assessed prior to habitat study site selection.
More comprehensive data collected on nearby glacial rivers may be used to demonstrate that habitat selection
by salmon in side-sloughs can be independent of water depth and velocity and should be compiled.
Fish habitat study sites should be surveyed and identified using the full range of habitats seasonally utilized by
agreed-upon target species and life stages. The objective is to identify the bioenergetics and physical factors
that control fish habitat selection. The Service considers the assessment of habitat influential to fish habitat site
selection to be an objective of the Instream Flow and Habitat Utilization Study request. In the resource agencies
Instream Flow and Habitat Utilization Study Plan requests, this is a specifically stated objective.
Sequentially, appropriate flow-habitat models can be selected after assessment and validation of 1) the full
seasonal distribution of target species and life stages,2) the physical factors (e.g., micro-habitat data) that
influence habitat selection and suitability, and 3) the bioenergetic factors affecting fish habitat suitability and
productivity.
Thus, field visits proposed for the end of September (2012) should be considered as reconnaissance and for
discussion purposes, and not for the purpose of actual study site-selection.
-Habitat Suitability Indices: Methods for collecting site-specific habitat criteria for the glacial Susitna River
need to be collaboratively identified. (As recommended in the resource agencies study plan request for Instream
Flow and Habitat Utilization). These criteria also need to be evaluated in the context of the hierarchical habitat
model, such that habitat criteria are determined and evaluated in all habitats of importance to each agreed-upon
target species and life stage.
The 1980’s studies were inconclusive in demonstrating a relationship between fish habitat criteria and fish
distribution, and they were also narrowly focused on associations of spawning and rearing salmon with water
EMAIL RECORD
Record of Email Page 4 of 6
depth and velocity in spring channels (side sloughs). Not only is this not representative of existing habitat and
the distribution of fish within those habitats, habitat data collected from nearby glacial rivers demonstrates that
spawning habitats selection is independent of flow depth and velocity in side sloughs and may be profoundly
influenced by bioenergetics and the input of organic matter .
This indicates that traditional hydraulic modeling (e.g., PHABSIM), as proposed, may be an insufficient fish
focus/tool. So, first we need to identify criteria that are influential to habitat selection, within the full seasonal
distributions of agreed-upon target species and life stages. Only then, after this has been adequately
determined, can we begin to develop utilization functions (curves or HSC) for those criteria.
The Service has previously expressed concern with the approach of repeating the 1980’s study effort, and we
have repeatedly asked for both a complete compilation of available data, and a review of the 1980’s information
prior to accepting its use for the proposed project. Lacking that review, we independently note that, in the
1980’s sites were selected that were, presumably, heavily utilized by spawning sockeye and chum (qualitative).
Study sites need to be based on relevant criteria related to physical habitat site selection as documented by fish
distribution and lack thereof.
-Groundwater- The integration of the groundwater study efforts with the biological studies is not clear.
Specifically, how will the groundwater study be made relevant to the scale of fish habitat and fish habitat site
selection in the Susitna River? The objectives of the groundwater study should include relevance to the
hierarchially nested habitats, including macro-, meso-, and micro-habitats that are influential to fish habitat
selection. The groundwater study sampling design should be relevant to fish habitat and site selection. A
specific objective needs to be measuring the hydraulic gradient/head (upwelling or downwelling) under the
existing hydrograph and under the proposed project hydrograph release flow schedule.
-Model selection: We need to first determine what criteria are important to fish habitat site/suitability and
selection before we can choose an appropriate flow-habitat model. ADFG Marine Mammals biologist, Dr. Bob
Small also reiterated this very same point regarding model selection for the beluga whale studies. Again, the
Service notes our concern about the limited focus of the 1980’s studies and using PHABSIM. Our concerns
stated in earlier correspondence to AEA remain unaddressed and are reiterated here for emphasis.
Model sensitivity and relevant criteria (inputs) are critical to achieving statistically valid outputs. At this point, it is
premature to select a model until we have known 1) fish distribution, and 2) identification of variables influential
to fish habitat site selection.
-Biometric Review- The Service previously requested a biometric review of the 1980’s findings. This request is
remains outstanding and should be conducted prior to basing any study plans on 1980’s studies or results. In all
cases, including the usage of the 1980’s Su-hydro data results and for the Susitna-Watana study plans,
estimates of precision and accuracy of study results is required to evaluate the power of any study plan. Details
of proposed study plan sampling and design methods need to be explicit and statistically valid with a priori
determination of levels of precision and accuracy of model outputs.
-Fish genetics- During the August 15-17 meetings, AEA stated that genetic samples from the Chinook above
the proposed dam site would not be collected. The stated rationale was due to the desire to minimize the
handling of the fish after subsequent tagging of fish. Genetic samples of Chinook at locations above the
proposed Susitna-Watana dam site are crucial to informing the Service’s management goals specific to
recommending licensing conditions under the Federal Power Act, and to conservation recommendations under
the Fish and Wildlife Coordination Act, and the Anadromous Fish Act. As such, we consider our request for
collection of genetic samples from Chinook salmon, and other fish species to be necessary for our resource
evaluation of the Susitna-Watana hydropower project.
Because of this information need, if AEA does not plan to collect the information, AEA should document how
this study request is being addressed.
Fish species genetic samples used for comparisons should be less than ten years old to reflect current gene
frequencies among the sampled fish populations. Genetic samples for salmon exist for some tributaries in the
EMAIL RECORD
Record of Email Page 5 of 6
lower and middle Susitna River. Some of these samples are greater than ten years old.
Fish genetic samples should be current and include samples of the Chinook migrating above the proposed dam
location. Because gene frequencies change over time, all genetic samples should be within the most recent ten
years to allow for valid comparison. Genetic analysis should analyze the existing extent of genetic differentiation
within and between fish using distinctly different habitats. We request genetic analysis of Chinook above the
proposed dam site relative to those at other upper, middle and lower river and tributary sample locations.
-Fish Passage/fishway prescription- The Service is concerned with the lack of transparent discussion about
the potential for fish passage alternatives at the proposed Susitna-Watana dam. If fish passage is required, how
will that be accomplished? If it is not feasible, what is your alternative proposal? Where is your project
assessment of the fish passage feasibility? What are the design criteria being considered/evaluated?
-Compensatory Mitigation- Compensatory mitigation is determined as part of a mitigation sequence after
avoidance, and minimization efforts. The Service has inquired about potential compensatory mitigation for
project impacts during several meetings. To date, this concern has not satisfactorily been addressed by the
project sponsors or project consultants. Because compensatory mitigation is a requirement in order to offset
unavoidable projects impacts to fish and wildlife resources and their habitats, it is should be considered
throughout the review process. Please explain how you plan to quantify existing habitats, and quantify primary,
secondary and cumulative (40cfr Part230 of the CWA) losses to those habitats under the proposed operational
flows over the temporal scale of the license period. How will habitats change proportionally under project
operations?
-Lower river- The Service is concerned with AEA consultants’ proposal to establish a lower boundary for the
physical studies (e.g., geomorphology, instream flow) at a location “downstream of Sunshine” at approximately
river mile 75, and not extend the study efforts further down into lower river to inform the biological studies. There
are many biological resource studies that would necessarily be informed by establishing a consistent study
boundary between the physical and biological studies. For example, studies related to the federally listed Cook
Inlet beluga whale, fish species and habitats, including the resident species, and anadromous salmon and
eulachon (beluga whale prey species). The lower river also includes the Susitna Flats State Game Refuge. If the
physical studies boundary is terminated at river mile 75, there will be no ability to relate or integrate biological
data to those studies (e.g., geomorphology, ISF, ice processes, flow routing). Resource agencies management
goals would effectively not be addressed below river mile 75, if project effects are not assessed to the mouth of
the river.
According to USACE (1966), 80% of the ability to produce accurate model results depends on using
appropriate bathymetry data, mesh design, and boundary conditions. The amount of time needed to collect this
information, particularly the bathymetry data, depends on the complexity of the channel’s geometry, which is
known to be complex in the lower Susitna River. Because data collection in the lower river will likely require
rigorous field collection due to the channel complexity, it is critical to initiate these efforts in a time sensitive
manner. The proposal to delay work in the lower river pending analysis at an arbitrary, and certainly non-
biologically relevant location, does not meet resource agencies objective of evaluating the potential project
impacts to fish and wildlife resources in the lower Susitna River. This is particularly true under the FERC ILP
process timeline specific to the Susitna-Watana dam project.
-Studies integration: A “map” or chart of how studies are proposed to be integrated is needed. AEA sponsors
and consultants, committed to providing this by September. Biological resource components are currently not
integrated or connected to the other studies, and appear as being treated independently of the rest of the study
requests. Study proposals must demonstrate how they will be integrated to provide needed resource
information.
Studies/components not address from the Non salmon anadromous, resident and invasives fish species
study request: During the August ILP meetings, the follow Service requests were preliminarily noted as not
being addressed or adequately addressed by AEA’s PSPs.
EMAIL RECORD
Record of Email Page 6 of 6
1) Marine derived nutrients contribution from non salmon anadromous species. The Service requested
information in our non-salmon anadromous, resident and invasive study plan request. It is not clear which study
proposal it is addressing this request, or IF it is being addressed. During the August 15-17 meetings, it was
indicated that it may be addressed in either the riparian instream flow, the terrestrial wildlife, the river
productivity or elsewhere. However, AEA’ s consultants were unable to specifically “point to it” when asked. It
does not appear to have been included in the PSPs.
2) Resource valuation of non-salmon anadromous and resident fish resources. During the meeting, AEA
consultants stated that a resource valuation would not be provided, as requested in the Service’s study request
for non salmon anadromous, resident and invasive fish study. An explanation of why this assessment will not be
addressed was not provided. We request that an explanation be provided that describes the rationale for this
determination and urge reconsideration of our study request.
3) Trophic ecology- The Service requested information on trophic ecology in the non salmon anadromous,
resident and invasive species study request. Michael Link stated that there are “significant predator-prey
dynamics” particular once fish move out of the mainstem; using this behavior to explain why fish hold there until
they are ready to dash to tributaries. He noted that the creeks are heavily preyed upon by bears, for example.
Dr. Bob Small (ADFG) recommended trophic ecology and/or foraging ecology information for the Cook Inlet
beluga whale studies. For fish, coordination with Tim Nightengale (AEA’s consultant; via teleconference) stated
that he would take gut samples from fish to see what macro-invertebrates they are eating, and when, and will
work with fish study teams to do some trophic analysis. The trophic ecology component needs to be clearly
spelled out in a study plan identifying any aspects that will and will not be addressed explained and with
appropriate rationale.
References:
Frissell, C. A., W. J. Liss, C. E. Warren, and M. D. Hurley. 1986. A hierarchical framework for stream habitat
classification: viewing streams in a watershed context. Environmental Management 10:2. Pp. 199-214.
Lovtang, J. C. 2005. Distribution, habitat use, and growth of juvenile Chinook salmon in the Metolius River
Basin, Oregon. M.S. Thesis, Oregon State University. March 2005.
USACE 1966. (Full citation will be provided in follow-up correspondence)
Betsy W. McCracken
Fishery Biologist
Conservation Planning Assistance
Ecological Services
US Fish and Wildlife Service/Region 7/Anchorage Field Office
Betsy_McCracken@fws.gov
(907) 271 - 2783
EMAIL RECORD
Record of Email Page 1 of 4
From: Bob_Henszey@fws.gov [mailto:Bob_Henszey@fws.gov]
Sent: Tuesday, September 11, 2012 12:26 PM
To: 'Kevin Fetherston'; Betsy McGregor
Cc: Catherine_Berg@fws.gov; Ann_Rappoport@fws.gov; Betsy_McCracken@fws.gov;
Jennifer_Spegon@fws.gov; Lori_Verbrugge@fws.gov; Michael_Buntjer@fws.gov; chiska.derr@noaa.gov; Klein,
Joseph P (DFG); 'Matthew LaCroix'; 'Michael R. Lilly, GW Scientific'; eric Rothwell; susan walker; 'William Rice';
matt.cutlip@ferc.gov; dreiser@r2usa.com
Subject: PSP 6.6 Riparian Instream Flow Study Plan - Interim Comments
Kevin,
The following are some of the key differences the USFWS sees between our study plan request (USFWS 10.1,
Instream Flows for Floodplain and Riparian Vegetation Study) and AEA's proposed study plan (PSP 6.6,
Riparian Instream Flow Study). The differences and comments listed below are likely not inclusive, since we
have not had a chance to fully evaluate the PSP.
Many of the PSPs rely upon or provide data from/for other studies. Recognizing these relationships is an
important part of the Integrated Licensing Process (ILP); however, the study providing the data should describe
the methodology and oversee the data collection and analyses, while the study requiring the results should
restrict its discussion to the types of data/results required from other PSPs. Repeating the methods in a study
not responsible for the data collection and analyses is unnecessary and risks confusion if the methods differ or
are inadequate in one of the studies. Since the Riparian Instream Flow PSP will rely upon data from the
Groundwater PSP, the Riparian Instream Flow PSP should describe only the results required from the
Groundwater PSP, and then describe how those results will be used in the Riparian Instream Flow PSP (e.g.,
5.7 Groundwater PSP should be the only PSP that describes the groundwater methods). This applies to other
PSPs, such as the habitat mapping studies that may be providing data for this PSP.
Study Goals and Objectives: The USFWS requested a specific goal that included quantifying the frequency,
timing and duration of surface-water and groundwater levels required to establish, maintain, and promote
floodplain and riparian plant communities. Two ancillary goals were also requested to quantify the frequency
and rate of sediment deposition required to promote soil development, and to quantify the effect of river ice on
the establishment and persistence of riparian plant communities. Section 6.6.1.1 of the PSP has no stated goal,
and only a general approach is provided. An "overarching goal" is provided in the Section 6.6.4 Study Methods,
but this goal is also very general. While goals can be very general in nature, the specifics in our goal set the
stage for a rigorous study plan to evaluate potential project-related effects on floodplain plant communities.
The USFWS requested six objectives to help meet our goal. Three of the PSP objectives are similar to our
requests {1) Synthesize 1980s data, 2) Study sites, and 6) Seed dispersal}, but they lack the additional specifics
stated in our requested objectives. Two of the PSP objectives appear to be wholly or at least partially the
objectives for other PSPs and not appropriate as stated {3) Map riparian vegetation, and 10) Impacts to shallow
groundwater well users}. What the PSP objectives lack, however, are our specific requests for river ice,
sediment deposition, and water-level regime (USFWS Objectives 4, 5, and 6). These missing objectives may be
studied under AEA’s PSP objectives, but the USFWS prefers they be considered as standalone objectives, and
possibly integrated into a single modeling objective after they have been studied individually. The USFWS is
particularly interested in our Objective 6 to characterize the water-level regime required to maintain floodplain
and riparian plant communities. Much of the discussion so far has focused on floodplain plant succession, but
little or no discussion so far has involved maintenance flows. Succession is important, but without maintenance
flows whole floodplain plant communities may collapse or the direction of succession changed to an unnatural
target (e.g., non-floodplain plant communities).
Study Area: The USFWS agrees with the PSP study area and four river segments, with the following additional
comments. The width of the active valley should also include the distance from the River that the River
influences groundwater, as well as define the return interval for both groundwater and flooding (e.g., 100-year
event under current or climate-change induced conditions). Much discussion has centered on the downstream
EMAIL RECORD
Record of Email Page 2 of 4
influence of the Project. The PSP study area Lower Reach would extend to RM 0. Will this lower extent remain
even if all agree that the Project influence on surface- and ground-water becomes indistinguishable from normal
environmental variation?
Study Methods: The methods need to follow the order of the objectives and use section headings that refer to
the intent of the objectives. Few methods are referenced, and some references that are cited are not included
in the literature cited. The relationship with other PSPs often seems confusing. It would be more helpful to state
what results will be required from PSP "x" to evaluate a Riparian ISF objective, and potentially what results from
a Riparian ISF objective will be required by PSP "y." It is not necessary to repeat coordination for every
objective, only state the inputs required and the outputs provided by an objective. This applies across PSPs
and among a PSP's objectives. The following comments on methods follow the order of the Objectives
requested by the USFWS:
RIFS-1 Synthesize Historical Data: In addition to other North American hydro-projects, this review should also
include a review of relatively undisturbed riverine systems.
RIFS-2 Select and Design Study Sites: The number of study sites should provide sufficient replication to
address the needs of the objectives, and should include sites where Project operation is expected to cause early
channel bed degradation or aggradation. The casual reference to pseudoreplication in one of the other
objectives needs to be addressed at the study-site level. Study sites are typically the experimental unit where
replication is used for true statistical analysis. All other sampling (e.g., within the study site) is really
subsampling used to obtain a better average value for that one replicate. As envisioned by many of the PSPs,
the "representative" study sites are really only one replicate for each process-domain. For more on
pseudoreplication see:
Hurlbert, Stuart H. 1984. Pseudoreplication and the Design of Ecological Field Experiments. Ecological
Monographs 54:187–211. http://dx.doi.org/10.2307/1942661
RISF-3 Characterize Seed Dispersal and Frequency of Establishment: Not sure where this objective is
addressed in the PSP. It appears to be scattered across several sections in the methods. If the methods have
been described by other similar projects, then cite their methods if appropriate and include enough details to
help others understand the methods that will be used. How will the Susitna River bimodal peak flows be
addressed? On a float trip down the Susitna 27-29 July 2012, there were newly emerging dicot seedlings on the
sandbars. How will the fate of these "second peak" seedlings be addressed? How will the role of precipitation
in maintaining favorable soil moisture conditions be evaluated? Will soil texture be considered? If so, how will
the soil profile be described?
In Section 6.6.4.3.1.4: Is "abundance" density or some other metric? What is "elevation" referenced to: ASL,
an arbitrary datum, or some elevation that can be linked to the local river or groundwater stage (keep in mind
the river drops downstream, so that must be accounted for also)? Is there a citation for others using 2-meter
square plots? What is the shape of these plots? A square plot may not be appropriate for a narrow band of
seedlings along a specific elevation in the gradient above the river. MODFLOW is a groundwater model, and
many not be sensitive enough to quantify hydroperiod relationships for seedlings. What other metrics will be
used to quantify/separate surface water, groundwater, soil moisture, precipitation, and other potential
hydrological process that support seedling establishment and recruitment?
How will the results from this objective be used to predict potential Project-related changes in seedling
establishment and recruitment into the population?
RISF-4 Characterize the Role of Ice in the Establishment, Survival and Recruitment of Riparian Species: The
discussion on ice processes (Section 6.6.4.4.1) seems unfocused, and essentially provides no discernible
methods: "Final details of the geomorphology and ice processes modeling ... will be developed as the 2012
studies are obtained." The goal of this study should be to characterize the role of river ice in the establishment
(colonization), survival (first 3 years) and recruitment into the future reproductive population of dominant riparian
species (e.g., balsam poplar, willows). Have others investigated the role of ice on riparian plant communities?
EMAIL RECORD
Record of Email Page 3 of 4
If so, can their methods be used here? How will the magnitude, frequency, and longitudinal distribution of ice
events affecting dominant riparian species/communities be evaluated?
RISF-5 Characterize the Role of Sediment Deposition in the Formation of Soils: The proposed soil sampling
techniques are included in Section 6.6.4.3.1.5, but based on these techniques it is unclear how the USFWS
requested objective to characterize the role of sediment deposition in the formation of floodplain and riparian
soils, and how sediment deposition affects the rate and trajectory of plant community succession. This objective
should investigate the rate of deposition, depth of sediment, and soil profile development required for natural
floodplain plant community succession, and then use the predicted sediment deposition characteristic from the
Fluvial Geomorphology Study to predict the effects of Project operation on floodplain plant communities.
Sampling to only a depth of 50 cm, and describing cumulative thickness of all organic horizons and loess
(windblown material?) without stratigraphy will likely be insufficient to meet this objective. Soil texture by feel
should follow standard techniques (e.g., Thien 1979, http://soils.usda.gov/education/resources/lessons/texture/).
RISF-6 Characterize Water-Level Regime Required to Maintain Floodplain and Riparian Plant Communities:
This is a critical objective that has not been sufficiently discussed in past workgroup meetings, possibly due to
lack of time, and the PSP methods are insufficient to evaluate if the USFWS requested objective will be met.
Suggest this objective be discussed near the beginning of future meetings to allow sufficient time for
discussion.
Objective 6 combines hydrologic information from the groundwater study (PSP 5.7) and the plant community
information from this study (PSP 6.6) and possibly the habitat mapping studies (PSPs 9.6 and 9.7) to produce
plant species/community response curves. The USFWS's Objectives RISF-3 to RISF-5 target critical stages in
plant community succession, while RISF-6 targets critical instream flows required for maintaining plant
communities as succession progresses (i.e., both succession and maintenance are important).
The methods for groundwater belong in the Groundwater PSP, and not in this PSP for reasons discussed
above. This PSP should request the required hydrologic information from PSP 5.7 and begin the discussion
from that point. The following comments, however, include the pertinent groundwater methods that should be
discussed in PSP 5.7.
Section 6.6.4.5 (Groundwater): The suggested four to six intensive study reaches instrumented with
groundwater and surface-water recording instruments may be insufficient to address this objective if plant
response will be described by process-domains (see pseudoreplication discussion above). However, hydrology
is likely the most dominant physical factor required for maintaining floodplain plant communities across the
various process-domains, and baring some other dominant physical factor (e.g., soil parent material, weather,
etc.) it may be possible to use data from the individual intensive study-site transects to build response curves
(see Henszey et al. 2004 {ne.water.usgs.gov/platte/reports/wetlands_24-3.pdf}, Figure 7 for an indication of the
number of data points required to build a response curve).
One-and-a-half growing seasons (July 2013 to September 2014) will likely provide insufficient groundwater
hydrology data to fit individual species response curves (especially for annual species), and may not be enough
data to reasonably predict groundwater relationships with river stage and to verify the model predictions with
independent data. Precipitation may also dramatically affect transient but critical groundwater levels (a few days
to a week or more of elevated water levels), which would be difficult to evaluate with limited data. How will
these potential problems be addressed?
What are the "project accuracy standards used for water-level measurements" for horizontal, vertical and
temporal measurements?
In addition to the Work Products described in Section 6.6.4.5.2, the products should provide water-level
summary statistics for each location (e.g., point, plot, or transect) that will be used to test and fit plant response
curves, such as growing season cumulative frequency, 7-day moving average, 10-day moving average, 14-day
moving average, and arithmetic mean (see Henszey et al. 2004 {ne.water.usgs.gov/platte/reports/wetlands_24-
3.pdf}, Table 1).
EMAIL RECORD
Record of Email Page 4 of 4
Section 6.6.4.7 (Succession Models and Flow Response Guilds) appears to potentially address the USFWS's
Objective 6 request; however, two critical referenced papers (Merritt et al. 2010 and Pearlstine et al. 1985) were
not included in the Literature Cited. These references were not provided until 8/28/2012, and the USFWS has
had insufficient time to review these papers in detail. The concept of the PSP response guilds is similar to the
USFWS's request to develop plant community response curves, but the PSP methods are insufficient to
evaluate if our requested Objective 6 will be met. The USFWS requested evaluating specific water-level
summary statistics (see above discussion for groundwater) with a rigorous curve-fitting technique similar to
Henszey et al. (2004). The methods should provide sufficient detail to show how quantifiable (not qualitative)
hydrologic (surface-water and groundwater) gradients will be constructed to show the optimum and range of
favorable water levels required for maintaining floodplain species/communities.
____________________________________
Robert J. Henszey, Ph.D.
Fish & Wildlife Biologist
Conservation Planning Assistance
US Fish & Wildlife Service
101 12th Avenue, Room 110
Fairbanks, AK 99701
Phone: 907-456-0323, Fax: 907-456-0208
Bob_Henszey@fws.gov
EMAIL RECORD
Record of Email Page 1 of 1
From: Betsy_McCracken@fws.gov [mailto:Betsy_McCracken@fws.gov]
Sent: Tuesday, September 18, 2012 10:16 AM
To: Betsy McGregor
Cc: Bryan Carey; 'Fullerton, Bill'; Bob_Henszey@fws.gov; Catherine_Berg@fws.gov; dreiser@r2usa.com; eric
Rothwell; Jennifer_Spegon@fws.gov; 'Klein, Joseph P (DFG)'; 'Kevin Fetherston'; 'Matthew LaCroix'; 'Laura
Arendall'; Lori_Verbrugge@fws.gov; matt.cutlip@ferc.gov; 'Mike Buntjer'; 'MaryLou Keefe'; 'Michael R. Lilly, GW
Scientific'; PHilgert@r2usa.com; rob.plotnikoff@tetratech.com; 'Benkert, Ronald C (DFG)'; susan walker;
'William Rice'
Subject: Follow up from August and September ILP meetings
Hi Betsy,
Can you please provide a timeline for when resource agencies can expect AEA to provide meeting mintues from
the August and the September ILP TWG meetings? Also, requested is the documentation of how AEA will
address agencies identified descrepancies and concerns related to proposed approaches that were presented
during the meetings. We intend to have follow up related to these outcomes, and need to make concerted
efforts toward this goal. Resource agencies have many outstanding and complex resource concerns yet to
resolve with AEA consultants related to the Susitna River basin resources and their habitats; particularly under
AEA's proposed approaches within the study requests, and would appreciate receipt of the follow-up
information.
NMFS previously requested the August meeting minutes, a few weeks ago. We are following up with this
secondary request, along with the additional request for the September meeting materials.
Thank you,
Betsy
Betsy W. McCracken
Fishery Biologist
Conservation Planning Assistance
Ecological Services
US Fish and Wildlife Service/Region 7/Anchorage Field Office
Betsy_McCracken@fws.gov
(907) 271 - 2783
APPENDIX 4
INFORMAL CONSULTATION DOCUMENTATION
SECTION 5 – WATER QUALITY
EMAIL RECORD
Record of Email Page 1 of 3
From: Klein, Joseph P (DFG) [mailto:joe.klein@alaska.gov]
Sent: Thursday, August 23, 2012 2:48 PM
To: Betsy McGregor
Cc: Benkert, Ronald C (DFG); Burch, Mark E (DFG); Erickson, Jack W (DFG); Fair, Lowell F (DFG); Fink, Mark J
(DFG); Giefer, Joe (DFG); Haught, Stormy B (DFG); Holen, Davin L (DFG); King, Kimberly N (DFG); Miller,
Monte D (DFG); Michael_Buntjer@fws.gov; Betsy_McCracken@fws.gov; eric Rothwell; Hill, Melissa E (DNR);
Schwarz, Terence C (DNR); Sager, Kimberly R (DNR); Ashton, William S (DEC)
Subject: RE: Follow up Meeting Notes-additional comments
Following are additional comments
Baseline Water Quality
5.5.4.3.2 In-Situ Water Quality Sampling The sampling protocol currently calls for monthly in-situ water
quality monitoring for the 4 summer months. It should be revised to include continuous (hourly or so) water
quality measurements for basic parameters (pH, DO, conductivity, turbidity), year-round if possible using in-situ
semi-permanent sensors (e.g. sondes). The technology is readily available and would provide very useful
baseline information to assess any post project impacts.
River Productivity
7.8.4.4 Conduct a literature/data search to identify existing river systems that could act as surrogates in
evaluating future changes to productivity in the Susitna River. We recommend supplementing or
substituting this section using a reference reach in a similar Alaska river using a BACI design monitoring
program in order to assess post project impacts.
From: Klein, Joseph P (DFG)
Sent: Thursday, August 23, 2012 10:42 AM
To: McGregor, Elizabeth A (AIDEA)
Cc: Benkert, Ronald C (DFG); Burch, Mark E (DFG); Erickson, Jack W (DFG); Fair, Lowell F (DFG); Fink, Mark J
(DFG); Giefer, Joe (DFG); Haught, Stormy B (DFG); Holen, Davin L (DFG); King, Kimberly N (DFG); Miller,
Monte D (DFG); Michael_Buntjer@fws.gov; Betsy_McCracken@fws.gov; Eric Rothwell
(Eric.Rothwell@noaa.gov); Hill, Melissa E (DNR); Schwarz, Terence C (DNR); Sager, Kimberly R (DNR); Ashton,
William S (DEC)
Subject: Follow up Meeting Notes
Betsy-
Thank you for the opportunity to discuss the proposed study plans for the Susitna-Watana Hydroelectric project.
We look to further discussions to continue to clarify study plan details.
To assist in you and your consultants in this process, below are brief notes by ADF&G staff. We may have
additional comments/or clarifications. Please feel free to contact me if you have any questions.
Regards, Joe
Fish Distribution and abundance in Upper, Middle and Lower Susitna River
Trot lines should considered during the winter to target appropriate fish species.
Minnow trapping under ice should be used during the winter, in all habitat types.
Should evaluate the feasibility of under ice videography.
EMAIL RECORD
Record of Email Page 2 of 3
Salmon Escapement
Identify locations of adult fish weir locations described on tributary streams (7.7.4.1.5, page 7-39).
Consider placement of adult fish weir upstream of the proposed dam on prominent Chinook salmon
streams.
Instream Flow
What is the sampling strategy (e.g. representative reach, mesohabitat typing) for the defined habitat
types?
How many and at what range will discharge-calibration sets be collected for each sampling method?
Will 2D modeling include side channels and sloughs within study area?
o Based on comments at the meeting it was my understanding it would.
What criteria will be used to identify cover types and substrate sizes?
For PHABSIM, will transects be independent, dependent or a combination and accordingly, what WSE
models and composite suitability index will be used?
What criteria will be used to select and weight transect-derived models?
Per the description of study sites for fish passage/off-channel connectivity (§6.5.4.5.5), what criteria
will be used to identify "a representative number" of different habitat types?
HSI data is needed for identified target species for each defined habitat type, over 2 years.
How will the data be aggregated to evaluate single flow recommendation?
Will a DSS-type program be available to review study results and if so, information is needed on it.
How do you envision the "collaborative process" will work? When will major decisions be made (e.g.
site and transect selections) and how often do you envision the work group will get together?
What equipment will be used and how will they be calibrated?
For the eulachon and boating studies, similar information is needed on what is the study area, what
sampling strategy will be used, how many and what range of calibration-discharge sets if appropriate,
and how will HSI curves will be developed?
Varial zone modeling, may need more defined time steps during analysis phase (possibly down to 15-
minute increments) depending on the rate of flow change over time.
Groundwater
What are the monitoring well placement sampling approach (e.g. equal spacing along linear transects,
etc.) and location (e.g. for instream flow, in all habitat types?) for the various resource studies (i.e.
instream flow, riparian instream flow, water quality). Also, a description of sampling intensity would
be helpful (i.e. for instream flow purposes, will the objective be to characterize entire gw/sw
interaction throughout entire intensive study site or only at select microhabitats).
What is the duration for monitoring (I believe at the meeting it would be from installation until winter
2013-14?)
How often will monitoring wells be calibrated for various parameters to be sampled pre- post- and
during field monitoring?
For each resource discipline, what parameters will be sampled and what are range of accuracies (e.g.
for water level +/- 0.1 ft?, water temp +/- 0.2 C?, etc.).
Water Quality
EMAIL RECORD
Record of Email Page 3 of 3
Information on availability of the Sampling and Analysis Plan and Quality Assurance Project Plan is
needed.
GW Quality in Selected Habitats (Section 5.5.4.7) - need more information on study. For example,
sampling intensity/number of site measurements per slough or criteria for how they will be
determined. Will ground water level monitors be installed if so, what is the sampling intensity
(numbers per habitat type) and duration of monitoring (e.g. continuous year-round/ point samples
during field visits, etc.). If not, it is strongly recommended groundwater monitoring be performed
concurrently with water quality monitoring in this study.
Any monitors should be calibrated pre- and post-monitoring along with multiple field measurements
for post monitoring calibration.
APPENDIX 4
INFORMAL CONSULTATION DOCUMENTATION
SECTION 6 – GEOMORPHOLOGY
NPS Preliminary Comments on Proposed Study Plans for Susitna-
Watana Project
These informal comments focus on the three recreation-related study plans released by AEA on
July 15th 2012, i.e., the Recreation Resources, Aesthetics Resources, and Recreational
Boating/River Access study plans.
Overall Comments
Common to all three PSP’s:
- Gap Analyses/PAD: Contrary to the opening language of the three PSP’s, the Gap
Analyses for Recreation and Aesthetics Resources were not included in the PAD and were
made available only after numerous complaints from NPS, other agencies, and stakeholders
shortly before our original comments on the PAD and study requests were due.
- Disciplinary/Study Interdependencies: NPS and others have repeatedly requested AEA
to develop a schedule that ensures coordination between the numerous interdependent
resource studies associated with the Watana project. Of particular interest to NPS are the
recreation and aesthetics studies, which are dependent on the results of other biophysical
resource studies such as the hydrology, instream flow, fluvial geomorphology, ice processes,
fisheries and game studies. Despite these requests, the July 2012 PSPs make only vague
references to the issue. There remains no visible sign that this coordination is being conducted
at a project-wide, discipline-wide level. For example, none of the tables depicting the various
study schedules includes any reference to when the results of the “input” studies will be
available, or how the dependent studies might be modified if these input studies reveal and
need to change the dependent studies’ substantive, temporal or geographic scopes.
Critical Path Method or some comparable project management mechanism should be a key
element of this project, especially with some 58 studies in play, many occurring concurrently.
There should be a transparent process for tracking the critical milestones and progress of the
PSP’s with the interdependencies identified in each study plan. A summary of the overall critical
path schedule should be included as a separate plan, and made available on the project
website for the stakeholders to access.
- Availability of 2012 Study results and schedule: According to the current published
schedule, comments on the July 2012 PSP’s are due on 10/15/12; AEA files revised PSP’s on
11/14/12; comments on the revised PSP’s are due on 11/29/12; and FERC will make final
determination on study plans on 12/14/12. This schedule means that agencies and
stakeholders will not have the results of critical 2012 reconnaissance and baselining studies that
are key to determining the scope and adequacy of the 2013-14 ILP studies before our final
opportunity to comment on the ILP studies. We are being asked to take the Applicant’s word
that if the results of 2012 studies indicate a need to modify the ILP studies, such modifications
will be made voluntarily.
- Socioeconomics – NPS maintains that the metrics and analyses regarding the
socioeconomic costs and benefits of the project should extend beyond the estimated value of
increased recreation and tourism. We recognize that it is less straightforward to determine
some non-market values, e.g. ecosystem services and existence values, than it is to estimate
the future value of commercial tourism in the project area. That does not mean that these non-
market values are zero, however. NPS continues to assert that a full accounting of all project-
related impacts on the social environment must include an estimate of these values. While it
will of course be up to FERC to decide how reliable the various economic value estimates are
(just as the uncertainty associated with the future value of energy production v. project
construction and operation costs must be accounted for), and thus to determine much weight to
give the various types of estimated socioeconomic values in its “equal consideration” analysis,
nowhere does the FPA as amended by ECPA instruct FERC or license applicants to ignore
such values outright, especially in light of emerging valuation methodology.
With respect to Benefits Transfer methodology, this method is most reliable when the reference
and study sites and projects are very similar, and when the economic impact valuation study at
the reference site was performed at the highest standard. Given the dearth of large original
hydropower projects licensed on free-flowing rivers in remote locations in recent decades, NPS
believes it will be challenging to identify an appropriate reference project for Watana. Just as
with ecosystem services valuation methods, there will be numerous assumptions and
approximations associated with application of the benefits transfer method to this project. In
contrast to the lack of appropriate reference sites for a benefits transfer analysis, however, the
value of ecosystem services – including services associated with the Susitna River -- is
currently being studied with some rigor in Mat-Su Borough.
From the “Socioeconomic and Transportation Study, Regional Economic Evaluation Study,” p.
263 of the PSP document:
“The economic impact of the Project on local tourism establishments (e.g., river sport
fishing, whitewater boating) and the regional economy will be estimated using the results
of the Recreation and Aesthetics study. Calculations will be based on information
obtained from the recreation survey, including the estimated recreation-related
expenditures per recreational day or trip and changes in the number of days or trips per
year. The regional economic impact of changes in subsistence-related expenditures due to
the proposed Project will be estimated using the results of the Subsistence study.
Approximate cash expenses to generate each pound of subsistence harvest will be based
on published information (Goldsmith 1998).
In addition, the benefits transfer approach will be used to supplement or compare unit
values (e.g., value per-day of sport fishing) for recreational goods and services obtained
from primary valuation methods. Benefits transfer involves the application of unit value
estimates, functions, data, and/or models from one or more previously conducted
valuation studies to estimate benefits associated with the resource under consideration
(Black et al. 1998). The basis of the method is the assumption that the recreational
experience is enhanced by high quality sites (e.g., clean water, abundant recreational
fisheries), hence the net willingness to pay for, and hence the value of, recreational trips
depends on site quality.
Different model specifications can be used to value specific qualities of the resource and
attributes of the recreational experience. To value these types of amenities, economists
typically rely on a variant of the basic travel cost model referred to as a discrete choice or
random utility model. Whereas basic travel cost models are most appropriate in analyzing
the number of trips people make to a site, random utility models can be used to assess
how people choose between multiple sites based on the qualities of the sites. Travel cost
approaches require data on site visitation, place of residence, substitute sites, and user
characteristics (such as income) (Black et al. 1998). These data will be obtained from the
recreation survey conducted for the Recreation and Aesthetics Study.”
The PSP for Socioeconomics appears to rely largely on results generated through the
Recreation and Aesthetics Resources studies. Having not seen the survey instruments and
protocol, we don’t know how socioeconomic data will be gleaned from those surveys. We would
like to participate in reviewing the proposed survey methodology, ideally before our ability to
comment on the ILP study plans expires.
Section by Section Comments
10. RECREATION AND AESTHETIC RESOURCES
10.1. Introduction
The Alaska Energy Authority (AEA) proposes a Recreation Resources Study, a Recreational
River Flow Study, and an Aesthetic Resources Study in order to document baseline conditions
and help assess potential impacts on recreation and aesthetic resources from construction and
operation of the proposed Susitna-Watana Project (Project). The proposed Recreation Resources
Study has been prepared in consultation with agencies and licensing participants.
The Recreation Resources Study (Section 10.5) will research, describe, and quantify recreation
demand and capacity of facilities, and assess reasonably foreseeable recreation needs associated
with development of the proposed Susitna–Watana Hydroelectric Project.”
NPS – The study is focusing on recreational uses and demand rather than recreational
opportunities and experiences. Need to be qualitative, not just quantitative, because
experiences are likely to change post project. We are relying on the recreation surveys to tease
out qualitative information (quality of experience, preferences, etc.). Without seeing the survey
instruments and protocol, we don’t have assurance that they will be able to characterize these.
10.5. Recreation Resources Study
10.5.1. General Description of the Proposed Study
The Recreation Resources Study is designed to identify recreation resources and activities that
may be affected by the construction and operation of the proposed Susitna-Watana Project
(Project), and to help assess the potential impacts of Project construction and operation on those
resources and activities. The specific goals of the study are to:
Identify and document recreation resources and facilities that support both commercial
and non-commercial recreation in the Project area;
Identify the types and levels of current recreational uses and future reasonably
foreseeable future uses based on surveys and interviews, consultation with licensing
participants, regional and statewide plans, and other data;
Evaluate the potential impacts of Project construction and operation on recreation
resources, needs, and uses in the Project area; and
Use the results of analyses to develop an RMP for the Project.
NPS: Incorporate the results of the 2012 studies
10.5.2. Existing Information and Need for Additional Information
Existing information was compiled in the Recreation Data Gap Analysis (AEA 2011a) and
recreation resource descriptions and inventory presented in AEA's Pre-application Document
(PAD) (AEA 2011b).
NPS - This claim that existing info was compiled in Rec Data Gap analysis and included
in PAD is incorrect. Note that the claim was repeated (cut and paste) in the two other
rec/aesthetic studies. The PAD was filed in December 2011 but we did not receive
AEA’s “2011” gap analysis until March 2012, after much pleading. To our knowledge,
the 2011 publication date for this document is inaccurate since it was not made public
until 2012. There was no project-specific info in the PAD on rec and aesthetics, just a
regurgitation of the scanty, methodologically primitive information developed for a
different hydro project thirty years ago, at a time when FERC did not have to give equal
consideration to these resource values in deciding whether to license a project.
A recreation study was initiated in 2012 to gather data to inform the 2013-
2014 study plan, including the following elements:
— Interviews with key representatives of agencies and organizations, including Alaska
Native entities knowledgeable about regional and state recreation management and issues
— A compilation of existing recreation inventory and capacity information
— An inventory of Project area access
— Incidental Observation Survey Data (completed by field crews)
— Coordination with other study disciplines and incorporation of data
— Geo-referenced mapping
— Field reconnaissance
— Identification of future trends and issues
— A description of the management framework
Available information from the 2012 data gathering efforts will be used to develop the Revised
Study Plan.
NPS- Agencies and stakeholders will not have the results from the “2012 data gathering
efforts” until they are reported out in 11/5/12. We will not be able to incorporate any
comments on them by the 10/15 due date for our PSP comments. It is also unclear how
much of this information AEA and its consultants will have far enough in advance of their
11/14 RSP deadline to help inform the revised plans.
10.5.3. Study Area
The Project area is shown in Figure 1.2-1. The study area includes the Susitna River watershed,
focusing on recreation opportunities and use patterns in and around the immediate Project area.
10.5.4. Study Methods
Both water-based and land-based recreation uses and access will be analyzed. Seasonal uses that
relate to ice and snow conditions will also be analyzed. Specialized study of river flow-
dependent activities will also be conducted, as described in Section 10.7. The Recreation
Resources Study is interdependent with analyses conducted in other disciplines, both biophysical
(e.g., aquatics and hydrology) and social (e.g., transportation and socioeconomics), and
systematic coordination of data with those study groups will be required.
NPS – with respect to interdependent analyses, and the reliance of the rec and aesthetics
studies on results from other disciplines, there is no detail in this PSP explaining how the
timing will work. The schedule table at end of each PSP with study seasons and
deliverables does not mention this, either. We need details of how the sequence will work.
AEA can’t just say it will happen when it does not appear that the results of other studies will
be available before the delivery date for this one.
Methods for the components of the proposed Recreation Resources Study Plan for 2013-14 are
described below.
Regional Recreation Analysis
NPS – This study plan should note, early-on, the distinction with subsistence hunting and
fishing v. sport activities. May be confusing to some stakeholders and readers as the
process goes on.
The regional recreation resources context will be defined in coordination with agencies, technical
workgroups, and other participants, including Alaska Native entities. Regional and local data
related to recreation use will be collected and analyzed, including examination of various land
management regimes within the area. Existing resource management plans relevant to the
recreational resources of the study area will be reviewed and compiled. The analysis will be
conducted in accordance with existing and proposed community and regional plans, and private
sector plans. Plans that will be incorporated include:
NPS - “Existing resource management plans . . . will be reviewed and compiled.” Isn’t this
being done in 2012?
Alaska’s Outdoor Legacy Statewide Comprehensive Outdoor Recreation Plan (SCORP)
2009–2014 (Alaska Department of Natural Resources [ADNR] 2009)
Alaska Recreational Trails Plan (ADNR 2000)
Chase Comprehensive Plan (MSB 1993)
Cultural Resource Management Plan for the Denali Highway Lands (VanderHoek 2005)
Denali State Park Management Plan (Alaska Division of Parks and Outdoor Recreation
[DPOR] 2006)
DPOR Ten Year Strategic Plan 2007–2017 (DPOR 2007)
East Alaska Resource Management Plan (Bureau of Land Management [BLM] 2006)
MSB Comprehensive Development Plan (MSB 2005)
MSB Trails Plan (MSB 2008)
MSB Comprehensive Economic Development Strategy (TIP Strategies Inc. 2010)
MSB Parks and Recreation Open Space Plan (MSB 2000)
South Denali Implementation Plan and Environmental Impact Statement (National Park
Service [NPS] 2006)
Susitna Area Plan (ADNR 1985)
Susitna Basin Recreation Rivers Management Plan (ADNR 1991)
Susitna Matanuska Area Plan (ADNR 2011)
Talkeetna Comprehensive Plan (MSB 1999)
NPS - 2012 info will be used to develop RSP. Will we see this prior to the 10/15 due date
for our PSP comments? If not, how will agencies and the public ensure that the 2012 data
is applied correctly? Timing problem points to larger problem of trying to finalize study plans
for a project before reconnaissance level work is compete. This applies to two other PSPs
(Aesthetics and Instream Recreation), too.
Trails leading into and within the Project area will be identified using aerial imagery. These
include multiple formal and informal trails and routes, several formally identified Revised
Statute (RS) 2477 trails, and Alaska Native Claims Settlement Act (ANCSA) 17(b) trails. The
trails will then be mapped, and “ground-truthed.” This will identify trails that have historical use,
and are legal under State “generally allowed uses,” but have not been named or identified by
ADNR. Management responsibilities for 17(b) easement trails will also be clarified wherever
possible.
Recreation Activity Areas (per SCORP planning) and the Recreation Opportunity Spectrum
(USFS 1979) “primitive” class will also be described as they relate to the study area. Scenic
Byways, Wild and Scenic Rivers (WSR), and other special resource use designations will be
identified and described. There are two river segments within the Project area that have been
identified by BLM as eligible for inclusion into the WSR System: Brushkana Creek and the
portion of the Susitna River from the headwaters to the confluence of Kosina Creek. BLM has
stated that they will conduct a suitability determination for these eligible river segments (Social
Sciences Technical Workgroup Meeting, April 3, 2012). The George Parks Highway between
MP 132 and 248 is designated as an Alaska State Scenic Byway (ADOT&PF 2008; 2012).
Recreation Use and Demand
Currently, the recreation uses of the Project area are widely dispersed. Visitors to the area
participate in a wide variety of activities; including sport hunting, sport fishing, recreational
boating, skiing, snowshoeing, and snow-machining. The amount, extent, and potential impact of
Project-related dispersed recreation use on the proposed Project area’s land and water resources
is currently unquantified.
A baseline of developed and dispersed recreation uses, including types, levels, and access will be
determined and described. High use locations will be identified by activity, along with daytime
and overnight visits, and seasonal patterns. User preferences and opinions about the quality of
recreation resources will also be described. Data will be collected through a literature review and
a comprehensive survey and interview program. Salient existing data will also be incorporated.
Future recreation demand will be estimated, based on socioeconomic indicators, foreseeable non-
Project recreation developments, and identified issues and trends. Effects of the Project features
(e.g., reservoir and access roads) on hunting and trapping opportunities and on non-consumptive
uses (bird-watching, hiking, camping, boating, etc.) in the vicinity and downstream of the
proposed Project reservoir will be assessed. Additionally, the recreation effects of any Project-
induced changes in ice formation the Susitna River will be evaluated. There are also potential
effects of induced recreation along the Denali Highway and downstream from the Susitna River
bridge on the Denali Highway to the proposed Watana Reservoir. The effects of Project
construction and operational activities (e.g. noise, dust, limitations on access, and recreation
activities of construction workers) on recreation will also be analyzed. Recreation demand within
the study will be estimated within the study area in the reasonably foreseeable future.
NPS – AEA needs to analyze effects of project operations, not just “features.” Nowhere in
the PSP is it explicitly acknowledged that the project may have effects on things like fish
abundance (affecting sportfishing opportunities), moose, caribou, waterfowl and upland
game bird populations due to migration barriers and alteration of habitat due to altered
fluvial morphology and riparian vegetation.
Survey results and an inventory of current and projected recreation opportunities, commercial
services, and facilities will inform the Socioeconomic Resource Study in regard to the economic
contribution of recreation in the study area.
NPS - Socioeconomic study needs to determine value of rec., not just contribution to local
economy. This value includes “consumers” outside the local market. AEA needs to expand
their inquiry into alternative socioeconomic methods and models beyond “Benefits Transfer”.
Also see our comment under “Overall Comments.”
Recreation Carrying Capacity
There are no existing developed recreation facilities on the Susitna River at the Watana Dam site.
In the broader Project area, both public and private recreation facilities exist. These are primarily
located along the road system.
The existing physical carrying capacity of recreation resources in the Project area will be
estimated. Public facilities will be inventoried and described as to condition, capacity, adequacy
and operational cost. Private facilities will also be inventoried to the extent practicable. Public
access to recreation sites will also be described, including Americans with Disabilities Act
(ADA) compliance, if appropriate.
NPS –Physical carrying capacity is just one of the four elements of “carrying capacity”
(physical, ecological, social, and spatial). The area’s physical capacity may or may not be
the most limiting, especially if the project results in greater access, which could cause use to
exceed the area’s social carrying capacity. This is one reason why it’s so important to study
the experiential aspect of pre- and post-project recreational use. On rivers in particular,
social capacity is almost always more sensitive than other aspects of capacity, with
concerns about group size and encounter rates; competition for space at put-ins, take-outs
and campsites; and crowding at fishing holes, play boating features, etc.
The need for and capacity of additional reasonably foreseeable recreational facilities will be
forecast. Carrying capacity guidelines and standards will be applied in order to develop
recommendations for future recreation facilities and sites.
Data Collection
The collection of recreation user data will be accomplished through multiple survey processes.
The study design will describe target respondents, geographic locations, target days and months,
and questionnaire content; survey methods, in the context of consultation with agencies,
workgroups, Alaska Natives, and others Survey instruments will be designed to collect
information typical of and compatible with other FERC efforts. This includes the survey
conducted for the 1985 studies (Harza-Ebasco 1985b) and other surveys such as the SCORP
(DNR 2009) and the Alaska Visitor Statistic Program (AVSP) (McDowell 2012).
Identification and Analysis of Salient Data from Existing Survey Research
Recreation supply and demand data from other recreation planning sources applicable to the
region will be synthesized. Existing data can inform estimates of levels (e.g., “recreation days”)
and types of participation in recreation uses. The estimates will include a discussion and
comparison of participation rates in activities regionally, statewide, and nationally. Recreation
trends, as forecast in other studies, will also be described.
NPS – The existing survey research appears to be biased towards “industrial tourism.” This
is not the only population that uses the project area. This analysis needs to capture use by
independent tourists, e.g. people driving up the AK Highway and on to Denali Hwy., and
local (unguided AK resident) users, many of whom are able to access the area without
relying on air taxis or het boat charters.
The AVSP Survey (McDowell 2012) is a statewide research program commissioned by the
Alaska Department of Commerce, Community and Economic Development that included 6,747
visitors to Alaska in the summer of 2011 and 1,361 visitors in the Fall/Winter 2011/2012. The
SCORP (ADNR 2009) survey database will also be used quantify recreation uses and demand. In
addition, Alaska Travel Industry Association research (GMA 2011) about nonresident travel to
Alaska will be reviewed and summarized as it pertains to recreation and aesthetic appeal of
Alaska’s visitor market. NPS– Excludes the Spring season
These data will be utilized to describe year-round nonresident (non-Alaskan) experiences by
visitors in three major communities in the MSB (Palmer, Wasilla, and Talkeetna), passengers on
the Alaska Railroad, and cruise passengers (visiting McKinley Princess Lodge).
The existing data include
Lodging types
Activities
Length of stay
Purpose of trip
Previous travel to Alaska
Modes of transportation used within the State
Trip spending
Communities visited (overall and overnight)
Demographics (origin, age, income, party size)
This nonresident data will be evaluated along with existing data relating to recreation use by
Alaska Resident, in the context of the overall study plan.
Incidental Observation Survey
The purpose of the incidental observation survey is to capture information from field researchers
about dispersed recreational use. The survey will gather information on the date and time of day
the activity was observed, the type of activity observed, number of people recreating, and the
location of observed activity. This survey will not have statistical value, but will help identify
types of recreational use in the study area. A protocol will accompany the survey to inform field
crews how to complete and submit the survey. The survey will be used throughout the study.
Telephone Surveys of Railbelt Residents
The purpose of this survey is to interview a sample of residents about their recreation use in the
area and to collect perspectives about recreational opportunities. The survey will be administered
to a statistical sample of 600-900 randomly-selected Railbelt residents within a four-hour drive
of the study area (Fairbanks, Denali Borough, Mat-Su Borough, and Anchorage). This survey
will be central to the estimation of resident recreation demand. The SCORP survey instrument
will be reviewed for any benchmark questions to be considered in the survey design. The overall
sample size will be refined after considering desired subgroup samples.
NPS – We believe that the Phone survey has very little value. Given the sample size, very
few subjects are likely to be familiar with the project area, and the SCORP questions are too
general to yield useful information about the specific kinds of recreational opportunities in
the area (SCORPs for states as large and geographically diverse as AK are a problem in
and of themselves). Instead we suggest the resources be focused on “executive interviews”
-- use snowball sampling method to find actual users of this area and others like it.
Expecting great cooperation from vendors and outfitters, who are being asked to take the
time and effort to hand over private info on “actual users,” may also be difficult. This
underscores our need to review the survey instruments and protocols ASAP. Even though
the project is unique, such survey templates are fairly standard and should already have
been developed and disseminated to agencies and stakeholders.
The survey instrument design will capture
Past and current recreation use within the study area
Year-round seasonal, and day/night recreation use in the study area
Nature of use or recreational interest, including, but not limited to, fishing, boating,
camping, picnicking, hiking, off-roading, snowmachining, snowshoeing, skiing, horseback
riding, biking, rock/ice climbing, dogsledding, photography, mushroom/berry picking, scenic
touring, wildlife viewing, and hunting
Guided or unguided uses
Recreation preferences (such as pristine, primitive, semi-primitive, or developed)
Expected future recreation use within the study area, including how use may change with
Project development and operational alternatives
Means of access to the study area
Quality of the recreational opportunity
Importance of and satisfaction with current recreation facilities (such as boat launches
and trails)
Attractiveness of the study area for recreational activities
Accessibility and conditions/availability
Visual quality of the scenery in the study area
Distance that users are willing to travel for weekend recreational opportunities
Demographics of household and respondents.
Questions that elicit information central to related disciplines, such as the Regional Economic
Evaluation Study, may also be included.
Intercept Surveys and Structured Observation Visitor Counts
The purpose of these surveys would be to capture specific recreation use data from users
accessing the area by boat, rail, air, snowmachine, or other modes. The survey would be
conducted in person based on a sampling plan that captures peak seasonal uses.
Access points may include, but are not limited to, boat launches (e.g., Susitna Landing, Willow
Creek, Talkeetna, Deshka Landing), railroad whistle stops, trail heads (e.g., East-West
snowmachine trail head on the Parks Highway, along the Denali Highway), air strips, and
campgrounds (e.g., Brushkana Creek).
NPS - Where is the detail on this and other methods? Again, we need to be developing
instruments now, or at least deciding when they will be developed (prior to our last chance
to comment in mid-Oct.).
The survey instrument design would capture, but would not be limited to
Number in party and demographics
Community of residence
Participation in type and location of recreation activity
Rating of quality of recreation experience
Level of satisfaction with facilities/recreation activities, including aesthetics
Guided or unguided use
Past use and intention for future use
Trip expenses
Means of access to the recreation area
Accessibility, conditions, and availability
Other opportunities within same distance that offers similar experiences
Preferences
Interest in potential new recreation facilities and opportunities.
On sample days, the survey crews will observe key characteristics of recreation use (e.g., the
number of people present, the number of vehicles entering/exiting the access site, types of
recreation activities evident) and record this information on pre-printed forms. Users to be
surveyed in person will be selected by availability and willingness to participate.
Executive Interviews
The purpose of the executive interviews is to gather specific information about commercial (e.g.,
guides, tours, etc.) and private recreation use the study area. It is anticipated that between 50 and
70 private sector recreation businesses, associations, and other entities will be interviewed.
These interviews will be conducted by telephone. The executive interview process will be
necessary to develop trust with businesses and organizations with recreation-related interests in
the study area, in order to collect proprietary economic data for use in the Regional Economic
Evaluation Study. The process of developing a list of potential respondents includes the
identification of organizations, associations, government agencies, and businesses with
recreation-related interests in study area. This list will be developed through existing and referred
contacts, internet searches, and interviews. Contacts may include, but will not be limited to
Mat-Su Borough Convention and Visitors Bureau
Federal Agencies, such as BLM, NPS, etc.
State Agencies, such as DNR, Alaska Department of Fish and Game (ADF&G), etc.
Alaska Railroad
Regional governments
ANCSA corporations and tribal organizations
Community councils
Alaska Outdoor Council and other recreation organizations
Alaska Outdoors Bulletin Board
Citizen groups
Environmental organizations
Business representatives to be interviewed may include those associated with
Remote lodges/cabin rentals/accommodations/campgrounds
Restaurants
Airstrips and flying services/flightseeing
Guide services
Whitewater rafting/boat trips
Tour operators (all modes)
Recreational mining operations
Transportation services, including buses and Alaska Railroad
The interview protocol (guide) may include, but is not limited to the following topics:
Nature of business/service (e.g., guide, tour operator, accommodations, etc.)
Employment
Season of operation (e.g., year-round, summer, winter, hunting, etc.)
Means of access to destination (e.g., fly-in, boat, road, etc.)
Specific areas of operation within the study area
Years of operation
Estimated number of clients per year
Client/membership information, including origin, party size, general perceptions of age,
or other demographic features
Fees charged
Ways that use might change under the various operational alternatives identified and
potential impacts on area image, fishing, hunting, and other recreation activities
Past and current plans, programs, business operations, membership, activity, etc.
Geographic areas of highest recreational interest (and reasons why)
Recreation infrastructure used or needed
Identification of any trends (anecdotal and data sources) in recreational use levels or
patterns
Information about other projects proposed in the study area that could directly or
indirectly affect recreation, tourism, or access to the previously inaccessible areas
Suggestions for prioritizing the highest potential recreation demand in the area
Other data needed for socioeconomic baseline or other social science research
GIS Maps and Figures
Recreational sites, facilities, and access routes (RS 2477 rights-of-way, 17(b) easements, and
other recreation use trails) will be identified and digitized in a GIS using existing agency and
licensing participant datasets and aerial photography. These recreation features will be
“groundtruthed” (via ground- and air-based observations) and geo-referenced where possible.
Focus group interviews, discussions with licensing participants, coordination with other resource
study disciplines, and user intercept surveys will augment recreation facilities and trails mapping.
Significant recreation facilities and access points will be photographed for inclusion in the
Recreation Resources Report.
10.5.5. Consistency with Generally Accepted Scientific Practice
The methods and work efforts outlined in this Study Plan are the same or consistent with
analyses used by applicants and licensees and relied upon by the Commission in other
hydroelectric licensing proceedings. The proposed methodology for analysis for demand and
capacity estimates and survey sampling are commonly employed in the development of
hydroelectric project license applications.
10.5.6. Schedule
Upon approval for implementation, it is estimated that the term of the study would be
approximately two years.
Table 10.5-1. Recreation Resources Study Schedule. Description Start Date Completion Date
Data Collection (including seasonal field visits and surveys) January 2013 November 2014
Inventory January 2013 October 2014
Analysis November 2013 November 2014
Initial Study Report December 2013
Updated Study Report December 2014
NPS - Only one December (2013) will be sampled. There is no “wiggle room” should
weather or other conditions render the limited sample seasons inadequate to represent
actual project area conditions. There is no mention of when results of other studies – ice,
morphology, fish and game populations, etc. – will be in hand, and how these results will be
incorporated in the rec study report. See our comment under Overall Comments regarding
interdependent studies.
10.5.7. Level of Effort and Cost
The estimate of the two-year recreation study is $570,000.
10.5.8. Literature Cited
Alaska Energy Authority (AEA). 2011a. Susitna-Watana Hydroelectric Project, Socioeconomic,
Recreation, Air Quality and Transportation Data Gap Analysis. Prepared by HDR, Inc.,
Anchorage.
—. 2011b. Pre-application Document: Susitna-Watana Hydroelectric Project FERC Project
No. 14241. Prepared for the Federal Energy Regulatory Commission, Washington, DC.
Alaska Department of Natural Resources (ADNR). 1985. Matanuska-Susitna Borough Susitna
Area Plan. Alaska Department of Natural Resources, Alaska Department of Fish and
Game and Matanuska-Susitna Borough, Anchorage.
—. 1991. Susitna Basin Recreation Rivers Management Plan. Alaska Department of Natural
Resources and Alaska Department of Fish and Game, Juneau.
—. 2000. Alaska Recreational Trails Plan. Alaska Department of Natural Resources. Division
of Parks and Outdoor Recreation. Juneau, Alaska.
—. 2009. Alaska’s Outdoor Legacy Statewide Comprehensive Outdoor Recreation Plan
(SCORP) 2009-2014. Alaska Department of Natural Resources, Juneau.
—. 2011. Susitna Matanuska Area Plan. Alaska Department of Natural Resources, Juneau.
Alaska Department of Transportation and Public Facilities (ADOT&PF). 2008. George Parks
Highway Scenic Byway Corridor Partnership Plan. Published online at:
http://dnr.alaska.gov/parks/plans/georgeparkshwyscenicbyway.pdf
—. 2012. George Parks Highway Scenic Byway Master Interpretive Plan (in draft).
Published online at:
http://dot.alaska.gov/stwdplng/scenic/assets/DRAFT_Parks_Hwy_MIP.pdf
Alaska Division of Parks and Outdoor Recreation (DPOR). 2006. Denali State Park
Management Plan. Alaska Department of Natural Resources, Juneau.
—. 2007. Alaska’s Division of Parks and Outdoor Recreation Ten Year Strategic Plan 2007-
2017. Alaska Department of Natural Resources, Juneau.
Bureau of Land Management (BLM). 2006. East Alaska Resource Management Plan. U.S.
Department of the Interior, Bureau of Land Management. Glennallen Field Office.
GMA Research Corporation. 2011. Images of Alaska. Alaska Travel Industry Association.
Harza-Ebasco Susitna Joint Venture (Harza-Ebasco). 1985. Pre-Application Document Appendix
4.9-3, Aesthetic Value and Visual Absorption Capability Ratings.
Matanuska-Susitna Borough (MSB). 1993. Chase Comprehensive Plan. Matanuska-Susitna
Borough Planning and Land Use Department, Palmer.
—. 1999. Talkeetna Comprehensive Plan. MSB Planning and Land Use Department, Palmer.
—. 2000. MSB Parks and Recreation Open Space Plan. Matanuska-Susitna Borough Planning
and Land Use Department, Palmer.
—. 2005. Matanuska-Susitna Borough Comprehensive Development Plan. Matanuska-Susitna
Borough Planning and Land Use Department, Palmer.
—. 2008. Matanuska-Susitna Borough Recreational Trails Plan. Adopted March 2000,
Updated August 2008. Matanuska-Susitna Borough Planning and Land Use Department,
Palmer.
McDowell Group, 2012. Alaska Visitor Statistics Program. Alaska Department of Commerce,
Community, and Economic Development.
National Park Service (NPS). 2006. Final South Denali Implementation Plan and
Environmental Impact Statement. U.S. Department of the Interior, Denali National Park
and Preserve, Denali Park, Alaska.
TIP Strategies Inc. 2010. Matanuska-Susitna Borough, Alaska Comprehensive Economic
Development Strategy. Prepared for the Matanuska-Susitna Borough, Palmer.
USDA Forest Service (USFS). 1979. The Recreation Opportunity Spectrum: A Framework for
Planning, Management, and Research. US Department of Agriculture, Forest Service.
VanderHoek, R. 2005. Cultural Resource Management Plan for the Denali Highway Lands,
Central Alaska. Office of History and Archaeology, Division of Parks and Outdoor
Recreation, Alaska Department of Natural Resources, Anchorage.
10.6. Aesthetics Resources Study
10.6.1. General Description of the Proposed Study
The goals and objectives for the Aesthetic Resources Study are to inventory and document
baseline aesthetic (e.g., visual, auditory) conditions in the Project area and evaluate the potential
effects on aesthetic resources, beneficial or adverse, that may result from construction and
operation of the proposed Project.
10.6.2. Existing Information and Need for Additional Information
Existing information was compiled in the Recreation Data Gap Analysis (AEA 2011a) and
recreation resource descriptions and inventory presented in AEA's Pre-application Document
(PAD) (AEA 2011b). A recreation study was initiated in 2012 to gather data to inform the 2013-
2014 study plan, including the following elements:
NPS - There was no aesthetics inventory, as would be understood by that term in 2011-12
as opposed to 1984, in the PAD – nor a gap analysis.
Interviews with key representatives of agencies and organizations, including Alaska
Native entities, knowledgeable about regional and state recreation management and
issues
A compilation of existing recreation inventory and capacity information
An inventory of Project area access
Incidental Observation Survey Data (completed by field crews)
Coordination with other study disciplines and incorporation of data
Geo-referenced mapping
Field reconnaissance
Identification of future trends and issues
A description of the management framework
Interviews with key representatives of agencies and organizations
Assessment of management frameworks for pertinent agencies
Identification of broad Project area viewsheds and preliminary KOPs using those
identified in the 1985 license application
Photography
Field reconnaissance
Description of Project area soundscape
Through the prior processes, the FERC scoping process and incorporation of work group and
other licensing participant recommendations, study methods for 2013-2014 were developed.
Issues, trends, original data collection strategies, and items for detailed analysis are incorporated
into the 2013-2014 Study Plan.
NPS - “Through the prior processes, the FERC scoping process . . . .study methods for
2013-14 were developed [emphasis added]” This is incorrect, they are still being
developed! We find this very strange language to include in a proposed study plan. NPS
has in fact had little time and opportunity to see products and engage consultants so far, so
it is extremely premature to claim this as fait accompli.
10.6.3. Study Area
The overall Project area is shown in Figure 1.2-1. The specific study area for Aesthetic
Resources will be developed as part of the analysis and in coordination with information from
other disciplines, such as hydrology. It will be based on a viewshed model of proposed Project
features, including the dam structure, transmission and road corridors, and the resulting Watana
reservoir. The study area will also include portions of the Susitna River located downstream of
the Watana Dam site down to Talkeetna.
NPS – As NPS and other agencies have noted, deciding to limit the downstream scope of
this and other studies to Talkeetna is totally unfounded. Until we get the results of the
instream flow, ice, fluvial geomorphology, fish, and other studies, no one can say how far
downstream the project’s measurable effects on visual and auditory resources will go. For
example, as previously noted by numerous commenters numerous times, the project’s
proposed, artificially high and variable winter load following flows are highly likely to alter the
formation of stable ice on the Susitna far downstream of the project. Spring flushing flows
and sediment transport may be largely eliminated, and summer flows will be very low, in all
probability leading to major changes in the formation and maintenance of islands, sloughs,
side channels, beaches, and riparian vegetation. Again, no one yet knows how far
downstream of the Talkeetna and Chulitna confluence these major changes will be evident.
All of these altered features will be visible. NPS vehemently disagrees about this premature
decision, which contradicts statements elsewhere in this and other PSPs acknowledging the
need to rely on the results of other studies. We will not have these results prior to 10/15,
when NPS comments must be finalized, or 12/14, when FERC’s determination on SPs will
be made.
10.6.4. Study Methods
The visual resource impact analysis will follow methods developed by the BLM (BLM 1986).
Specific methodology will be augmented with relevant portions of the USFS Visual Management
System (VMS) / Scenery Management System (SMS) (USFS 1995) methods, as consideration of
this approach will be an important aspect of bridging data collected during the 1985 PAD
(Harza-Ebasco 1985) and that collected during the current study effort. It is also expected that
the Visual Sensitivity Analysis will be expanded beyond what is used by the BLM at the
planning level to incorporate surveys, focus groups, and information collected through the
scoping process. Data collection and analysis will be completed across all four seasons. The
Aesthetic Resources Study is interdependent with analyses conducted in other disciplines, both
biophysical (e.g., hydrology) and social (e.g., transportation), and coordination of data with other
study groups will be significant.
NPS – Again, this acknowledges interdependency of this study on results of other studies,
but provides no detail on timing of those deliverables and proposed schedule for finalizing
details of this. See also our comments under “Overall Comments.”
Define Study Area
The preliminary study area identified as part of the 2012 work will be refined based on updated
Project design and siting. The viewshed will be generated for all Project features, including roads
and transmission lines, and refined in coordination with federal, state, and local agencies. The
study area will be sufficient in size to address all established indicators of change, including
potential indirect effects to recreation, cultural resources, subsistence, and socioeconomics. It is
expected that this area will include the Susitna River drainage and upland areas where views of
the basin are expected to change based on construction and/or operation of the proposed Project.
Viewshed models will be developed for pre-and post-Project conditions to depict expected
changes in viewshed areas (i.e., creation of new views, loss of others). The study area will also
include common air transportation routes used for transportation and recreational air tours. Maps
displaying the viewsheds and geographic boundary of the analysis area will be created.
Important views and vistas identified through other resource reviews will be identified and
placed on the viewshed map.
Establish Key Observation Points
A final list of KOPs will be developed using information from the 1985 license application
(Harza-Ebasco 1985), field observations in 2012, ongoing interdisciplinary/interagency
coordination, and Project scoping. It is expected that KOPs will differ by landscape analysis
factors, such as their distance from the Project, predominant angle of observation, dominant use
(i.e., recreation or travel), and average travel speed at which the Project could be viewed. KOPs
may represent views experienced across all seasons or may be specific to a particular season.
NPS - KOPs – Do NPS, other resource agencies and stakeholders get a say on these?
When? This is supposed to be The Plan, not a plan to plan.
Baseline Data Collection
Field data collection will include a combination of site visits by helicopter and travel of upstream
segments of the Susitna River by boat. Additional information describing access, existing
lighting, and movement will be recorded. Baseline photography will be collected at a resolution
sufficient for use in computer-generated visual simulations.
Data on existing aesthetic resource values will be collected using the BLM’s Visual Resource
Inventory (VRI) methodology (BLM 1986). Data collection efforts will include an inventory of
scenic quality, visual sensitivity, and distance zones within the Study Area. All areas will be
evaluated within the context of viewer experiences. For example, views from roadways or from
the perspective of a boater traveling downriver will be established as “linear” or “roving” KOPs.
Data collection methods are described below.
Scenic Quality
Scenic quality of the Project area will be determined through the VRI process (BLM 1986). This
process entails dividing the landscape into Scenic Quality Rating Units (SQRUs) based on
conspicuous changes in physiography or land use and ranking scenic quality within each SQRU
based on the assessment of seven key factors: landform, vegetation, water, color, adjacent
scenery, scarcity, and cultural modification. Each key factor is scored, and the value of each is
added to derive an overall score for the unit. Based on these results, each SQRU is assigned a
scenic quality rating of A, B, or C, with A representing the highest scenic quality and C
representing the lowest scenic quality.
Visual Sensitivity
Viewer sensitivity will be classified using the BLM Visual Sensitivity Level Analysis (SLA)
(BLM 1986). The SLA will be completed in two steps: (1) delineation of Sensitivity Level
Rating Units (SLRUs), and (2) rating visual sensitivity within each SLRU. By definition, SLRUs
represent a geographic area where public sensitivity to change of the visual resources is shared
amongst constituents. The unit boundaries may be defined by a single factor driving the
sensitivity consideration, or factors driving sensitivity may extend across numerous SLRUs.
Units are thus derived, in part, by the consideration of factors analyzed in the SLA. Visual
sensitivity within each SLRU is estimated as high, medium, or low, based on the types of users,
amount of use, public interest, adjacent land use, and land use designations. Information required
for this analysis will be obtained through land use plan review, data collected by other resource
disciplines, and surveys and/or focus groups. The data collected through surveys and focus
groups will be coordinated with the set conducted for the Recreation Resources Study.
Respondents will be asked about their place-based visual preferences.
Visual Distance Zones
Distance zones represent the distance from which the landscape is most commonly viewed.
These zones will be established by buffering common travel routes and viewer locations at
distances of 3 miles, 5 miles, and 15 miles using GIS (BLM 1986).
NPS - There is no mention of assessing the aesthetics of varying flows. This is a high
volume glacial river flowing at up to 25 mph – the sight and sound of its flows, color of its
water, mixing at clear water tributaries are major components of river-related recreation.
Need to do this at KOPs along the river, in all seasons, using videography (sound). Need to
add to Sound analysis, too.
Photo Simulations
To support the visual resource impact analysis and to disclose expected visibility of Project
components from various vantage points, photo simulations will be prepared. Simulations will be
produced by rendering Project components (turbines, substations, access roads, etc.) with 3-
dimensional (3D) computer models and superimposing these images onto photographs taken
from KOPs. Model parameters will account for environmental factors, such as seasons, viewing
angle, and light conditions, resulting in an accurate virtual representation of the appearance of
the proposed Project. Simulations will be produced to illustrate (1) the structure, (2) downriver
landscape characteristics, (3) reservoir landscape characteristics, (4) access roads and
transmission lines, (5) views of reservoir from upland areas, and (6) views of potential
construction-related impacts. Additional simulations and/or videography will be produced as
needed in key areas. Simulations will be completed by seasons and under daylight and nighttime
conditions.
Visual Resources Analysis
BLM contrast rating procedures will be used (BLM 1986). The visual resource impact analysis
focuses on established indicators of change. Indicators will include, but will not be limited to, the
following:
Impacts to visual resources, measured by the degree of visual contrast created by the
Project
Change in existing VRI values of scenic quality, visual sensitivity, and distance zones
Introduction of new sources of light and glare
Change in the viewshed area, including both the elimination and creation of views and
vistas
Change in the mechanism of view (e.g., transition from mobile view traveling downriver
to a static view when situated on the reservoir)
Change in visibility that may result from Project-related dust
Methodology used to address each indicator is described below.
Contrast Rating Analysis
The BLM Contrast Rating procedure will be used to determine visual contrast that may result
from the construction and operation of the Project based on photo simulations depicting Project
features. This method assumes that the extent to which the Project results in adverse effects to
visual resources is a function of the visual contrast between the Project and the existing
landscape character. Impact determinations will be based on the identified level of contrast and
are not a measure of the overall attractiveness of the Project (BLM 1986).
At each KOP, Project features will be evaluated using photo simulations and described using the
same basic elements of form, line, color, and texture used during the baseline evaluation. The
level of perceived contrast between the proposed Project and the existing landscape will be
classified using the following definitions:
None: The element contrast is not visible or perceived.
Weak: The element contrast can be seen but does not attract attention.
Moderate: The element contrast begins to attract attention and begins to dominate the
characteristic landscape.
Strong: The element contrast demands attention, would not be overlooked, and is
dominant in the landscape.
The level of contrast will be assessed for all Project components used during construction,
operations and maintenance, and decommissioning of the proposed Project.
Visual Resource Inventory Analysis
The VRI analysis will be used to identify expected change to VRI classes based on changes to
the visual resource values of scenic quality, visual sensitivity, and/or distance zones that may
result from operation of the proposed Project. This analysis will be completed within the
framework study area, with the goal of understanding how visual resource values and resulting
VRI class may shift based on operation of the proposed Project (including the dam, access roads,
and transmission lines). Impacts to VRI components will be evaluated by ranking each key factor
used to classify scenic quality, visual sensitivity, and distance zones under operational
conditions, and comparing those values to that determined through the established pre-Project
VRI.
Light and Glare
The impact analysis for light and glare will focus on potential impacts that may result from
nighttime artificial lighting and/or daytime glare. The analysis of artificial lighting will identify
potential impacts to human activity at nearby off-site locations that may result from the proposed
Project. Photo simulations will be produced to demonstrate views of the proposed Project at
night from selected KOPs.
Change in Viewshed Area and Mechanism of View
Viewshed analysis performed for both pre- and post-Project conditions will be compared to
identify the changes in viewshed and mechanism of view. These data will quantify the extent of
changes in views, and the degree to which access to views changes with the development of
roads and the elevation of the viewer within the inundated portions of the reservoir.
Change in Visibility
Data generated by the Air Quality Resource discipline will be used to determine the potential for
changes in visibility that may result from construction and/or operation of the proposed Project
and related recreation resource values. Results from the air quality dust analysis will be
incorporated in this study.
Sound Analysis
A systematic sound study will be conducted to characterize the existing ambient sound
environment in the vicinity of the proposed Project and estimate the potential impact associated
with construction and operational activities.
The steps in the sound analysis are described below.
Review Documentation and Develop Data Needs
Relevant Project data will be reviewed, including the most current Project description, operating
and construction equipment rosters, construction schedules. Ambient sound data recorded in the
area or in a similar area will be obtained. Based upon this review, itemized data requirements
will be developed that would be needed to perform predictive sound emission modeling. Based
on this review a set of outdoor ambient sound level surveys in the vicinity of the Project area will
be obtained. The data requirements will include anticipated categories of stationary and mobile
construction equipment and their frequency of operation, locations of nearest representative
noise-sensitive receivers (NSR), recreation sites (RS), and sound data or specifications
associated with intended operating dam systems and processes. Laws, ordinances, regulations,
and standards that may influence the sound impact assessment for this study will also be
inventoried.
Seasonal Surveys of Ambient Sound Levels
Ambient sound level measurements will be collected in the Project vicinity. These will include
unattended long-term ([LT]”, a minimum of 24 continuous hours, up to a single week) sound
level monitoring at up to a total of four representative NSR or RS locations and up to a total of
16 attended short-term ([ST], e.g., 15-20 minutes duration each) daytime and nighttime sound
measurements to help characterize the affected environment. Observations of perceived and
identifiable sources of sound contributing to the ambient sound environment and the conditions
during which they occur will be documented as part of the field survey. This survey will be
conducted up to four times, associated with up to four distinct seasons (e.g., summer, fall, winter,
spring) but for a minimum of two seasons consistent with NPS Natural Sounds Program (NSP)
published guidelines (NPS 2012). To the extent practicable, the survey locations will be the
same for each surveyed season.
NPS - When do we decide where the four LT and 16 ST locations will be? What if we think
there should be more? Again, need to agree about this prior to 10/15/12. NPS would like to
have enough advance detail to involve our Soundscapes staff in reviewing this
methodology.
Modeling of Project Sound Levels.
Up to three scenarios or alternatives of future Project operational sound levels will be estimated
with System for the Prediction of Acoustic Detectability (SPreAD). Computer Aided Noise
Abatement (CADNA/A), an industry-accepted outdoor sound propagation modeling program,
could also be used (Sound Advice Acoustics Ltd, 2012). Predicted sound level isopleths or
“sound contours” will be superimposed on suitable aerial photographs or maps of the Project
vicinity and will include specific sound level prediction at selected measurement and/or
assessment locations from the ambient sound field surveys of Task 2. Predicted sound emissions
associated with both Project construction and operation using different transportation route
options will also be assessed.
GIS Maps and Figures
Viewsheds, KOPs, and soundscapes will be mapped as GIS layers according to Project
standards. Mapping will also identify relevant management standards within the study area.
Significant visual features will be photographed for inclusion in the Aesthetic Resources Report.
Visual simulations depicting the appearance of the proposed Project will be produced for a
subset of KOPs, and used to inform the impact analysis.
10.6.5. Consistency with Generally Accepted Scientific Practice
The methods and work efforts outlined in this Study Plan are the same or consistent with
analyses used by applicants and licensees and relied upon by the Commission in other
hydroelectric licensing proceedings. The Aesthetics studies are based on the BLM’s visual
resources methodology. The sound analysis is consistent with National Park Service Guidelines.
10.6.6. Schedule
Upon implementation, it is estimated that the term of the studies will be approximately two
years.
Table 10.6-1. Aesthetic Resources Study Schedule. Description Start Date Completion Date Duration
(months)
Data Collection(including seasonal field visits and sound monitoring) January 2013 November 2013 11
Inventory January 2013 October 2013 10
Initial Study Report October 2013 December 2013 3
Analysis November 2013 March 2014 5
Updated Study Report April 2014 December 2014 8
NPS - very short, and no work in any December. Initial study report is scheduled for 12/13 –
will this allow integration of results of other biophysical studies?
10.6.7. Level of Effort and Cost
The estimate of $500,000 includes the following components over two full years of study.
10.6.8. Literature Cited
AEA (Alaska Energy Authority). 2011a. Susitna-Watana Hydroelectric Project, Socioeconomic,
Recreation, Air Quality and Transportation Data Gap Analysis. Prepared by HDR, Inc.,
Anchorage.
—. 2011b. Pre-application Document: Susitna-Watana Hydroelectric Project FERC Project
No. 14241. December 2011. Prepared for the Federal Energy Regulatory Commission,
Washington, DC.
Air Resource Specialists (ARS). 2012. Win Haze Modeling Software. Published online at
http://vista.cira.colostate.edu/improve/Tools/tools.htm. Accessed 6/18/12.
Bureau of Land Management (BLM). 1986. Visual Resource Inventory. BLM Handbook 8410-1.
Washington, D.C.
Harza-Ebasco Susitna Joint Venture (Harza-Ebasco). 1985. Pre-Application Document Appendix
4.9-3, Aesthetic Value and Visual Absorption Capability Ratings. Prepared for the Alaska
Power Authority. Anchorage, Alaska.
National Park Service (NPS). “In the Field.” 2012. Published online at
http://nature.nps.gov/sound/field.cfm. Accessed 6/17/2012.
Reed, S.E., J.L. Boggs and J.P. Mann. 2010. SPreAD-GIS: an ArcGIS toolbox for modeling the
propagation of engine noise in a wildland setting. Version 2.0. The Wilderness Society,
San Francisco, CA. U.S. Department of the Interior, National Park Service, Alaska
Regional Office. March 7, 2012.
Sound Advice Acoustics, Ltd. 2012. “CADNA Prediction Software.” Published online at
http://www.soundadviceacoustics.co.uk/prediction_software.php. Accessed 06/18/12.
TIP Strategies Inc. 2010. Matanuska-Susitna Borough, Alaska Comprehensive Economic
Development Strategy. Prepared for the Matanuska-Susitna Borough, Palmer.
USDA Forest Service. (USFS) 1974. The Visual Management System. Agriculture Handbook
Number 462.
—. 1995. Landscape Aesthetics: A Handbook for Scenery Management.
10.7. Recreational Boating / River Access Study
NPS– Consider changing the title of this study to “Flow Dependent Recreation,” reflecting
the broader affected activities beyond boating and fishing. The Study’s title and some initial
statements about scope are contradictory. Study goal is not merely to contribute data
concerning recreational boating and access – it is to look at all forms of flow-dependent rec.
That would include activities like fishing that are affected by flows (e.g. if salmon disappear
because no more spawning habitat, or if you can’t ski, mush, or snow machine the river
anymore due to unstable ice) regardless of whether you’re doing it in a boat or from shore.
NPS - Aesthetics can be flow dependent (stillwater in res. v. free-flowing stream, lost sight
and sound of whitewater at high flows in DC, morphological and vegetation changes
downstream due to changed flow regime). There is no mention of this in this or the
Aesthetics PSP.
NPS – There is also no mention of whether impacts on rec access and experiences due to
changed ice and snow cover resulting from changed flow regime will be assessed under this
PSP. It should be included.
10.7.1. General Description of the Proposed Study
This study incorporates and contributes to data and analysis conducted as part of the Recreation
Resources Study (Section 10.5). In the overall recreation study, recreational boating uses and
river access points will be identified. Current and future use of the river by both motorized and
non-motorized boat users will also be estimated therein. Because the Project will affect river
flow regimes, including the inundation of about 39 miles of the river, and because changes in
river flow regimes may directly impact boating and other flow-dependent recreation activities, a
specific methodology of recreational flow analysis is also proposed.
Study Goals and Objectives
The goal of the Recreational Boating / River Access Study is to contribute data to the
Recreation Resource Study concerning recreational boating and access.
The goal and objective of the study is to contribute to the Recreation Resource Study concerning
the relationship between river flows and recreation opportunities and uses, by:
developing flow preference curves for each major river reach by type of use and
equipment; NPS: Doubt you can develop a preference curve for winter activities that require
stable river ice. It will either be present or absent. What method will be used to assess this
effect?
describing the potential effects of altered river flows on existing and potential boating
activity and other recreational uses of the Susitna River; and
describing any new boating or other flow-dependent recreational opportunities that may
be created by Project construction and operation.
10.7.2. Existing Information and Need for Additional Information
Existing information was compiled in the Recreation Data Gap Analysis (AEA 2011a) and
recreation resource descriptions and inventory presented in AEA's Pre-application Document
(PAD) (AEA 2011b). A recreation study was initiated in 2012 to gather data to inform the 2013-
2014 study plan, including the following elements:
— Interviews with key representatives of agencies and organizations, including Alaska
Native entities, knowledgeable about regional and state recreation management and
issues
— A compilation of existing recreation inventory and capacity information
— An inventory of Project area access
— Incidental Observation Survey Data (completed by field crews)
— Coordination with other study disciplines and incorporation of data
— Geo-referenced mapping
— Field reconnaissance
— Identification of future trends and issues
— A description of the management framework
— compilation of existing baseline boating recreation information and access;
— hydrology data review;
— field reconnaissance and photography;
— identification of future trends and issues; and
— description of the management framework and special river designations.
— compilation of existing baseline boating recreation information and access;
— hydrology data review;
— field reconnaissance and photography;
— identification of future trends and issues; and
— description of the management framework and special river designations.
Available information from the 2012 data gathering efforts will be used to develop the Revised
Study Plan.
Through the consultation events including the FERC scoping process and work group meetings,
other licensing participant recommendations including input on study methods were used for
development of the 2013-2014 study plans.
10.7.3. Study Area
The reaches of the Susitna River, shown in Figure 10.7-1, will be subdivided into smaller units
as a result of physical studies in other disciplines and field observations conducted in the
Recreational River Flow Study. Areas of concentration will include areas where the proposed
reservoir would create the most flow changes.
NPS – We do not understand the statement: “areas where the proposed reservoir would
create the most flow changes.” What is the threshold for “most”? Who decides? When?
Even assuming consensus on the standard to be used, how can this decision be made
before the results of the instream flow, flow routing, ice processes, etc. studies are in hand?
What if we and others disagree with AEA’s geographic scope decision? This needs to be
nailed down by 10/15/12.
The Recreation River Flow Study will focus on those reaches of the Susitna River directly
affected by the Project. These include the section of river that would be inundated by the
proposed reservoir, Devils Canyon, and the reach downstream of Devils Canyon to the
confluence with the Talkeetna River.
NPS - Again, it is totally unfounded for AEA to arbitrarily stop at Talkeetna River. This
contradicts prior commitments to rely on the results of other studies to inform impacts on
recreation. Those studies will not be completed for several years.
10.7.4. Study Methods
The Recreation River Flow Study is interdependent with analyses conducted in other disciplines,
especially physical (e.g., hydrology) and social (e.g., transportation), and input of data from
those study groups will be significant.
This Study is designed to identify the minimum and optimum instream flow needed for
motorized, non-motorized, and whitewater boating, as well as other flow-dependent recreational
activities, on the Susitna River.
Using accepted practices for recreational flow study design, as described in Whittaker et al.
(1993, 2005), a progressive sequence of levels of study will be undertaken. These include: Level
1, desktop analysis; Level 2, limited reconnaissance; and Level 3, intensive field studies. This
process maximizes study efficiency by characterizing recreation activities for respective river
segments in the desktop phase, confirming assessments in the reconnaissance phase, and then
focusing intensive field studies to those activities and river segments warranting detailed study
and analysis. This process also contributes to early identification of potential Project effects and
user conflicts, and information needed to evaluate potential Project effects on river-based
recreation.
Level 1: Desktop analyses integrate existing information about channel characteristics,
hydrology, river recreational opportunities, access points, and flows in order to determine what
recreational boating resources are present that could be affected by the potential Project.
Level 2: Reconnaissance efforts gather first-hand information on the river resource, types of
recreation opportunities, and associated attributes as well as the recreational user groups
accessing the river. The reconnaissance also provides valuable information on access sites,
logistics, travel to and from the site, local resources and people, and, lastly, potential safety
concerns. Motorized and non-motorized watercraft may be used during the reconnaissance to
better understand recreation opportunities on the river.
Level 3: Intensive field studies will document the existing flow-dependent recreation
opportunities (motorized and non-motorized watercraft) and the associated attributes for the
respective opportunities, and will quantify the flow preferences (minimum acceptable and
optimum) for each opportunity. This is done through a combination of field observations,
interviews with licensing participant groups, focus group sessions, and an instream flow
recreation survey targeting recreation opportunities for a given river segment. The survey work
will be conducted in coordination with surveys associated with the overall Recreation Study.
NPS – Again, this underscores why we need to see the proposed survey instruments,
protocol, etc. to determine if the Rec Survey adequately addresses these issues.
Elements of recreational boating flow research include:
Data collection - Water recreation attributes for discrete sections on the Susitna River
will be described, including types of river recreation, reach length, gradient, character,
whitewater difficulty classification, and recommended range of flows for respective
recreation activities. Activities will be identified by type of motorized and non-motorized
water craft, including whitewater kayaks and packrafts; commercial and non-commercial
uses; and trip purposes, trip length, frequency of use, and seasonal considerations.
Reconnaissance – River recreation opportunities and associated instream flow attributes
will be observed and described. Existing and potential sites for recreational boating
access along the river corridor and the area inundated by the proposed reservoir will also
be described.
Consultations - Boaters, land and resource managers, guides, user groups and others will
be interviewed to determine the types and locations of boating activity occurring on the
Susitna River. Interviews will be conducted with boaters and other experts with
experience on the Susitna River to determine a range of conditions generally acceptable
to various types of watercraft and skill levels.
Consultation methods include the following:
Interviews will be conducted with river recreation users with previous experience on the
Susitna, including motorized, non-motorized, and whitewater boaters.
Focus group sessions will contribute additional information about flow preferences,
recreation use patterns for respective reaches and groups, whitewater difficulty, safety,
campsites, significant rapids, and recreational access. The focus group sessions will be
coordinated with national, regional, or local water recreation clubs.
Outcomes of the process include the following:
Motorized and non-motorized boating opportunities and associated attributes for the
range of flows will be examined. This includes, where applicable, the level of whitewater
difficulty, portage requirements, length of trip, and characterization of experiences.
Includes tourism boating up to Devils Canyon.
Flow preference curves for each reach will be developed for respective river recreation
opportunities.
The frequency for the range of preferred flows for respective opportunities will be
quantified for existing conditions and likely proposed Project operations.
Put-in and take-out sites and related needs (e.g., scouting and remote camping) that may
be associated with respective recreation opportunities in a particular river segment will be
identified.
10.7.5. Consistency with Generally Accepted Scientific Practice
The methods and work efforts outlined in this Study Plan are the same or consistent with
analyses used by applicants and licensees and relied upon by the Commission in other
hydroelectric licensing proceedings. The proposed methodology is often used in analysis for
development of hydroelectric license applications to fulfill the FERC’s Exhibit E requirements
for documentation and development of mitigation measures for flow dependent recreation.
10.7.6. Schedule
Upon implementation, it is estimated that the term of the studies will be approximately two
years.
Table 10.7-1. Recreational Boating / River Access Study Schedule. Description Start Date Completion Date Duration
(months)
Data Collection (including seasonal field visits and consultations) January 2013 November 2013 11
Inventory January 2013 October 2013 10
Initial Study Report December 2013
Analysis November 2013 March 2014 5
Updated Study Report April 2013 December 2014 8
NPS - No information about when/how the Level 1-3 analyses fit in with this schedule.
Much of this study plan appears to have been cut and paste from the NPS/OSU guide,
without an explanation of how the methods will be applied to this particular project. We
need specifics and an agreement on who makes mid-point decisions to proceed, e.g., from
Level 1 to 2, or 2 to 3, based on what criteria.
NPS - There is only one winter and one summer of study, and no Novembers or
Decembers. This does not indicate a sincere concern for impacts on winter recreation.
Arguably, AK’s winter rec season is longer than its summer season. It is certainly important
to users, as well as purveyors of equipment (e.g. snow machines) and the local economy.
One year of study is also not an adequate sample size to support conclusions about
important flow-dependent activities like sportfishing and float hunting. Note the emergency
Chinook closure this year – how can you study the most sought-after fish species in SC AK
if harvest is prohibited during the only year of study? Likewise, the upland game hunting
season is dependent on variable weather etc. – one season is just not enough to document
baseline opportunities and experiences when they are dependent on highly variable
interannual conditions.
10.7.7. Level of Effort and Cost
The estimated cost of the two-year study is $100,000.
10.7.8. Literature Cited
AEA (Alaska Energy Authority). 2011a. Susitna-Watana Hydroelectric Project, Socioeconomic,
Recreation, Air Quality and Transportation Data Gap Analysis. Prepared by HDR, Inc.,
Anchorage.
—. 2011b. Pre-application Document: Susitna-Watana Hydroelectric Project FERC Project
No. 14241. December 2011. Prepared for the Federal Energy Regulatory Commission,
Washington, DC.
Harza-Ebasco Susitna Joint Venture (Harza-Ebasco). 1985. Susitna Hydroelectric Project
Recreation Survey Report. Prepared for the Alaska Power Authority. Anchorage, Alaska.
Reed, S.E., J.L. Boggs and J.P. Mann. 2010. SPreAD-GIS: an ArcGIS toolbox for modeling the
propagation of engine noise in a wildland setting. Version 2.0. The Wilderness Society,
San Francisco, CA. U.S. Department of the Interior, National Park Service, Alaska
Regional Office. March 7, 2012.
Whittaker, D., B. Shelby, W. Jackson. 1993. Instream flows for recreation: a handbook on
concepts and research methods. U.S. Department of Interior, National Park Service
Rivers and Trails Conservation Program, Oregon State University, and National Park
Service. Water Resources Division.
Whittaker, D., B. Shelby, and J. Gangemi. 2005. Flows and recreation: a guide to studies for
river professionals. Report for Hydropower Reform Coalition and National Park Service
– Hydropower Recreation Assistance.
EMAIL RECORD
Record of Email Page 1 of 3
From: Klein, Joseph P (DFG) [mailto:joe.klein@alaska.gov]
Sent: Thursday, August 23, 2012 2:48 PM
To: Betsy McGregor
Cc: Benkert, Ronald C (DFG); Burch, Mark E (DFG); Erickson, Jack W (DFG); Fair, Lowell F (DFG); Fink, Mark J
(DFG); Giefer, Joe (DFG); Haught, Stormy B (DFG); Holen, Davin L (DFG); King, Kimberly N (DFG); Miller,
Monte D (DFG); Michael_Buntjer@fws.gov; Betsy_McCracken@fws.gov; eric Rothwell; Hill, Melissa E (DNR);
Schwarz, Terence C (DNR); Sager, Kimberly R (DNR); Ashton, William S (DEC)
Subject: RE: Follow up Meeting Notes-additional comments
Following are additional comments
Baseline Water Quality
5.5.4.3.2 In-Situ Water Quality Sampling The sampling protocol currently calls for monthly in-situ water
quality monitoring for the 4 summer months. It should be revised to include continuous (hourly or so) water
quality measurements for basic parameters (pH, DO, conductivity, turbidity), year-round if possible using in-situ
semi-permanent sensors (e.g. sondes). The technology is readily available and would provide very useful
baseline information to assess any post project impacts.
River Productivity
7.8.4.4 Conduct a literature/data search to identify existing river systems that could act as surrogates in
evaluating future changes to productivity in the Susitna River. We recommend supplementing or
substituting this section using a reference reach in a similar Alaska river using a BACI design monitoring
program in order to assess post project impacts.
From: Klein, Joseph P (DFG)
Sent: Thursday, August 23, 2012 10:42 AM
To: McGregor, Elizabeth A (AIDEA)
Cc: Benkert, Ronald C (DFG); Burch, Mark E (DFG); Erickson, Jack W (DFG); Fair, Lowell F (DFG); Fink, Mark J
(DFG); Giefer, Joe (DFG); Haught, Stormy B (DFG); Holen, Davin L (DFG); King, Kimberly N (DFG); Miller,
Monte D (DFG); Michael_Buntjer@fws.gov; Betsy_McCracken@fws.gov; Eric Rothwell
(Eric.Rothwell@noaa.gov); Hill, Melissa E (DNR); Schwarz, Terence C (DNR); Sager, Kimberly R (DNR); Ashton,
William S (DEC)
Subject: Follow up Meeting Notes
Betsy-
Thank you for the opportunity to discuss the proposed study plans for the Susitna-Watana Hydroelectric project.
We look to further discussions to continue to clarify study plan details.
To assist in you and your consultants in this process, below are brief notes by ADF&G staff. We may have
additional comments/or clarifications. Please feel free to contact me if you have any questions.
Regards, Joe
Fish Distribution and abundance in Upper, Middle and Lower Susitna River
Trot lines should considered during the winter to target appropriate fish species.
Minnow trapping under ice should be used during the winter, in all habitat types.
Should evaluate the feasibility of under ice videography.
EMAIL RECORD
Record of Email Page 2 of 3
Salmon Escapement
Identify locations of adult fish weir locations described on tributary streams (7.7.4.1.5, page 7-39).
Consider placement of adult fish weir upstream of the proposed dam on prominent Chinook salmon
streams.
Instream Flow
What is the sampling strategy (e.g. representative reach, mesohabitat typing) for the defined habitat
types?
How many and at what range will discharge-calibration sets be collected for each sampling method?
Will 2D modeling include side channels and sloughs within study area?
o Based on comments at the meeting it was my understanding it would.
What criteria will be used to identify cover types and substrate sizes?
For PHABSIM, will transects be independent, dependent or a combination and accordingly, what WSE
models and composite suitability index will be used?
What criteria will be used to select and weight transect-derived models?
Per the description of study sites for fish passage/off-channel connectivity (§6.5.4.5.5), what criteria
will be used to identify "a representative number" of different habitat types?
HSI data is needed for identified target species for each defined habitat type, over 2 years.
How will the data be aggregated to evaluate single flow recommendation?
Will a DSS-type program be available to review study results and if so, information is needed on it.
How do you envision the "collaborative process" will work? When will major decisions be made (e.g.
site and transect selections) and how often do you envision the work group will get together?
What equipment will be used and how will they be calibrated?
For the eulachon and boating studies, similar information is needed on what is the study area, what
sampling strategy will be used, how many and what range of calibration-discharge sets if appropriate,
and how will HSI curves will be developed?
Varial zone modeling, may need more defined time steps during analysis phase (possibly down to 15-
minute increments) depending on the rate of flow change over time.
Groundwater
What are the monitoring well placement sampling approach (e.g. equal spacing along linear transects,
etc.) and location (e.g. for instream flow, in all habitat types?) for the various resource studies (i.e.
instream flow, riparian instream flow, water quality). Also, a description of sampling intensity would
be helpful (i.e. for instream flow purposes, will the objective be to characterize entire gw/sw
interaction throughout entire intensive study site or only at select microhabitats).
What is the duration for monitoring (I believe at the meeting it would be from installation until winter
2013-14?)
How often will monitoring wells be calibrated for various parameters to be sampled pre- post- and
during field monitoring?
For each resource discipline, what parameters will be sampled and what are range of accuracies (e.g.
for water level +/- 0.1 ft?, water temp +/- 0.2 C?, etc.).
Water Quality
EMAIL RECORD
Record of Email Page 3 of 3
Information on availability of the Sampling and Analysis Plan and Quality Assurance Project Plan is
needed.
GW Quality in Selected Habitats (Section 5.5.4.7) - need more information on study. For example,
sampling intensity/number of site measurements per slough or criteria for how they will be
determined. Will ground water level monitors be installed if so, what is the sampling intensity
(numbers per habitat type) and duration of monitoring (e.g. continuous year-round/ point samples
during field visits, etc.). If not, it is strongly recommended groundwater monitoring be performed
concurrently with water quality monitoring in this study.
Any monitors should be calibrated pre- and post-monitoring along with multiple field measurements
for post monitoring calibration.
EMAIL RECORD
Record of Email Page 1 of 6
From: Betsy_McCracken@fws.gov [mailto:Betsy_McCracken@fws.gov]
Sent: Friday, September 07, 2012 4:02 PM
To: Betsy McGregor
Cc: Bryan Carey; 'Fullerton, Bill'; Betsy McGregor; Bob_Henszey@fws.gov; eric Rothwell; 'Klein, Joseph P
(DFG)'; 'Kevin Fetherston'; 'Matthew LaCroix'; 'Laura Arendall'; 'Mike Buntjer'; 'MaryLou Keefe'; 'Michael R. Lilly,
GW Scientific'; PHilgert@r2usa.com; rob.plotnikoff@tetratech.com; 'Benkert, Ronald C (DFG)'; susan walker;
'William Rice'; matt.cutlip@ferc.gov; Lori_Verbrugge@fws.gov; Catherine_Berg@fws.gov;
Jennifer_Spegon@fws.gov; dreiser@r2usa.com
Subject: Follow up comments from August 15-17 ILP meetings
Hi Betsy,
Thank you and AEA for hosting the August ILP meetings. We all gained a lot of insight from the meetings, and
we were pleased to be updated. Like others, as a result of the meetings, the Service has a few comments and
concerns to share with the group.
In addition to these below, other staff from the Service may provide comments relative to their study area
expertise. We hope that our collective comments will be helpful toward gaining concurrence on proposed
studies, and as we move forward with the review process of the proposed Watana dam.
Thank you,
Betsy
_________________________________________________________________________________________
_________________________________
September 7, 2012
Notes from ILP Formal Study Meetings August 15-17, 2012:
At the request of AEA and its consultants, the USFWS (Service) submits this brief summary of concerns
regarding the Susitna-Watana hydropower dam formal ILP Formal Study meetings that were held August 16-17,
2012. The Service’s concerns in this informal correspondence, along with other remaining concerns will be
further articulated in the Service’s formal response letter on AEA’s ILP Proposed Study Plan (PSP) review, due
to FERC October 15, 2012. Additional informal comments from the Service may be provided under separate
cover before the October due date.
FWS concerns highlighted during meetings relative to Instream Flow, Habitat Utilization and the
Geomorphology proposed study plans:
Overall, the Service finds that AEA’s proposed study plans for instream flow, habitat utilization and
geomorphology do not fully address agency’s resource management concerns. During the three days of ILP
study meetings, sequencing and integration of the proposed biological resource studies and the physical
process studies was not described and is still a significant outstanding information need. It is necessary to
describe the integration of these inter-related studies and how that integration will result in a comparison of the
baseline biological information and the resulting effects to biologic resources caused by the proposed project
operations. Study results must be quantifiable in order to assess potential losses to aquatic resources and their
habitats, to review the project under our relevant fish and wildlife resource conservation authorities, to inform
fishway prescription authority under Section 18 of the Federal Power Act, and to eventually develop
recommended protection, mitigation, and enhancement for the project license. We do not believe that the
current study plan proposals will yield sufficient information to allow us to adequately assess proposed project
impacts to the Nation’s fish and wildlife resources and develop adequate PME’s.
EMAIL RECORD
Record of Email Page 2 of 6
The Service has repeatedly articulated concerns about the lack of study sequencing, connectivity and
integration between the biological studies and the other proposed engineering and physical processes studies.
We reiterate and highlight the need for the collection of adequate temporal and spatial baseline biological and
fish habitat data to provide direct input to some of the proposed physical modeling efforts. Many of our
concerns, below, are related to the temporal mismatch of biological data collection with the forward momentum
of the physical modeling efforts.
-Habitat Mapping
Hierarchially-nested aquatic habitats- HDR stated at the meeting that the “habitat mapping” will be started in
September; and that the sampling will be stratified by meso-habitat type as identified in the 1980’s study reports.
The 1980’s studies did not hierarchically nest the habitat types. The Service specifically requested hierarchially
nested habitat mapping (e.g., Frissel et al, 1986). We are concerned with the proposal to use the 1980’s study
sites, which focus on the side sloughs, and do not consider the full breadth of fish habitats, which is currently
unknown and the subject of ongoing study that has not been completed or submitted for agency review and
comment. We do not endorse the use of the 1980’s sites without out first completing and then applying a
hierarchal assessment of the river reaches as a study framework. The hierarchally nested aquatic habitats
framework is needed to structure fish distribution surveys, the instream flow study and other physical process
studies. Without it, the fish surveys will be too narrowly constrained and the instream flow studies will not
represent all habitats that may be affected by the proposed project. The Service recommends the following
habitat hierarchy for the Susitna River be used for habitat mapping purposes and integration of studies:
Large River Floodplain Habitat Hierarchy
1. Geomorphic units: Large-scale geomorphic and hydraulic controls.
a. Bedrock controlled, single-channel units with shallow hyporheic exchange and thermal homogeneity.
b. Unconfined, multiple channel floodplain units with expansive hyporheic exchange and thermal
heterogeneity.
2. Macrohabitats: Primary, flood, and spring channel networks.
a. Primary channels—Perennial channels.
b. Flood channels—Seasonally connected channels.
c. Spring channels—Disconnected sloughs that discharge groundwater.
d. Floodplain ponds—Ponded spring channel networks.
3. Mesohabitats: Bed and bank morphological controls; hydraulic features.
a. Riffle-pool sequences—Run, riffle, pool, glide, tailout.
b. Backwaters, alcoves, shallow meander margins.
4. Microhabitats: Hydraulics, water quality, substrate, cover.
a. Water depth, velocity, bulk flow characteristics (e.g. Reynolds and Froude #’s).
b. Vertical hydraulic exchange (ground and surface water exchange).
c. Bed, or intragravel temperature and dissolved oxygen.
d. Substrate size, heterogeneity.
EMAIL RECORD
Record of Email Page 3 of 6
e. Elements of wood, vegetation, and rock structure.
-Fish distribution: A first step is to assess the seasonal distributions of target species and life stages and the
physical habitat criteria that influence habitat selection and suitability. As a first step, target species have to be
identified, agreed upon, and their life history and habitat use similarities to other, unstudied species (i.e., non-
target species) need to be determined and described. In the study requests of the Service and other agencies,
we recommended studying the baselines of all affected fish species and life stages, including all five species of
anadromous salmon and all resident fish.
Fish distribution data are needed to describe the baseline data to support and compliment other proposed study
objectives, including those related to fish habitat selection and utilization. A first step to acquiring adequate fish
distribution is to assess the full lateral and longitudinal profile of seasonal fish distribution, life stage periodicity,
and suitable used and unused habitats that are influential in fish habitat site selection. The fish distribution data
is needed to provide the base data layer that will support and compliment other proposed study objectives,
including those related to fish habitat selection and utilization, and instream flow (ISF) needs. This information
is also needed for resource agencies’ fishway prescription decisions under the Federal Power Act. Baseline
biological information is critical input necessary for integration with physical studies. Accordingly, the Service is
reiterating the need for multiple and continuous years of biologically relevant data in order to provide robust
integration with the physical modeling studies, and decision-support relative to fish and wildlife resources of the
Susitna River basin.
-Habitat site selection criteria: Criteria that influence habitat selection and suitability need to be identified
using statistically powerful and robust methods and current models of fish distribution including bioenergetics
and not exclusively physical habitat models (Lovtang 2005). The Service remains opposed to the proposal to
repeat the 1980’s approaches to fisheries studies. The 1980’s studies do not determine the habitat criteria
influencing fish habitat site-selection, they simply report utilization functions for water depth and velocity, or
depth and substrate. They also lack a fundamental baseline assessment of all available fish habitat and instead
focus on study of habitats that had high fish use density. The habitats that were apparently suitable but
unoccupied or underutilized by fish need to be assessed, and the entire range of habitat availability and habitat
use data need to be assessed prior to habitat study site selection.
More comprehensive data collected on nearby glacial rivers may be used to demonstrate that habitat selection
by salmon in side-sloughs can be independent of water depth and velocity and should be compiled.
Fish habitat study sites should be surveyed and identified using the full range of habitats seasonally utilized by
agreed-upon target species and life stages. The objective is to identify the bioenergetics and physical factors
that control fish habitat selection. The Service considers the assessment of habitat influential to fish habitat site
selection to be an objective of the Instream Flow and Habitat Utilization Study request. In the resource agencies
Instream Flow and Habitat Utilization Study Plan requests, this is a specifically stated objective.
Sequentially, appropriate flow-habitat models can be selected after assessment and validation of 1) the full
seasonal distribution of target species and life stages,2) the physical factors (e.g., micro-habitat data) that
influence habitat selection and suitability, and 3) the bioenergetic factors affecting fish habitat suitability and
productivity.
Thus, field visits proposed for the end of September (2012) should be considered as reconnaissance and for
discussion purposes, and not for the purpose of actual study site-selection.
-Habitat Suitability Indices: Methods for collecting site-specific habitat criteria for the glacial Susitna River
need to be collaboratively identified. (As recommended in the resource agencies study plan request for Instream
Flow and Habitat Utilization). These criteria also need to be evaluated in the context of the hierarchical habitat
model, such that habitat criteria are determined and evaluated in all habitats of importance to each agreed-upon
target species and life stage.
The 1980’s studies were inconclusive in demonstrating a relationship between fish habitat criteria and fish
distribution, and they were also narrowly focused on associations of spawning and rearing salmon with water
EMAIL RECORD
Record of Email Page 4 of 6
depth and velocity in spring channels (side sloughs). Not only is this not representative of existing habitat and
the distribution of fish within those habitats, habitat data collected from nearby glacial rivers demonstrates that
spawning habitats selection is independent of flow depth and velocity in side sloughs and may be profoundly
influenced by bioenergetics and the input of organic matter .
This indicates that traditional hydraulic modeling (e.g., PHABSIM), as proposed, may be an insufficient fish
focus/tool. So, first we need to identify criteria that are influential to habitat selection, within the full seasonal
distributions of agreed-upon target species and life stages. Only then, after this has been adequately
determined, can we begin to develop utilization functions (curves or HSC) for those criteria.
The Service has previously expressed concern with the approach of repeating the 1980’s study effort, and we
have repeatedly asked for both a complete compilation of available data, and a review of the 1980’s information
prior to accepting its use for the proposed project. Lacking that review, we independently note that, in the
1980’s sites were selected that were, presumably, heavily utilized by spawning sockeye and chum (qualitative).
Study sites need to be based on relevant criteria related to physical habitat site selection as documented by fish
distribution and lack thereof.
-Groundwater- The integration of the groundwater study efforts with the biological studies is not clear.
Specifically, how will the groundwater study be made relevant to the scale of fish habitat and fish habitat site
selection in the Susitna River? The objectives of the groundwater study should include relevance to the
hierarchially nested habitats, including macro-, meso-, and micro-habitats that are influential to fish habitat
selection. The groundwater study sampling design should be relevant to fish habitat and site selection. A
specific objective needs to be measuring the hydraulic gradient/head (upwelling or downwelling) under the
existing hydrograph and under the proposed project hydrograph release flow schedule.
-Model selection: We need to first determine what criteria are important to fish habitat site/suitability and
selection before we can choose an appropriate flow-habitat model. ADFG Marine Mammals biologist, Dr. Bob
Small also reiterated this very same point regarding model selection for the beluga whale studies. Again, the
Service notes our concern about the limited focus of the 1980’s studies and using PHABSIM. Our concerns
stated in earlier correspondence to AEA remain unaddressed and are reiterated here for emphasis.
Model sensitivity and relevant criteria (inputs) are critical to achieving statistically valid outputs. At this point, it is
premature to select a model until we have known 1) fish distribution, and 2) identification of variables influential
to fish habitat site selection.
-Biometric Review- The Service previously requested a biometric review of the 1980’s findings. This request is
remains outstanding and should be conducted prior to basing any study plans on 1980’s studies or results. In all
cases, including the usage of the 1980’s Su-hydro data results and for the Susitna-Watana study plans,
estimates of precision and accuracy of study results is required to evaluate the power of any study plan. Details
of proposed study plan sampling and design methods need to be explicit and statistically valid with a priori
determination of levels of precision and accuracy of model outputs.
-Fish genetics- During the August 15-17 meetings, AEA stated that genetic samples from the Chinook above
the proposed dam site would not be collected. The stated rationale was due to the desire to minimize the
handling of the fish after subsequent tagging of fish. Genetic samples of Chinook at locations above the
proposed Susitna-Watana dam site are crucial to informing the Service’s management goals specific to
recommending licensing conditions under the Federal Power Act, and to conservation recommendations under
the Fish and Wildlife Coordination Act, and the Anadromous Fish Act. As such, we consider our request for
collection of genetic samples from Chinook salmon, and other fish species to be necessary for our resource
evaluation of the Susitna-Watana hydropower project.
Because of this information need, if AEA does not plan to collect the information, AEA should document how
this study request is being addressed.
Fish species genetic samples used for comparisons should be less than ten years old to reflect current gene
frequencies among the sampled fish populations. Genetic samples for salmon exist for some tributaries in the
EMAIL RECORD
Record of Email Page 5 of 6
lower and middle Susitna River. Some of these samples are greater than ten years old.
Fish genetic samples should be current and include samples of the Chinook migrating above the proposed dam
location. Because gene frequencies change over time, all genetic samples should be within the most recent ten
years to allow for valid comparison. Genetic analysis should analyze the existing extent of genetic differentiation
within and between fish using distinctly different habitats. We request genetic analysis of Chinook above the
proposed dam site relative to those at other upper, middle and lower river and tributary sample locations.
-Fish Passage/fishway prescription- The Service is concerned with the lack of transparent discussion about
the potential for fish passage alternatives at the proposed Susitna-Watana dam. If fish passage is required, how
will that be accomplished? If it is not feasible, what is your alternative proposal? Where is your project
assessment of the fish passage feasibility? What are the design criteria being considered/evaluate d?
-Compensatory Mitigation- Compensatory mitigation is determined as part of a mitigation sequence after
avoidance, and minimization efforts. The Service has inquired about potential compensatory mitigation for
project impacts during several meetings. To date, this concern has not satisfactorily been addressed by the
project sponsors or project consultants. Because compensatory mitigation is a requirement in order to offset
unavoidable projects impacts to fish and wildlife resources and their habitats, it is should be considered
throughout the review process. Please explain how you plan to quantify existing habitats, and quantify primary,
secondary and cumulative (40cfr Part230 of the CWA) losses to those habitats under the proposed operational
flows over the temporal scale of the license period. How will habitats change proportionally under project
operations?
-Lower river- The Service is concerned with AEA consultants’ proposal to establish a lower boundary for the
physical studies (e.g., geomorphology, instream flow) at a location “downstream of Sunshine” at approximately
river mile 75, and not extend the study efforts further down into lower river to inform the biological studies. There
are many biological resource studies that would necessarily be informed by establishing a consistent study
boundary between the physical and biological studies. For example, studies related to the federally listed Cook
Inlet beluga whale, fish species and habitats, including the resident species, and anadromous salmon a nd
eulachon (beluga whale prey species). The lower river also includes the Susitna Flats State Game Refuge. If the
physical studies boundary is terminated at river mile 75, there will be no ability to relate or integrate biological
data to those studies (e.g., geomorphology, ISF, ice processes, flow routing). Resource agencies management
goals would effectively not be addressed below river mile 75, if project effects are not assessed to the mouth of
the river.
According to USACE (1966), 80% of the ability to produce accurate model results depends on using
appropriate bathymetry data, mesh design, and boundary conditions. The amount of time needed to collect this
information, particularly the bathymetry data, depends on the complexity of the channel’s geometry, which is
known to be complex in the lower Susitna River. Because data collection in the lower river will likely require
rigorous field collection due to the channel complexity, it is critical to initiate these efforts in a time sensitive
manner. The proposal to delay work in the lower river pending analysis at an arbitrary, and certainly non-
biologically relevant location, does not meet resource agencies objective of evaluating the potential project
impacts to fish and wildlife resources in the lower Susitna River. This is particularly true under the FERC ILP
process timeline specific to the Susitna-Watana dam project.
-Studies integration: A “map” or chart of how studies are proposed to be integrated is needed. AEA sponsors
and consultants, committed to providing this by September. Biological resource components are currently not
integrated or connected to the other studies, and appear as being treated independently of the rest of the study
requests. Study proposals must demonstrate how they will be integrated to provide needed resource
information.
Studies/components not address from the Non salmon anadromous, resident and invasives fish species
study request: During the August ILP meetings, the follow Service requests were preliminarily noted as not
being addressed or adequately addressed by AEA’s PSPs.
EMAIL RECORD
Record of Email Page 6 of 6
1) Marine derived nutrients contribution from non salmon anadromous species. The Service requested
information in our non-salmon anadromous, resident and invasive study plan request. It is not clear which study
proposal it is addressing this request, or IF it is being addressed. During the August 15-17 meetings, it was
indicated that it may be addressed in either the riparian instream flow, the terrestrial wildlife, the river
productivity or elsewhere. However, AEA’ s consultants were unable to specifically “point to it” when asked. It
does not appear to have been included in the PSPs.
2) Resource valuation of non-salmon anadromous and resident fish resources. During the meeting, AEA
consultants stated that a resource valuation would not be provided, as requested in the Service’s study request
for non salmon anadromous, resident and invasive fish study. An explanation of why this assessment will not be
addressed was not provided. We request that an explanation be provided that describes the rationale for this
determination and urge reconsideration of our study request.
3) Trophic ecology- The Service requested information on trophic ecology in the non salmon anadromous,
resident and invasive species study request. Michael Link stated that there are “significant predator-prey
dynamics” particular once fish move out of the mainstem; using this behavior to explain why fish hold there until
they are ready to dash to tributaries. He noted that the creeks are heavily preyed upon by bears, for example.
Dr. Bob Small (ADFG) recommended trophic ecology and/or foraging ecology information for the Cook Inlet
beluga whale studies. For fish, coordination with Tim Nightengale (AEA’s consultant; via teleconference) stated
that he would take gut samples from fish to see what macro-invertebrates they are eating, and when, and will
work with fish study teams to do some trophic analysis. The trophic ecology component needs to be clearly
spelled out in a study plan identifying any aspects that will and will not be addressed explained and with
appropriate rationale.
References:
Frissell, C. A., W. J. Liss, C. E. Warren, and M. D. Hurley. 1986. A hierarchical framework for stream habitat
classification: viewing streams in a watershed context. Environmental Management 10:2. Pp. 199-214.
Lovtang, J. C. 2005. Distribution, habitat use, and growth of juvenile Chinook salmon in the Metolius River
Basin, Oregon. M.S. Thesis, Oregon State University. March 2005.
USACE 1966. (Full citation will be provided in follow-up correspondence)
Betsy W. McCracken
Fishery Biologist
Conservation Planning Assistance
Ecological Services
US Fish and Wildlife Service/Region 7/Anchorage Field Office
Betsy_McCracken@fws.gov
(907) 271 - 2783
EMAIL RECORD
Record of Email Page 1 of 4
From: Bob_Henszey@fws.gov [mailto:Bob_Henszey@fws.gov]
Sent: Tuesday, September 11, 2012 12:26 PM
To: 'Kevin Fetherston'; Betsy McGregor
Cc: Catherine_Berg@fws.gov; Ann_Rappoport@fws.gov; Betsy_McCracken@fws.gov;
Jennifer_Spegon@fws.gov; Lori_Verbrugge@fws.gov; Michael_Buntjer@fws.gov; chiska.derr@noaa.gov; Klein,
Joseph P (DFG); 'Matthew LaCroix'; 'Michael R. Lilly, GW Scientific'; eric Rothwell; susan walker; 'William Rice';
matt.cutlip@ferc.gov; dreiser@r2usa.com
Subject: PSP 6.6 Riparian Instream Flow Study Plan - Interim Comments
Kevin,
The following are some of the key differences the USFWS sees between our study plan request (USFWS 10.1,
Instream Flows for Floodplain and Riparian Vegetation Study) and AEA's proposed study plan (PSP 6.6,
Riparian Instream Flow Study). The differences and comments listed below are likely not inclusive, since we
have not had a chance to fully evaluate the PSP.
Many of the PSPs rely upon or provide data from/for other studies. Recognizing these relationships is an
important part of the Integrated Licensing Process (ILP); however, the study providing the data should describe
the methodology and oversee the data collection and analyses, while the study requiring the results should
restrict its discussion to the types of data/results required from other PSPs. Repeating the methods in a study
not responsible for the data collection and analyses is unnecessary and risks confusion if the methods differ or
are inadequate in one of the studies. Since the Riparian Instream Flow PSP will rely upon data from the
Groundwater PSP, the Riparian Instream Flow PSP should describe only the results required from the
Groundwater PSP, and then describe how those results will be used in the Riparian Instream Flow PSP (e.g.,
5.7 Groundwater PSP should be the only PSP that describes the groundwater methods). This applies to other
PSPs, such as the habitat mapping studies that may be providing data for this PSP.
Study Goals and Objectives: The USFWS requested a specific goal that included quantifying the frequency,
timing and duration of surface-water and groundwater levels required to establish, maintain, and promote
floodplain and riparian plant communities. Two ancillary goals were also requested to quantify the frequency
and rate of sediment deposition required to promote soil development, and to quantify the effect of river ice on
the establishment and persistence of riparian plant communities. Section 6.6.1.1 of the PSP has no stated goal,
and only a general approach is provided. An "overarching goal" is provided in the Section 6.6.4 Study Methods,
but this goal is also very general. While goals can be very general in nature, the specifics in our goal set the
stage for a rigorous study plan to evaluate potential project-related effects on floodplain plant communities.
The USFWS requested six objectives to help meet our goal. Three of the PSP objectives are similar to our
requests {1) Synthesize 1980s data, 2) Study sites, and 6) Seed dispersal}, but they lack the additional specifics
stated in our requested objectives. Two of the PSP objectives appear to be wholly or at least partially the
objectives for other PSPs and not appropriate as stated {3) Map riparian vegetation, and 10) Impacts to shallow
groundwater well users}. What the PSP objectives lack, however, are our specific requests for river ice,
sediment deposition, and water-level regime (USFWS Objectives 4, 5, and 6). These missing objectives may be
studied under AEA’s PSP objectives, but the USFWS prefers they be considered as standalone objectives, and
possibly integrated into a single modeling objective after they have been studied individually. The USFWS is
particularly interested in our Objective 6 to characterize the water-level regime required to maintain floodplain
and riparian plant communities. Much of the discussion so far has focused on floodplain plant succession, but
little or no discussion so far has involved maintenance flows. Succession is important, but without maintenance
flows whole floodplain plant communities may collapse or the direction of succession changed to an unnatural
target (e.g., non-floodplain plant communities).
Study Area: The USFWS agrees with the PSP study area and four river segments, with the following additional
comments. The width of the active valley should also include the distance from the River that the River
influences groundwater, as well as define the return interval for both groundwater and flooding (e.g., 100-year
event under current or climate-change induced conditions). Much discussion has centered on the downstream
EMAIL RECORD
Record of Email Page 2 of 4
influence of the Project. The PSP study area Lower Reach would extend to RM 0. Will this lower extent remain
even if all agree that the Project influence on surface- and ground-water becomes indistinguishable from normal
environmental variation?
Study Methods: The methods need to follow the order of the objectives and use section headings that refer to
the intent of the objectives. Few methods are referenced, and some references that are cited are not included
in the literature cited. The relationship with other PSPs often seems confusing. It would be more helpful to state
what results will be required from PSP "x" to evaluate a Riparian ISF objective, and potentially what results from
a Riparian ISF objective will be required by PSP "y." It is not necessary to repeat coordination for every
objective, only state the inputs required and the outputs provided by an objective. This applies across PSPs
and among a PSP's objectives. The following comments on methods follow the order of the Objectives
requested by the USFWS:
RIFS-1 Synthesize Historical Data: In addition to other North American hydro-projects, this review should also
include a review of relatively undisturbed riverine systems.
RIFS-2 Select and Design Study Sites: The number of study sites should provide sufficient replication to
address the needs of the objectives, and should include sites where Project operation is expected to cause early
channel bed degradation or aggradation. The casual reference to pseudoreplication in one of the other
objectives needs to be addressed at the study-site level. Study sites are typically the experimental unit where
replication is used for true statistical analysis. All other sampling (e.g., within the study site) is really
subsampling used to obtain a better average value for that one replicate. As envisioned by many of the PSPs,
the "representative" study sites are really only one replicate for each process-domain. For more on
pseudoreplication see:
Hurlbert, Stuart H. 1984. Pseudoreplication and the Design of Ecological Field Experiments. Ecological
Monographs 54:187–211. http://dx.doi.org/10.2307/1942661
RISF-3 Characterize Seed Dispersal and Frequency of Establishment: Not sure where this objective is
addressed in the PSP. It appears to be scattered across several sections in the methods. If the methods have
been described by other similar projects, then cite their methods if appropriate and include enough details to
help others understand the methods that will be used. How will the Susitna River bimodal peak flows be
addressed? On a float trip down the Susitna 27-29 July 2012, there were newly emerging dicot seedlings on the
sandbars. How will the fate of these "second peak" seedlings be addressed? How will the role of precipitation
in maintaining favorable soil moisture conditions be evaluated? Will soil texture be considered? If so, how will
the soil profile be described?
In Section 6.6.4.3.1.4: Is "abundance" density or some other metric? What is "elevation" referenced to: ASL,
an arbitrary datum, or some elevation that can be linked to the local river or groundwater stage (keep in mind
the river drops downstream, so that must be accounted for also)? Is there a citation for others using 2-meter
square plots? What is the shape of these plots? A square plot may not be appropriate for a narrow band of
seedlings along a specific elevation in the gradient above the river. MODFLOW is a groundwater model, and
many not be sensitive enough to quantify hydroperiod relationships for seedlings. What other metrics will be
used to quantify/separate surface water, groundwater, soil moisture, precipitation, and other potential
hydrological process that support seedling establishment and recruitment?
How will the results from this objective be used to predict potential Project-related changes in seedling
establishment and recruitment into the population?
RISF-4 Characterize the Role of Ice in the Establishment, Survival and Recruitment of Riparian Species: The
discussion on ice processes (Section 6.6.4.4.1) seems unfocused, and essentially provides no discernible
methods: "Final details of the geomorphology and ice processes modeling ... will be developed as the 2012
studies are obtained." The goal of this study should be to characterize the role of river ice in the establishment
(colonization), survival (first 3 years) and recruitment into the future reproductive population of dominant riparia n
species (e.g., balsam poplar, willows). Have others investigated the role of ice on riparian plant communities?
EMAIL RECORD
Record of Email Page 3 of 4
If so, can their methods be used here? How will the magnitude, frequency, and longitudinal distribution of ice
events affecting dominant riparian species/communities be evaluated?
RISF-5 Characterize the Role of Sediment Deposition in the Formation of Soils: The proposed soil sampling
techniques are included in Section 6.6.4.3.1.5, but based on these techniques it is unclear how the USFWS
requested objective to characterize the role of sediment deposition in the formation of floodplain and riparian
soils, and how sediment deposition affects the rate and trajectory of plant community succession. This objective
should investigate the rate of deposition, depth of sediment, and soil profile development required for natural
floodplain plant community succession, and then use the predicted sediment deposition characteristic from the
Fluvial Geomorphology Study to predict the effects of Project operation on floodplain plant communities.
Sampling to only a depth of 50 cm, and describing cumulative thickness of all organic horizons and loess
(windblown material?) without stratigraphy will likely be insufficient to meet this objective. Soil texture by feel
should follow standard techniques (e.g., Thien 1979, http://soils.usda.gov/education/resources/lessons/texture/).
RISF-6 Characterize Water-Level Regime Required to Maintain Floodplain and Riparian Plant Communities:
This is a critical objective that has not been sufficiently discussed in past workgroup meetings, possibly due to
lack of time, and the PSP methods are insufficient to evaluate if the USFWS requested objective will be met.
Suggest this objective be discussed near the beginning of future meetings to allow sufficient time for
discussion.
Objective 6 combines hydrologic information from the groundwater study (PSP 5.7) and the plant community
information from this study (PSP 6.6) and possibly the habitat mapping studies (PSPs 9.6 and 9.7) to produce
plant species/community response curves. The USFWS's Objectives RISF-3 to RISF-5 target critical stages in
plant community succession, while RISF-6 targets critical instream flows required for maintaining plant
communities as succession progresses (i.e., both succession and maintenance are important).
The methods for groundwater belong in the Groundwater PSP, and not in this PSP for reasons discussed
above. This PSP should request the required hydrologic information from PSP 5.7 and begin the discussion
from that point. The following comments, however, include the pertinent groundwater methods that should be
discussed in PSP 5.7.
Section 6.6.4.5 (Groundwater): The suggested four to six intensive study reaches instrumented with
groundwater and surface-water recording instruments may be insufficient to address this objective if plant
response will be described by process-domains (see pseudoreplication discussion above). However, hydrology
is likely the most dominant physical factor required for maintaining floodplain plant communities across the
various process-domains, and baring some other dominant physical factor (e.g., soil parent material, weather,
etc.) it may be possible to use data from the individual intensive study-site transects to build response curves
(see Henszey et al. 2004 {ne.water.usgs.gov/platte/reports/wetlands_24-3.pdf}, Figure 7 for an indication of the
number of data points required to build a response curve).
One-and-a-half growing seasons (July 2013 to September 2014) will likely provide insufficient groundwater
hydrology data to fit individual species response curves (especially for annual species), and may not be enough
data to reasonably predict groundwater relationships with river stage and to verify the model predictions with
independent data. Precipitation may also dramatically affect transient but critical groundwater levels (a few days
to a week or more of elevated water levels), which would be difficult to evaluate with limited data. How will
these potential problems be addressed?
What are the "project accuracy standards used for water-level measurements" for horizontal, vertical and
temporal measurements?
In addition to the Work Products described in Section 6.6.4.5.2, the products should provide water-level
summary statistics for each location (e.g., point, plot, or transect) that will be used to test and fit plant response
curves, such as growing season cumulative frequency, 7-day moving average, 10-day moving average, 14-day
moving average, and arithmetic mean (see Henszey et al. 2004 {ne.water.usgs.gov/platte/reports/wetlands_24-
3.pdf}, Table 1).
EMAIL RECORD
Record of Email Page 4 of 4
Section 6.6.4.7 (Succession Models and Flow Response Guilds) appears to potentially address the USFWS's
Objective 6 request; however, two critical referenced papers (Merritt et al. 2010 and Pearlstine et al. 1985) were
not included in the Literature Cited. These references were not provided until 8/28/2012, and the USFWS has
had insufficient time to review these papers in detail. The concept of the PSP response guilds is similar to the
USFWS's request to develop plant community response curves, but the PSP methods are insufficient to
evaluate if our requested Objective 6 will be met. The USFWS requested evaluating specific water-level
summary statistics (see above discussion for groundwater) with a rigorous curve-fitting technique similar to
Henszey et al. (2004). The methods should provide sufficient detail to show how quantifiable (not qualitative)
hydrologic (surface-water and groundwater) gradients will be constructed to show the optimum and range of
favorable water levels required for maintaining floodplain species/communities.
____________________________________
Robert J. Henszey, Ph.D.
Fish & Wildlife Biologist
Conservation Planning Assistance
US Fish & Wildlife Service
101 12th Avenue, Room 110
Fairbanks, AK 99701
Phone: 907-456-0323, Fax: 907-456-0208
Bob_Henszey@fws.gov
APPENDIX 4
INFORMAL CONSULTATION DOCUMENTATION
SECTION 7 – HYDROLOGY-RELATED RESOURCES
EMAIL RECORD
Record of Email Page 1 of 3
From: Klein, Joseph P (DFG) [mailto:joe.klein@alaska.gov]
Sent: Thursday, August 23, 2012 2:48 PM
To: Betsy McGregor
Cc: Benkert, Ronald C (DFG); Burch, Mark E (DFG); Erickson, Jack W (DFG); Fair, Lowell F (DFG); Fink, Mark J
(DFG); Giefer, Joe (DFG); Haught, Stormy B (DFG); Holen, Davin L (DFG); King, Kimberly N (DFG); Miller,
Monte D (DFG); Michael_Buntjer@fws.gov; Betsy_McCracken@fws.gov; eric Rothwell; Hill, Melissa E (DNR);
Schwarz, Terence C (DNR); Sager, Kimberly R (DNR); Ashton, William S (DEC)
Subject: RE: Follow up Meeting Notes-additional comments
Following are additional comments
Baseline Water Quality
5.5.4.3.2 In-Situ Water Quality Sampling The sampling protocol currently calls for monthly in-situ water
quality monitoring for the 4 summer months. It should be revised to include continuous (hourly or so) water
quality measurements for basic parameters (pH, DO, conductivity, turbidity), year-round if possible using in-situ
semi-permanent sensors (e.g. sondes). The technology is readily available and would provide very useful
baseline information to assess any post project impacts.
River Productivity
7.8.4.4 Conduct a literature/data search to identify existing river systems that could act as surrogates in
evaluating future changes to productivity in the Susitna River. We recommend supplementing or
substituting this section using a reference reach in a similar Alaska river using a BACI design monitoring
program in order to assess post project impacts.
From: Klein, Joseph P (DFG)
Sent: Thursday, August 23, 2012 10:42 AM
To: McGregor, Elizabeth A (AIDEA)
Cc: Benkert, Ronald C (DFG); Burch, Mark E (DFG); Erickson, Jack W (DFG); Fair, Lowell F (DFG); Fink, Mark J
(DFG); Giefer, Joe (DFG); Haught, Stormy B (DFG); Holen, Davin L (DFG); King, Kimberly N (DFG); Miller,
Monte D (DFG); Michael_Buntjer@fws.gov; Betsy_McCracken@fws.gov; Eric Rothwell
(Eric.Rothwell@noaa.gov); Hill, Melissa E (DNR); Schwarz, Terence C (DNR); Sager, Kimberly R (DNR); Ashton,
William S (DEC)
Subject: Follow up Meeting Notes
Betsy-
Thank you for the opportunity to discuss the proposed study plans for the Susitna-Watana Hydroelectric project.
We look to further discussions to continue to clarify study plan details.
To assist in you and your consultants in this process, below are brief notes by ADF&G staff. We may have
additional comments/or clarifications. Please feel free to contact me if you have any questions.
Regards, Joe
Fish Distribution and abundance in Upper, Middle and Lower Susitna River
Trot lines should considered during the winter to target appropriate fish species.
Minnow trapping under ice should be used during the winter, in all habitat types.
Should evaluate the feasibility of under ice videography.
EMAIL RECORD
Record of Email Page 2 of 3
Salmon Escapement
Identify locations of adult fish weir locations described on tributary streams (7.7.4.1.5, page 7-39).
Consider placement of adult fish weir upstream of the proposed dam on prominent Chinook salmon
streams.
Instream Flow
What is the sampling strategy (e.g. representative reach, mesohabitat typing) for the defined habitat
types?
How many and at what range will discharge-calibration sets be collected for each sampling method?
Will 2D modeling include side channels and sloughs within study area?
o Based on comments at the meeting it was my understanding it would.
What criteria will be used to identify cover types and substrate sizes?
For PHABSIM, will transects be independent, dependent or a combination and accordingly, what WSE
models and composite suitability index will be used?
What criteria will be used to select and weight transect-derived models?
Per the description of study sites for fish passage/off-channel connectivity (§6.5.4.5.5), what criteria
will be used to identify "a representative number" of different habitat types?
HSI data is needed for identified target species for each defined habitat type, over 2 years.
How will the data be aggregated to evaluate single flow recommendation?
Will a DSS-type program be available to review study results and if so, information is needed on it.
How do you envision the "collaborative process" will work? When will major decisions be made (e.g.
site and transect selections) and how often do you envision the work group will get together?
What equipment will be used and how will they be calibrated?
For the eulachon and boating studies, similar information is needed on what is the study area, what
sampling strategy will be used, how many and what range of calibration-discharge sets if appropriate,
and how will HSI curves will be developed?
Varial zone modeling, may need more defined time steps during analysis phase (possibly down to 15-
minute increments) depending on the rate of flow change over time.
Groundwater
What are the monitoring well placement sampling approach (e.g. equal spacing along linear transects,
etc.) and location (e.g. for instream flow, in all habitat types?) for the various resource studies (i.e.
instream flow, riparian instream flow, water quality). Also, a description of sampling intensity would
be helpful (i.e. for instream flow purposes, will the objective be to characterize entire gw/sw
interaction throughout entire intensive study site or only at select microhabitats).
What is the duration for monitoring (I believe at the meeting it would be from installation until winter
2013-14?)
How often will monitoring wells be calibrated for various parameters to be sampled pre- post- and
during field monitoring?
For each resource discipline, what parameters will be sampled and what are range of accuracies (e.g.
for water level +/- 0.1 ft?, water temp +/- 0.2 C?, etc.).
Water Quality
EMAIL RECORD
Record of Email Page 3 of 3
Information on availability of the Sampling and Analysis Plan and Quality Assurance Project Plan is
needed.
GW Quality in Selected Habitats (Section 5.5.4.7) - need more information on study. For example,
sampling intensity/number of site measurements per slough or criteria for how they will be
determined. Will ground water level monitors be installed if so, what is the sampling intensity
(numbers per habitat type) and duration of monitoring (e.g. continuous year-round/ point samples
during field visits, etc.). If not, it is strongly recommended groundwater monitoring be performed
concurrently with water quality monitoring in this study.
Any monitors should be calibrated pre- and post-monitoring along with multiple field measurements
for post monitoring calibration.
EMAIL RECORD
Record of Email Page 1 of 6
From: Betsy_McCracken@fws.gov [mailto:Betsy_McCracken@fws.gov]
Sent: Friday, September 07, 2012 4:02 PM
To: Betsy McGregor
Cc: Bryan Carey; 'Fullerton, Bill'; Betsy McGregor; Bob_Henszey@fws.gov; eric Rothwell; 'Klein, Joseph P
(DFG)'; 'Kevin Fetherston'; 'Matthew LaCroix'; 'Laura Arendall'; 'Mike Buntjer'; 'MaryLou Keefe'; 'Michael R. Lilly,
GW Scientific'; PHilgert@r2usa.com; rob.plotnikoff@tetratech.com; 'Benkert, Ronald C (DFG)'; susan walker;
'William Rice'; matt.cutlip@ferc.gov; Lori_Verbrugge@fws.gov; Catherine_Berg@fws.gov;
Jennifer_Spegon@fws.gov; dreiser@r2usa.com
Subject: Follow up comments from August 15-17 ILP meetings
Hi Betsy,
Thank you and AEA for hosting the August ILP meetings. We all gained a lot of insight from the meetings, and
we were pleased to be updated. Like others, as a result of the meetings, the Service has a few comments and
concerns to share with the group.
In addition to these below, other staff from the Service may provide comments relative to their study area
expertise. We hope that our collective comments will be helpful toward gaining concurrence on proposed
studies, and as we move forward with the review process of the proposed Watana dam.
Thank you,
Betsy
_________________________________________________________________________________________
_________________________________
September 7, 2012
Notes from ILP Formal Study Meetings August 15-17, 2012:
At the request of AEA and its consultants, the USFWS (Service) submits this brief summary of concerns
regarding the Susitna-Watana hydropower dam formal ILP Formal Study meetings that were held August 16-17,
2012. The Service’s concerns in this informal correspondence, along with other remaining concerns will be
further articulated in the Service’s formal response letter on AEA’s ILP Proposed Study Plan (PSP) review, due
to FERC October 15, 2012. Additional informal comments from the Service may be provided under separate
cover before the October due date.
FWS concerns highlighted during meetings relative to Instream Flow, Habitat Utilization and the
Geomorphology proposed study plans:
Overall, the Service finds that AEA’s proposed study plans for instream flow, habitat utilization and
geomorphology do not fully address agency’s resource management concerns. During the three days of ILP
study meetings, sequencing and integration of the proposed biological resource studies and the physical
process studies was not described and is still a significant outstanding information need. It is necessary to
describe the integration of these inter-related studies and how that integration will result in a comparison of the
baseline biological information and the resulting effects to biologic resources caused by the proposed project
operations. Study results must be quantifiable in order to assess potential losses to aquatic resources and their
habitats, to review the project under our relevant fish and wildlife resource conservation authorities, to inform
fishway prescription authority under Section 18 of the Federal Power Act, and to eventually develop
recommended protection, mitigation, and enhancement for the project license. We do not believe that the
current study plan proposals will yield sufficient information to allow us to adequately assess proposed project
impacts to the Nation’s fish and wildlife resources and develop adequate PME’s.
EMAIL RECORD
Record of Email Page 2 of 6
The Service has repeatedly articulated concerns about the lack of study sequencing, connectivity and
integration between the biological studies and the other proposed engineering and physical processes studies.
We reiterate and highlight the need for the collection of adequate temporal and spatial baseline biological and
fish habitat data to provide direct input to some of the proposed physical modeling efforts. Many of our
concerns, below, are related to the temporal mismatch of biological data collection with the forward momentum
of the physical modeling efforts.
-Habitat Mapping
Hierarchially-nested aquatic habitats- HDR stated at the meeting that the “habitat mapping” will be started in
September; and that the sampling will be stratified by meso-habitat type as identified in the 1980’s study reports.
The 1980’s studies did not hierarchically nest the habitat types. The Service specifically requested hierarchially
nested habitat mapping (e.g., Frissel et al, 1986). We are concerned with the proposal to use the 1980’s study
sites, which focus on the side sloughs, and do not consider the full breadth of fish habitats, which is currently
unknown and the subject of ongoing study that has not been completed or submitted for agency review and
comment. We do not endorse the use of the 1980’s sites without out first completing and then applying a
hierarchal assessment of the river reaches as a study framework. The hierarchally nested aquatic habitats
framework is needed to structure fish distribution surveys, the instream flow study and other physical process
studies. Without it, the fish surveys will be too narrowly constrained and the instream flow studies will not
represent all habitats that may be affected by the proposed project. The Service recommends the following
habitat hierarchy for the Susitna River be used for habitat mapping purposes and integration of studies:
Large River Floodplain Habitat Hierarchy
1. Geomorphic units: Large-scale geomorphic and hydraulic controls.
a. Bedrock controlled, single-channel units with shallow hyporheic exchange and thermal homogeneity.
b. Unconfined, multiple channel floodplain units with expansive hyporheic exchange and thermal
heterogeneity.
2. Macrohabitats: Primary, flood, and spring channel networks.
a. Primary channels—Perennial channels.
b. Flood channels—Seasonally connected channels.
c. Spring channels—Disconnected sloughs that discharge groundwater.
d. Floodplain ponds—Ponded spring channel networks.
3. Mesohabitats: Bed and bank morphological controls; hydraulic features.
a. Riffle-pool sequences—Run, riffle, pool, glide, tailout.
b. Backwaters, alcoves, shallow meander margins.
4. Microhabitats: Hydraulics, water quality, substrate, cover.
a. Water depth, velocity, bulk flow characteristics (e.g. Reynolds and Froude #’s).
b. Vertical hydraulic exchange (ground and surface water exchange).
c. Bed, or intragravel temperature and dissolved oxygen.
d. Substrate size, heterogeneity.
EMAIL RECORD
Record of Email Page 3 of 6
e. Elements of wood, vegetation, and rock structure.
-Fish distribution: A first step is to assess the seasonal distributions of target species and life stages and the
physical habitat criteria that influence habitat selection and suitability. As a first step, target species have to be
identified, agreed upon, and their life history and habitat use similarities to other, unstudied species (i.e., non-
target species) need to be determined and described. In the study requests of the Service and other agencies,
we recommended studying the baselines of all affected fish species and life stages, including all five species of
anadromous salmon and all resident fish.
Fish distribution data are needed to describe the baseline data to support and compliment other proposed study
objectives, including those related to fish habitat selection and utilization. A first step to acquiring adequate fish
distribution is to assess the full lateral and longitudinal profile of seasonal fish distribution, life stage periodicity,
and suitable used and unused habitats that are influential in fish habitat site selection. The fish distribution data
is needed to provide the base data layer that will support and compliment other proposed study objectives,
including those related to fish habitat selection and utilization, and instream flow (ISF) needs. This information
is also needed for resource agencies’ fishway prescription decisions under the Federal Power Act. Baseline
biological information is critical input necessary for integration with physical studies. Accordingly, the Service is
reiterating the need for multiple and continuous years of biologically relevant data in order to provide robust
integration with the physical modeling studies, and decision-support relative to fish and wildlife resources of the
Susitna River basin.
-Habitat site selection criteria: Criteria that influence habitat selection and suitability need to be identified
using statistically powerful and robust methods and current models of fish distribution including bioenergetics
and not exclusively physical habitat models (Lovtang 2005). The Service remains opposed to the proposal to
repeat the 1980’s approaches to fisheries studies. The 1980’s studies do not determine the habitat criteria
influencing fish habitat site-selection, they simply report utilization functions for water depth and velocity, or
depth and substrate. They also lack a fundamental baseline assessment of all available fish habitat and instead
focus on study of habitats that had high fish use density. The habitats that were apparently suitable but
unoccupied or underutilized by fish need to be assessed, and the entire range of habitat availability and habitat
use data need to be assessed prior to habitat study site selection.
More comprehensive data collected on nearby glacial rivers may be used to demonstrate that habitat selection
by salmon in side-sloughs can be independent of water depth and velocity and should be compiled.
Fish habitat study sites should be surveyed and identified using the full range of habitats seasonally utilized by
agreed-upon target species and life stages. The objective is to identify the bioenergetics and physical factors
that control fish habitat selection. The Service considers the assessment of habitat influential to fish habitat site
selection to be an objective of the Instream Flow and Habitat Utilization Study request. In the resource agencies
Instream Flow and Habitat Utilization Study Plan requests, this is a specifically stated objective.
Sequentially, appropriate flow-habitat models can be selected after assessment and validation of 1) the full
seasonal distribution of target species and life stages,2) the physical factors (e.g., micro-habitat data) that
influence habitat selection and suitability, and 3) the bioenergetic factors affecting fish habitat suitability and
productivity.
Thus, field visits proposed for the end of September (2012) should be considered as reconnaissance and for
discussion purposes, and not for the purpose of actual study site-selection.
-Habitat Suitability Indices: Methods for collecting site-specific habitat criteria for the glacial Susitna River
need to be collaboratively identified. (As recommended in the resource agencies study plan request for Instream
Flow and Habitat Utilization). These criteria also need to be evaluated in the context of the hierarchical habitat
model, such that habitat criteria are determined and evaluated in all habitats of importance to each agreed-upon
target species and life stage.
The 1980’s studies were inconclusive in demonstrating a relationship between fish habitat criteria and fish
distribution, and they were also narrowly focused on associations of spawning and rearing salmon with water
EMAIL RECORD
Record of Email Page 4 of 6
depth and velocity in spring channels (side sloughs). Not only is this not representative of existing habitat and
the distribution of fish within those habitats, habitat data collected from nearby glacial rivers demonstrates that
spawning habitats selection is independent of flow depth and velocity in side sloughs and may be profoundly
influenced by bioenergetics and the input of organic matter .
This indicates that traditional hydraulic modeling (e.g., PHABSIM), as proposed, may be an insufficient fish
focus/tool. So, first we need to identify criteria that are influential to habitat selection, within the full seasonal
distributions of agreed-upon target species and life stages. Only then, after this has been adequately
determined, can we begin to develop utilization functions (curves or HSC) for those criteria.
The Service has previously expressed concern with the approach of repeating the 1980’s study effort, and we
have repeatedly asked for both a complete compilation of available data, and a review of the 1980’s information
prior to accepting its use for the proposed project. Lacking that review, we independently note that, in the
1980’s sites were selected that were, presumably, heavily utilized by spawning sockeye and chum (qualitative).
Study sites need to be based on relevant criteria related to physical habitat site selection as documented by fish
distribution and lack thereof.
-Groundwater- The integration of the groundwater study efforts with the biological studies is not clear.
Specifically, how will the groundwater study be made relevant to the scale of fish habitat and fish habitat site
selection in the Susitna River? The objectives of the groundwater study should include relevance to the
hierarchially nested habitats, including macro-, meso-, and micro-habitats that are influential to fish habitat
selection. The groundwater study sampling design should be relevant to fish habitat and site selection. A
specific objective needs to be measuring the hydraulic gradient/head (upwelling or downwelling) under the
existing hydrograph and under the proposed project hydrograph release flow schedule.
-Model selection: We need to first determine what criteria are important to fish habitat site/suitability and
selection before we can choose an appropriate flow-habitat model. ADFG Marine Mammals biologist, Dr. Bob
Small also reiterated this very same point regarding model selection for the beluga whale studies. Again, the
Service notes our concern about the limited focus of the 1980’s studies and using PHABSIM. Our concerns
stated in earlier correspondence to AEA remain unaddressed and are reiterated here for emphasis.
Model sensitivity and relevant criteria (inputs) are critical to achieving statistically valid outputs. At this point, it is
premature to select a model until we have known 1) fish distribution, and 2) identification of variables influential
to fish habitat site selection.
-Biometric Review- The Service previously requested a biometric review of the 1980’s findings. This request is
remains outstanding and should be conducted prior to basing any study plans on 1980’s studies or results. In all
cases, including the usage of the 1980’s Su-hydro data results and for the Susitna-Watana study plans,
estimates of precision and accuracy of study results is required to evaluate the power of any study plan. Details
of proposed study plan sampling and design methods need to be explicit and statistically valid with a priori
determination of levels of precision and accuracy of model outputs.
-Fish genetics- During the August 15-17 meetings, AEA stated that genetic samples from the Chinook above
the proposed dam site would not be collected. The stated rationale was due to the desire to minimize the
handling of the fish after subsequent tagging of fish. Genetic samples of Chinook at locations above the
proposed Susitna-Watana dam site are crucial to informing the Service’s management goals specific to
recommending licensing conditions under the Federal Power Act, and to conservation recommendations under
the Fish and Wildlife Coordination Act, and the Anadromous Fish Act. As such, we consider our request for
collection of genetic samples from Chinook salmon, and other fish species to be necessary for our resource
evaluation of the Susitna-Watana hydropower project.
Because of this information need, if AEA does not plan to collect the information, AEA should document how
this study request is being addressed.
Fish species genetic samples used for comparisons should be less than ten years old to reflect current gene
frequencies among the sampled fish populations. Genetic samples for salmon exist for some tributaries in the
EMAIL RECORD
Record of Email Page 5 of 6
lower and middle Susitna River. Some of these samples are greater than ten years old.
Fish genetic samples should be current and include samples of the Chinook migrating above the proposed dam
location. Because gene frequencies change over time, all genetic samples should be within the most recent ten
years to allow for valid comparison. Genetic analysis should analyze the existing extent of genetic differentiation
within and between fish using distinctly different habitats. We request genetic analysis of Chinook above the
proposed dam site relative to those at other upper, middle and lower river and tributary sample locations.
-Fish Passage/fishway prescription- The Service is concerned with the lack of transparent discussion about
the potential for fish passage alternatives at the proposed Susitna-Watana dam. If fish passage is required, how
will that be accomplished? If it is not feasible, what is your alternative proposal? Where is your project
assessment of the fish passage feasibility? What are the design criteria being considered/evaluate d?
-Compensatory Mitigation- Compensatory mitigation is determined as part of a mitigation sequence after
avoidance, and minimization efforts. The Service has inquired about potential compensatory mitigation for
project impacts during several meetings. To date, this concern has not satisfactorily been addressed by the
project sponsors or project consultants. Because compensatory mitigation is a requirement in order to offset
unavoidable projects impacts to fish and wildlife resources and their habitats, it is should be considered
throughout the review process. Please explain how you plan to quantify existing habitats, and quantify primary,
secondary and cumulative (40cfr Part230 of the CWA) losses to those habitats under the proposed operational
flows over the temporal scale of the license period. How will habitats change proportionally under project
operations?
-Lower river- The Service is concerned with AEA consultants’ proposal to establish a lower boundary for the
physical studies (e.g., geomorphology, instream flow) at a location “downstream of Sunshine” at approximately
river mile 75, and not extend the study efforts further down into lower river to inform the biological studies. There
are many biological resource studies that would necessarily be informed by establishing a consistent study
boundary between the physical and biological studies. For example, studies related to the federally listed Cook
Inlet beluga whale, fish species and habitats, including the resident species, and anadromous salmon a nd
eulachon (beluga whale prey species). The lower river also includes the Susitna Flats State Game Refuge. If the
physical studies boundary is terminated at river mile 75, there will be no ability to relate or integrate biological
data to those studies (e.g., geomorphology, ISF, ice processes, flow routing). Resource agencies management
goals would effectively not be addressed below river mile 75, if project effects are not assessed to the mouth of
the river.
According to USACE (1966), 80% of the ability to produce accurate model results depends on using
appropriate bathymetry data, mesh design, and boundary conditions. The amount of time needed to collect this
information, particularly the bathymetry data, depends on the complexity of the channel’s geometry, which is
known to be complex in the lower Susitna River. Because data collection in the lower river will likely require
rigorous field collection due to the channel complexity, it is critical to initiate these efforts in a time sensitive
manner. The proposal to delay work in the lower river pending analysis at an arbitrary, and certainly non-
biologically relevant location, does not meet resource agencies objective of evaluating the potential project
impacts to fish and wildlife resources in the lower Susitna River. This is particularly true under the FERC ILP
process timeline specific to the Susitna-Watana dam project.
-Studies integration: A “map” or chart of how studies are proposed to be integrated is needed. AEA sponsors
and consultants, committed to providing this by September. Biological resource components are currently not
integrated or connected to the other studies, and appear as being treated independently of the rest of the study
requests. Study proposals must demonstrate how they will be integrated to provide needed resource
information.
Studies/components not address from the Non salmon anadromous, resident and invasives fish species
study request: During the August ILP meetings, the follow Service requests were preliminarily noted as not
being addressed or adequately addressed by AEA’s PSPs.
EMAIL RECORD
Record of Email Page 6 of 6
1) Marine derived nutrients contribution from non salmon anadromous species. The Service requested
information in our non-salmon anadromous, resident and invasive study plan request. It is not clear which study
proposal it is addressing this request, or IF it is being addressed. During the August 15-17 meetings, it was
indicated that it may be addressed in either the riparian instream flow, the terrestrial wildlife, the river
productivity or elsewhere. However, AEA’ s consultants were unable to specifically “point to it” when asked. It
does not appear to have been included in the PSPs.
2) Resource valuation of non-salmon anadromous and resident fish resources. During the meeting, AEA
consultants stated that a resource valuation would not be provided, as requested in the Service’s study request
for non salmon anadromous, resident and invasive fish study. An explanation of why this assessment will not be
addressed was not provided. We request that an explanation be provided that describes the rationale for this
determination and urge reconsideration of our study request.
3) Trophic ecology- The Service requested information on trophic ecology in the non salmon anadromous,
resident and invasive species study request. Michael Link stated that there are “significant predator-prey
dynamics” particular once fish move out of the mainstem; using this behavior to explain why fish hold there until
they are ready to dash to tributaries. He noted that the creeks are heavily preyed upon by bears, for example.
Dr. Bob Small (ADFG) recommended trophic ecology and/or foraging ecology information for the Cook Inlet
beluga whale studies. For fish, coordination with Tim Nightengale (AEA’s consultant; via teleconference) stated
that he would take gut samples from fish to see what macro-invertebrates they are eating, and when, and will
work with fish study teams to do some trophic analysis. The trophic ecology component needs to be clearly
spelled out in a study plan identifying any aspects that will and will not be addressed explained and with
appropriate rationale.
References:
Frissell, C. A., W. J. Liss, C. E. Warren, and M. D. Hurley. 1986. A hierarchical framework for stream habitat
classification: viewing streams in a watershed context. Environmental Management 10:2. Pp. 199-214.
Lovtang, J. C. 2005. Distribution, habitat use, and growth of juvenile Chinook salmon in the Metolius River
Basin, Oregon. M.S. Thesis, Oregon State University. March 2005.
USACE 1966. (Full citation will be provided in follow-up correspondence)
Betsy W. McCracken
Fishery Biologist
Conservation Planning Assistance
Ecological Services
US Fish and Wildlife Service/Region 7/Anchorage Field Office
Betsy_McCracken@fws.gov
(907) 271 - 2783
EMAIL RECORD
Record of Email Page 1 of 4
From: Bob_Henszey@fws.gov [mailto:Bob_Henszey@fws.gov]
Sent: Tuesday, September 11, 2012 12:26 PM
To: 'Kevin Fetherston'; Betsy McGregor
Cc: Catherine_Berg@fws.gov; Ann_Rappoport@fws.gov; Betsy_McCracken@fws.gov;
Jennifer_Spegon@fws.gov; Lori_Verbrugge@fws.gov; Michael_Buntjer@fws.gov; chiska.derr@noaa.gov; Klein,
Joseph P (DFG); 'Matthew LaCroix'; 'Michael R. Lilly, GW Scientific'; eric Rothwell; susan walker; 'William Rice';
matt.cutlip@ferc.gov; dreiser@r2usa.com
Subject: PSP 6.6 Riparian Instream Flow Study Plan - Interim Comments
Kevin,
The following are some of the key differences the USFWS sees between our study plan request (USFWS 10.1,
Instream Flows for Floodplain and Riparian Vegetation Study) and AEA's proposed study plan (PSP 6.6,
Riparian Instream Flow Study). The differences and comments listed below are likely not inclusive, since we
have not had a chance to fully evaluate the PSP.
Many of the PSPs rely upon or provide data from/for other studies. Recognizing these relationships is an
important part of the Integrated Licensing Process (ILP); however, the study providing the data should describe
the methodology and oversee the data collection and analyses, while the study requiring the results should
restrict its discussion to the types of data/results required from other PSPs. Repeating the methods in a study
not responsible for the data collection and analyses is unnecessary and risks confusion if the methods differ or
are inadequate in one of the studies. Since the Riparian Instream Flow PSP will rely upon data from the
Groundwater PSP, the Riparian Instream Flow PSP should describe only the results required from the
Groundwater PSP, and then describe how those results will be used in the Riparian Instream Flow PSP (e.g.,
5.7 Groundwater PSP should be the only PSP that describes the groundwater methods). This applies to other
PSPs, such as the habitat mapping studies that may be providing data for this PSP.
Study Goals and Objectives: The USFWS requested a specific goal that included quantifying the frequency,
timing and duration of surface-water and groundwater levels required to establish, maintain, and promote
floodplain and riparian plant communities. Two ancillary goals were also requested to quantify the frequency
and rate of sediment deposition required to promote soil development, and to quantify the effect of river ice on
the establishment and persistence of riparian plant communities. Section 6.6.1.1 of the PSP has no stated goal,
and only a general approach is provided. An "overarching goal" is provided in the Section 6.6.4 Study Methods,
but this goal is also very general. While goals can be very general in nature, the specifics in our goal set the
stage for a rigorous study plan to evaluate potential project-related effects on floodplain plant communities.
The USFWS requested six objectives to help meet our goal. Three of the PSP objectives are similar to our
requests {1) Synthesize 1980s data, 2) Study sites, and 6) Seed dispersal}, but they lack the additional specifics
stated in our requested objectives. Two of the PSP objectives appear to be wholly or at least partially the
objectives for other PSPs and not appropriate as stated {3) Map riparian vegetation, and 10) Impacts to shallow
groundwater well users}. What the PSP objectives lack, however, are our specific requests for river ice,
sediment deposition, and water-level regime (USFWS Objectives 4, 5, and 6). These missing objectives may be
studied under AEA’s PSP objectives, but the USFWS prefers they be considered as standalone objectives, and
possibly integrated into a single modeling objective after they have been studied individually. The USFWS is
particularly interested in our Objective 6 to characterize the water-level regime required to maintain floodplain
and riparian plant communities. Much of the discussion so far has focused on floodplain plant succession, but
little or no discussion so far has involved maintenance flows. Succession is important, but without maintenance
flows whole floodplain plant communities may collapse or the direction of succession changed to an unnatural
target (e.g., non-floodplain plant communities).
Study Area: The USFWS agrees with the PSP study area and four river segments, with the following additional
comments. The width of the active valley should also include the distance from the River that the River
influences groundwater, as well as define the return interval for both groundwater and flooding (e.g., 100-year
event under current or climate-change induced conditions). Much discussion has centered on the downstream
EMAIL RECORD
Record of Email Page 2 of 4
influence of the Project. The PSP study area Lower Reach would extend to RM 0. Will this lower extent remain
even if all agree that the Project influence on surface- and ground-water becomes indistinguishable from normal
environmental variation?
Study Methods: The methods need to follow the order of the objectives and use section headings that refer to
the intent of the objectives. Few methods are referenced, and some references that are cited are not included
in the literature cited. The relationship with other PSPs often seems confusing. It would be more helpful to state
what results will be required from PSP "x" to evaluate a Riparian ISF objective, and potentially what results from
a Riparian ISF objective will be required by PSP "y." It is not necessary to repeat coordination for every
objective, only state the inputs required and the outputs provided by an objective. This applies across PSPs
and among a PSP's objectives. The following comments on methods follow the order of the Objectives
requested by the USFWS:
RIFS-1 Synthesize Historical Data: In addition to other North American hydro-projects, this review should also
include a review of relatively undisturbed riverine systems.
RIFS-2 Select and Design Study Sites: The number of study sites should provide sufficient replication to
address the needs of the objectives, and should include sites where Project operation is expected to cause early
channel bed degradation or aggradation. The casual reference to pseudoreplication in one of the other
objectives needs to be addressed at the study-site level. Study sites are typically the experimental unit where
replication is used for true statistical analysis. All other sampling (e.g., within the study site) is really
subsampling used to obtain a better average value for that one replicate. As envisioned by many of the PSPs,
the "representative" study sites are really only one replicate for each process-domain. For more on
pseudoreplication see:
Hurlbert, Stuart H. 1984. Pseudoreplication and the Design of Ecological Field Experiments. Ecological
Monographs 54:187–211. http://dx.doi.org/10.2307/1942661
RISF-3 Characterize Seed Dispersal and Frequency of Establishment: Not sure where this objective is
addressed in the PSP. It appears to be scattered across several sections in the methods. If the methods have
been described by other similar projects, then cite their methods if appropriate and include enough details to
help others understand the methods that will be used. How will the Susitna River bimodal peak flows be
addressed? On a float trip down the Susitna 27-29 July 2012, there were newly emerging dicot seedlings on the
sandbars. How will the fate of these "second peak" seedlings be addressed? How will the role of precipitation
in maintaining favorable soil moisture conditions be evaluated? Will soil texture be considered? If so, how will
the soil profile be described?
In Section 6.6.4.3.1.4: Is "abundance" density or some other metric? What is "elevation" referenced to: ASL,
an arbitrary datum, or some elevation that can be linked to the local river or groundwater stage (keep in mind
the river drops downstream, so that must be accounted for also)? Is there a citation for others using 2-meter
square plots? What is the shape of these plots? A square plot may not be appropriate for a narrow band of
seedlings along a specific elevation in the gradient above the river. MODFLOW is a groundwater model, and
many not be sensitive enough to quantify hydroperiod relationships for seedlings. What other metrics will be
used to quantify/separate surface water, groundwater, soil moisture, precipitation, and other potential
hydrological process that support seedling establishment and recruitment?
How will the results from this objective be used to predict potential Project-related changes in seedling
establishment and recruitment into the population?
RISF-4 Characterize the Role of Ice in the Establishment, Survival and Recruitment of Riparian Species: The
discussion on ice processes (Section 6.6.4.4.1) seems unfocused, and essentially provides no discernible
methods: "Final details of the geomorphology and ice processes modeling ... will be developed as the 2012
studies are obtained." The goal of this study should be to characterize the role of river ice in the establishment
(colonization), survival (first 3 years) and recruitment into the future reproductive population of dominant riparia n
species (e.g., balsam poplar, willows). Have others investigated the role of ice on riparian plant communities?
EMAIL RECORD
Record of Email Page 3 of 4
If so, can their methods be used here? How will the magnitude, frequency, and longitudinal distribution of ice
events affecting dominant riparian species/communities be evaluated?
RISF-5 Characterize the Role of Sediment Deposition in the Formation of Soils: The proposed soil sampling
techniques are included in Section 6.6.4.3.1.5, but based on these techniques it is unclear how the USFWS
requested objective to characterize the role of sediment deposition in the formation of floodplain and riparian
soils, and how sediment deposition affects the rate and trajectory of plant community succession. This objective
should investigate the rate of deposition, depth of sediment, and soil profile development required for natural
floodplain plant community succession, and then use the predicted sediment deposition characteristic from the
Fluvial Geomorphology Study to predict the effects of Project operation on floodplain plant communities.
Sampling to only a depth of 50 cm, and describing cumulative thickness of all organic horizons and loess
(windblown material?) without stratigraphy will likely be insufficient to meet this objective. Soil texture by feel
should follow standard techniques (e.g., Thien 1979, http://soils.usda.gov/education/resources/lessons/texture/).
RISF-6 Characterize Water-Level Regime Required to Maintain Floodplain and Riparian Plant Communities:
This is a critical objective that has not been sufficiently discussed in past workgroup meetings, possibly due to
lack of time, and the PSP methods are insufficient to evaluate if the USFWS requested objective will be met.
Suggest this objective be discussed near the beginning of future meetings to allow sufficient time for
discussion.
Objective 6 combines hydrologic information from the groundwater study (PSP 5.7) and the plant community
information from this study (PSP 6.6) and possibly the habitat mapping studies (PSPs 9.6 and 9.7) to produce
plant species/community response curves. The USFWS's Objectives RISF-3 to RISF-5 target critical stages in
plant community succession, while RISF-6 targets critical instream flows required for maintaining plant
communities as succession progresses (i.e., both succession and maintenance are important).
The methods for groundwater belong in the Groundwater PSP, and not in this PSP for reasons discussed
above. This PSP should request the required hydrologic information from PSP 5.7 and begin the discussion
from that point. The following comments, however, include the pertinent groundwater methods that should be
discussed in PSP 5.7.
Section 6.6.4.5 (Groundwater): The suggested four to six intensive study reaches instrumented with
groundwater and surface-water recording instruments may be insufficient to address this objective if plant
response will be described by process-domains (see pseudoreplication discussion above). However, hydrology
is likely the most dominant physical factor required for maintaining floodplain plant communities across the
various process-domains, and baring some other dominant physical factor (e.g., soil parent material, weather,
etc.) it may be possible to use data from the individual intensive study-site transects to build response curves
(see Henszey et al. 2004 {ne.water.usgs.gov/platte/reports/wetlands_24-3.pdf}, Figure 7 for an indication of the
number of data points required to build a response curve).
One-and-a-half growing seasons (July 2013 to September 2014) will likely provide insufficient groundwater
hydrology data to fit individual species response curves (especially for annual species), and may not be enough
data to reasonably predict groundwater relationships with river stage and to verify the model predictions with
independent data. Precipitation may also dramatically affect transient but critical groundwater levels (a few days
to a week or more of elevated water levels), which would be difficult to evaluate with limited data. How will
these potential problems be addressed?
What are the "project accuracy standards used for water-level measurements" for horizontal, vertical and
temporal measurements?
In addition to the Work Products described in Section 6.6.4.5.2, the products should provide water-level
summary statistics for each location (e.g., point, plot, or transect) that will be used to test and fit plant response
curves, such as growing season cumulative frequency, 7-day moving average, 10-day moving average, 14-day
moving average, and arithmetic mean (see Henszey et al. 2004 {ne.water.usgs.gov/platte/reports/wetlands_24-
3.pdf}, Table 1).
EMAIL RECORD
Record of Email Page 4 of 4
Section 6.6.4.7 (Succession Models and Flow Response Guilds) appears to potentially address the USFWS's
Objective 6 request; however, two critical referenced papers (Merritt et al. 2010 and Pearlstine et al. 1985) were
not included in the Literature Cited. These references were not provided until 8/28/2012, and the USFWS has
had insufficient time to review these papers in detail. The concept of the PSP response guilds is similar to the
USFWS's request to develop plant community response curves, but the PSP methods are insufficient to
evaluate if our requested Objective 6 will be met. The USFWS requested evaluating specific water-level
summary statistics (see above discussion for groundwater) with a rigorous curve-fitting technique similar to
Henszey et al. (2004). The methods should provide sufficient detail to show how quantifiable (not qualitative)
hydrologic (surface-water and groundwater) gradients will be constructed to show the optimum and range of
favorable water levels required for maintaining floodplain species/communities.
____________________________________
Robert J. Henszey, Ph.D.
Fish & Wildlife Biologist
Conservation Planning Assistance
US Fish & Wildlife Service
101 12th Avenue, Room 110
Fairbanks, AK 99701
Phone: 907-456-0323, Fax: 907-456-0208
Bob_Henszey@fws.gov
EMAIL RECORD
Record of Email Page 1 of 2
From: Eric Rothwell [mailto:eric.rothwell@noaa.gov]
Sent: Wednesday, September 12, 2012 5:37 PM
To: dreiser@r2usa.com
Cc: PHilgert@r2usa.com; Laura Arendall; Betsy McGregor; susan walker; Berg, Catherine; Betsy McCracken
(FWS); Michael_Buntjer@fws.gov
Subject: Re: Meeting on the 12th
Dudley,
Thank you for coming over and meeting today. Also, thank you for providing the meeting presentation before
hand, having it to review helped facilitate the discussion. The aerial imagery with the proposed study reaches
was also helpful in our conversation, when they are available I would like a copy.
I typed up some of my comments from today, starting with general comments, twg meeting protocol comments,
and then specific comments on the site selection process. I cc'd other agency personnel that will likely attend
the meeting Friday, hoping that it will provide some useful discussion points and I look forward to continuing the
discussion September 26-28th. Betsy, Sue, etc. the attached presentation that Dudley provided is draft and
parts will likely change prior to Friday's meeting.
General comments about all of the PSPs:
What can be determined from each of the study components, a description of deliverables (not results)
this will help us understand if our requests have been met.
How will uncertainty be determined for each of the study components? (ice processes -> hydraulic flow
routing -> winter fish and habitat effects)
How will incomplete study components, data, or results be dealt with - situations where an extension of
the study period is necessary.
General comments about TWG meetings, as Friday will start to define what TWG will look like:
An agenda should be provided with enough time to review and submit changes
All meeting materials provided with enough time for review prior to the meeting, including presentations
Relevant background material that will aid the discussion will be provided
Meeting summary and minutes within two weeks of the meeting, distributed to all attendees as a draft.
Then a two week period to submit additions and/or corrections
And - attendees (agency personnel included) will be prepared by reviewing all the materials prior to
meeting.
Comments specific to the study site selection process
The proposed methods for site selection are first to select sites in a hierarchical framework (segment by
hydrology, then geomorphology, then habitat units). Sites selected will include all the riverine habitat types that
are defined (relevant to that reach, for example MR2 may not have any upland sloughs).
The site selection will be informed by selecting sites that are 'critical', meaning that they are likely to be highly
affected/sensitive to flow changes and highly important biologically. Generally I agree with prioritizing sites that
will by hydraulically affected and are biologically important, but we have incomplete biologic information The
data from the 1980s provides some useful information about utilization of off-channel habitats that should inform
our studies but the information is limited in that it does not fully capture mainstem utilization or overwintering.
So, with new fish utilization and distribution information site selection should include some flexibility to include
sites where life histories are not assessed under the currently proposed sites. This seems to be suggested in
EMAIL RECORD
Record of Email Page 2 of 2
the site selection process schedule if it includes fish distribution/habitat utilization information, November 2013
evaluate summer 2013 data and modify/add sites as needed in collaboration with TWG
The schedule provided includes refinement of selected sites by the use of mapping results to evaluate habitat
variability, conduct statistical power analysis, refine intensive sites and identify supplementary sites. If possible
an addendum to the PSP or definitely in the RSP a description of the initial site selection (by the hierarchical
framework) and refinement (by habitat mapping results and fish studies) methods should be presented, not just
the selected sites. This depends on the fish studies being sufficient to describe the full distribution of fish and
their habitat use.
Incorporation of multiple study elements, such as ice processes, groundwater, geomorphology, and water
quality. This is especially important in habitats where one of the other study elements is driving habitat use by
fish, for example if upwelling and water temperature is a determining factor for site selecting for Chinook to
overwinter then the study site should include this habitat and integrate the WQ and GW studies to understand
distribution of thermal refugia for overwintering and how the project would affect those
processes/characteristics.
The slides presenting the 1980s electrofishing and sampling was informative, but again shows an incomplete
understanding of habitat utilization. The 1980s sampling focused on the off-channel habitats (side
sloughs/channel, upland sloughs, and confluences with tributaries). This information should be used to inform
selections but must also be put into context that we really don't know very much about mainstem utilization and
overwintering, and so need to be flexible (potential with extended study years) when a better understanding is
gained through the 2013 and 2014 fish studies.
The slides on each of the species, I had a general comment that they should be put into perspective. That the
1980s data does not represent a complete understanding so comments like no mainstem spawning should be
qualified. There likely is a riverine component to sockeye (and other species) that do spawn in the river but that
just wasn't captured in the 1980s due to the methodologies available. We do not currently know the full
spawning distribution.
Representative reaches, extrapolation of results, and replication. We touched on this and I look forward to
talking about this more. I did not review Aaserude et al. 1985 prior to our meeting but plan on reading it prior to
the Sept. 26-28 meetings.
Although not discussed, I have a concern with winter flow routing and ice processes, and how they will inform
site selection. Site selection for analyzing winter instream flow effects to fish and their habitat will depend on an
understanding of operational effects downstream (to flow timing and quantity, hydraulics, and water quality).
Also the extension of the studies downstream will depend on these results. The winter hydraulic flow routing
model will rely on ice process modeling to determine the downstream extent and magnitude of operational flow
effects. The ice process modeling will need several years of data, in addition to the ice thickness
measurements and discharge measurements at each of the cross-sections for the winter routing model. I see a
lack of time to collect data for the models (winter flow routing and ice process) calibrate the models and then
selection sites and methods to conduct ISF studies to assess project effects on fish during winter operations
under the currently proposed study period.
This was a very targeted meeting to discuss site selection, I look forward to discussing this and other parts of
the ISF and other study plans in the near future. After Friday's meeting I hope to see the selection methods
written up with consideration of the agency comments (including the proposed methods for extrapolation), this
should help us continue the discussion.
Best Regards,
Eric
APPENDIX 4
INFORMAL CONSULTATION DOCUMENTATION
SECTION 8 – INSTREAM FLOW STUDY: FISH, AQUATICS, AND
RIPARIAN
EMAIL RECORD
Record of Meeting Page 1 of 3
From: Klein, Joseph P (DFG) [joe.klein@alaska.gov]
Sent: Thursday, August 02, 2012 10:32 AM
To: dreiser@r2usa.com
Cc: Betsy McGregor; Erickson, Jack W (DFG); Betsy_McCracken@fws.gov; Michael Buntjer; Steele, Marie C
(DNR); eric Rothwell
Subject: Instream Flow Study Plan
Dudley‐
Thank you for the channel summaries – there are very helpful and informative.
Following up with the suggestion below, additional information that would be helpful with development of the
study design would be a summary of the relative proportions of channel types. It would be great if the
information was combined with relative densities of documented fish use. I see that some of this information
is included in the proposed study plan and so I’m not clear on when this information will be available.
As you know, this information is one of the initial steps for identifying sampling strategies (representative
reach vs macro habitat), habitat selections as well as modeling selections (transects, weighting protocols,
hydraulic and habitat simulation programs, aggregation protocols, etc.). Two key issues that I am not clear on
are 1) how will the decision be made on which habitat specific model(s) will be used, and 2) how and when
will other related riverine studies be integrated (e.g. water temperature, ground water, fish passage, sediment
transport, channel maintenance, and ice processes)?
I am looking forward to discussing these topics at the upcoming and future meetings.
Per a future site visit, right now my calendar is open for September.
Hope this helps, Joe
Joe Klein, P.E.
Supervisor Aquatic Resources Unit
Alaska Department of Fish and Game
333 Raspberry Rd
Anchorage, AK 99518
(907) 267‐2148
joe.klein@alaska.gov
From: Betsy McGregor
Sent: Wednesday, August 01, 2012 11:50 AM
To: Betsy_McCracken@fws.gov; dreiser@r2usa.com
Cc: eric Rothwell; 'Phil Hilgert (R2)'; Lori_Verbrugge@fws.gov; Catherine_Berg@fws.gov; jklein@alaska.gov;
jerickson@alaska.gov; James.brady@hdrinc.com; mlink@lgl.com; susan walker; shawn.florio@hdrinc.com;
mkeefe@r2usa.com; bburgess@abrinc.com; lawhead@abrinc.com; tschick@abrinc.com; pdworian@urs.com;
bridget.easley@urs.com; mtuttell@dowlhkm.com; paul.anderson2@alaska.gov; mobley@alaska.net;
donna.logan@mcdowellgroup.net; jmh@northernlanduse.com; keri.lestyk@hdrinc.com; mlilly@gwscientific.com;
jshook@abrinc.com; amy.rosenthal@urs.com; louise.kling@urs.com; john.gangemi@erm.com;
EMAIL RECORD
Record of Meeting Page 2 of 3
marie.steele@alaska.gov; bill.fullerton@tetratech.com; Butera, Bob; robert.plotnikoff@tetratech;
tracie.krauthoefer@hdrinc.com; Burden, Pat; khansen@dowlhkm.com; bob_henszey@fws.gov;
michael_buntjer@fws.gov
Subject: RE: July 26th Su-Watana Field Visit- ISF
Hi Betsy.
Thanks for providing Dudley with your availability for the ISF field trip. Hopefully others will do so as well so the
trip can be as beneficial for the licensing participants as possible. R2 prepared the slough and side channel
summaries that we used during the site visit last week. It would be great to provide any feedback as to how
that summary could be modified or any additional information that may be useful for the September ISF site
visit.
Data gathered thus far will be disseminated to the agencies, as well as all other interested licensing participants
through AEA. AEA is committed to an open process with all of the licensing participants. However, any requests
for summaries of information gathered, project status or data should be directed to AEA instead of
AEA's individual contractors.
At this time, contractors are very busy preparing for the August TWG meetings and some are also
concurrently in the midst of conducting the 2012 studies. The 2012 study plans have been presented at TWG
meetings and can be found on AEA's website. The status of the current data gathering efforts will be mentioned
during the August TWG meetings and some information will be presented where it is relevant to development of
the Revised Study Plan, which is the primary objective of the upcoming TWG meetings. Additional interim
data may also be made available to the licensing participants as it relates to further refinement of the study
plans. The 2012 studies will be summarized and data will be presented to the licensing participants after the
field season is completed.
Thanks for your participation in this Project.
Betsy
Betsy McGregor
AEA Environmental Manager
From: Betsy_McCracken@fws.gov [Betsy_McCracken@fws.gov]
Sent: Wednesday, August 01, 2012 9:33 AM
To: dreiser@r2usa.com
Cc: Betsy McGregor; eric Rothwell; 'Phil Hilgert (R2)'; Lori_Verbrugge@fws.gov; Catherine_Berg@fws.gov
Subject: RE: July 26th Su-Watana Field Visit- ISF
Hey Dudley,
I want to let folks know that have some "black out" dates for September in terms of being able to participate in
Susitna River field visits. Hopefully by providing them in advance, I can avoid a scheduling conflict. I will be
unavailable roughly September 6-12. These dates are not yet confirmed but, are approximate. I look forward to
getting on the river to discuss instream flow, groundwater and habitat utilization components (among others) of
the proposed field studies.
Also, as you are likely aware, resource agencies are in the midst of reviewing study plans provided by AEA's
consultants. Relative to R2's proposed Instream Flow (ISF), Groundwater and Habitat Utilization study plans,
EMAIL RECORD
Record of Meeting Page 3 of 3
would you please provide a summary of recent field work conducted or currently in the works from this summer
(2012) season? For example, has there been any groundwater (reconnaisance or otherwise) work done this
season that would inform the ISF and habitat utilization efforts? I am asking this in an effort to gain an
understanding of where we are at, or where we will be at with efforts when we head out to the river in
September.
Thank you very much,
Betsy
Betsy W. McCracken
Fishery Biologist
Conservation Planning Assistance
Ecological Services
US Fish and Wildlife Service/Region 7/Anchorage Field Office
Betsy_McCracken@fws.gov
(907) 271 - 2783
EMAIL RECORD
Record of Meeting Page 1 of 3
From: Klein, Joseph P (DFG) [joe.klein@alaska.gov]
Sent: Thursday, August 02, 2012 10:32 AM
To: dreiser@r2usa.com
Cc: Betsy McGregor; Erickson, Jack W (DFG); Betsy_McCracken@fws.gov; Michael Buntjer; Steele, Marie C
(DNR); eric Rothwell
Subject: Instream Flow Study Plan
Dudley‐
Thank you for the channel summaries – there are very helpful and informative.
Following up with the suggestion below, additional information that would be helpful with development of the
study design would be a summary of the relative proportions of channel types. It would be great if the
information was combined with relative densities of documented fish use. I see that some of this information
is included in the proposed study plan and so I’m not clear on when this information will be available.
As you know, this information is one of the initial steps for identifying sampling strategies (representative
reach vs macro habitat), habitat selections as well as modeling selections (transects, weighting protocols,
hydraulic and habitat simulation programs, aggregation protocols, etc.). Two key issues that I am not clear on
are 1) how will the decision be made on which habitat specific model(s) will be used, and 2) how and when
will other related riverine studies be integrated (e.g. water temperature, ground water, fish passage, sediment
transport, channel maintenance, and ice processes)?
I am looking forward to discussing these topics at the upcoming and future meetings.
Per a future site visit, right now my calendar is open for September.
Hope this helps, Joe
Joe Klein, P.E.
Supervisor Aquatic Resources Unit
Alaska Department of Fish and Game
333 Raspberry Rd
Anchorage, AK 99518
(907) 267‐2148
joe.klein@alaska.gov
From: Betsy McGregor
Sent: Wednesday, August 01, 2012 11:50 AM
To: Betsy_McCracken@fws.gov; dreiser@r2usa.com
Cc: eric Rothwell; 'Phil Hilgert (R2)'; Lori_Verbrugge@fws.gov; Catherine_Berg@fws.gov; jklein@alaska.gov;
jerickson@alaska.gov; James.brady@hdrinc.com; mlink@lgl.com; susan walker; shawn.florio@hdrinc.com;
mkeefe@r2usa.com; bburgess@abrinc.com; lawhead@abrinc.com; tschick@abrinc.com; pdworian@urs.com;
bridget.easley@urs.com; mtuttell@dowlhkm.com; paul.anderson2@alaska.gov; mobley@alaska.net;
donna.logan@mcdowellgroup.net; jmh@northernlanduse.com; keri.lestyk@hdrinc.com; mlilly@gwscientific.com;
jshook@abrinc.com; amy.rosenthal@urs.com; louise.kling@urs.com; john.gangemi@erm.com;
EMAIL RECORD
Record of Meeting Page 2 of 3
marie.steele@alaska.gov; bill.fullerton@tetratech.com; Butera, Bob; robert.plotnikoff@tetratech;
tracie.krauthoefer@hdrinc.com; Burden, Pat; khansen@dowlhkm.com; bob_henszey@fws.gov;
michael_buntjer@fws.gov
Subject: RE: July 26th Su-Watana Field Visit- ISF
Hi Betsy.
Thanks for providing Dudley with your availability for the ISF field trip. Hopefully others will do so as well so the
trip can be as beneficial for the licensing participants as possible. R2 prepared the slough and side channel
summaries that we used during the site visit last week. It would be great to provide any feedback as to how
that summary could be modified or any additional information that may be useful for the September ISF site
visit.
Data gathered thus far will be disseminated to the agencies, as well as all other interested licensing participants
through AEA. AEA is committed to an open process with all of the licensing participants. However, any requests
for summaries of information gathered, project status or data should be directed to AEA instead of
AEA's individual contractors.
At this time, contractors are very busy preparing for the August TWG meetings and some are also
concurrently in the midst of conducting the 2012 studies. The 2012 study plans have been presented at TWG
meetings and can be found on AEA's website. The status of the current data gathering efforts will be mentioned
during the August TWG meetings and some information will be presented where it is relevant to development of
the Revised Study Plan, which is the primary objective of the upcoming TWG meetings. Additional interim
data may also be made available to the licensing participants as it relates to further refinement of the study
plans. The 2012 studies will be summarized and data will be presented to the licensing participants after the
field season is completed.
Thanks for your participation in this Project.
Betsy
Betsy McGregor
AEA Environmental Manager
From: Betsy_McCracken@fws.gov [Betsy_McCracken@fws.gov]
Sent: Wednesday, August 01, 2012 9:33 AM
To: dreiser@r2usa.com
Cc: Betsy McGregor; eric Rothwell; 'Phil Hilgert (R2)'; Lori_Verbrugge@fws.gov; Catherine_Berg@fws.gov
Subject: RE: July 26th Su-Watana Field Visit- ISF
Hey Dudley,
I want to let folks know that have some "black out" dates for September in terms of being able to participate in
Susitna River field visits. Hopefully by providing them in advance, I can avoid a scheduling conflict. I will be
unavailable roughly September 6-12. These dates are not yet confirmed but, are approximate. I look forward to
getting on the river to discuss instream flow, groundwater and habitat utilization components (among others) of
the proposed field studies.
Also, as you are likely aware, resource agencies are in the midst of reviewing study plans provided by AEA's
consultants. Relative to R2's proposed Instream Flow (ISF), Groundwater and Habitat Utilization study plans,
EMAIL RECORD
Record of Meeting Page 3 of 3
would you please provide a summary of recent field work conducted or currently in the works from this summer
(2012) season? For example, has there been any groundwater (reconnaisance or otherwise) work done this
season that would inform the ISF and habitat utilization efforts? I am asking this in an effort to gain an
understanding of where we are at, or where we will be at with efforts when we head out to the river in
September.
Thank you very much,
Betsy
Betsy W. McCracken
Fishery Biologist
Conservation Planning Assistance
Ecological Services
US Fish and Wildlife Service/Region 7/Anchorage Field Office
Betsy_McCracken@fws.gov
(907) 271 - 2783
EMAIL RECORD
Record of Email Page 1 of 3
From: Klein, Joseph P (DFG) [mailto:joe.klein@alaska.gov]
Sent: Thursday, August 23, 2012 2:48 PM
To: Betsy McGregor
Cc: Benkert, Ronald C (DFG); Burch, Mark E (DFG); Erickson, Jack W (DFG); Fair, Lowell F (DFG); Fink, Mark J
(DFG); Giefer, Joe (DFG); Haught, Stormy B (DFG); Holen, Davin L (DFG); King, Kimberly N (DFG); Miller,
Monte D (DFG); Michael_Buntjer@fws.gov; Betsy_McCracken@fws.gov; eric Rothwell; Hill, Melissa E (DNR);
Schwarz, Terence C (DNR); Sager, Kimberly R (DNR); Ashton, William S (DEC)
Subject: RE: Follow up Meeting Notes-additional comments
Following are additional comments
Baseline Water Quality
5.5.4.3.2 In-Situ Water Quality Sampling The sampling protocol currently calls for monthly in-situ water
quality monitoring for the 4 summer months. It should be revised to include continuous (hourly or so) water
quality measurements for basic parameters (pH, DO, conductivity, turbidity), year-round if possible using in-situ
semi-permanent sensors (e.g. sondes). The technology is readily available and would provide very useful
baseline information to assess any post project impacts.
River Productivity
7.8.4.4 Conduct a literature/data search to identify existing river systems that could act as surrogates in
evaluating future changes to productivity in the Susitna River. We recommend supplementing or
substituting this section using a reference reach in a similar Alaska river using a BACI design monitoring
program in order to assess post project impacts.
From: Klein, Joseph P (DFG)
Sent: Thursday, August 23, 2012 10:42 AM
To: McGregor, Elizabeth A (AIDEA)
Cc: Benkert, Ronald C (DFG); Burch, Mark E (DFG); Erickson, Jack W (DFG); Fair, Lowell F (DFG); Fink, Mark J
(DFG); Giefer, Joe (DFG); Haught, Stormy B (DFG); Holen, Davin L (DFG); King, Kimberly N (DFG); Miller,
Monte D (DFG); Michael_Buntjer@fws.gov; Betsy_McCracken@fws.gov; Eric Rothwell
(Eric.Rothwell@noaa.gov); Hill, Melissa E (DNR); Schwarz, Terence C (DNR); Sager, Kimberly R (DNR); Ashton,
William S (DEC)
Subject: Follow up Meeting Notes
Betsy-
Thank you for the opportunity to discuss the proposed study plans for the Susitna-Watana Hydroelectric project.
We look to further discussions to continue to clarify study plan details.
To assist in you and your consultants in this process, below are brief notes by ADF&G staff. We may have
additional comments/or clarifications. Please feel free to contact me if you have any questions.
Regards, Joe
Fish Distribution and abundance in Upper, Middle and Lower Susitna River
Trot lines should considered during the winter to target appropriate fish species.
Minnow trapping under ice should be used during the winter, in all habitat types.
Should evaluate the feasibility of under ice videography.
EMAIL RECORD
Record of Email Page 2 of 3
Salmon Escapement
Identify locations of adult fish weir locations described on tributary streams (7.7.4.1.5, page 7-39).
Consider placement of adult fish weir upstream of the proposed dam on prominent Chinook salmon
streams.
Instream Flow
What is the sampling strategy (e.g. representative reach, mesohabitat typing) for the defined habitat
types?
How many and at what range will discharge-calibration sets be collected for each sampling method?
Will 2D modeling include side channels and sloughs within study area?
o Based on comments at the meeting it was my understanding it would.
What criteria will be used to identify cover types and substrate sizes?
For PHABSIM, will transects be independent, dependent or a combination and accordingly, what WSE
models and composite suitability index will be used?
What criteria will be used to select and weight transect-derived models?
Per the description of study sites for fish passage/off-channel connectivity (§6.5.4.5.5), what criteria
will be used to identify "a representative number" of different habitat types?
HSI data is needed for identified target species for each defined habitat type, over 2 years.
How will the data be aggregated to evaluate single flow recommendation?
Will a DSS-type program be available to review study results and if so, information is needed on it.
How do you envision the "collaborative process" will work? When will major decisions be made (e.g.
site and transect selections) and how often do you envision the work group will get together?
What equipment will be used and how will they be calibrated?
For the eulachon and boating studies, similar information is needed on what is the study area, what
sampling strategy will be used, how many and what range of calibration-discharge sets if appropriate,
and how will HSI curves will be developed?
Varial zone modeling, may need more defined time steps during analysis phase (possibly down to 15-
minute increments) depending on the rate of flow change over time.
Groundwater
What are the monitoring well placement sampling approach (e.g. equal spacing along linear transects,
etc.) and location (e.g. for instream flow, in all habitat types?) for the various resource studies (i.e.
instream flow, riparian instream flow, water quality). Also, a description of sampling intensity would
be helpful (i.e. for instream flow purposes, will the objective be to characterize entire gw/sw
interaction throughout entire intensive study site or only at select microhabitats).
What is the duration for monitoring (I believe at the meeting it would be from installation until winter
2013-14?)
How often will monitoring wells be calibrated for various parameters to be sampled pre- post- and
during field monitoring?
For each resource discipline, what parameters will be sampled and what are range of accuracies (e.g.
for water level +/- 0.1 ft?, water temp +/- 0.2 C?, etc.).
Water Quality
EMAIL RECORD
Record of Email Page 3 of 3
Information on availability of the Sampling and Analysis Plan and Quality Assurance Project Plan is
needed.
GW Quality in Selected Habitats (Section 5.5.4.7) - need more information on study. For example,
sampling intensity/number of site measurements per slough or criteria for how they will be
determined. Will ground water level monitors be installed if so, what is the sampling intensity
(numbers per habitat type) and duration of monitoring (e.g. continuous year-round/ point samples
during field visits, etc.). If not, it is strongly recommended groundwater monitoring be performed
concurrently with water quality monitoring in this study.
Any monitors should be calibrated pre- and post-monitoring along with multiple field measurements
for post monitoring calibration.
EMAIL RECORD
Record of Email Page 1 of 6
From: Betsy_McCracken@fws.gov [mailto:Betsy_McCracken@fws.gov]
Sent: Friday, September 07, 2012 4:02 PM
To: Betsy McGregor
Cc: Bryan Carey; 'Fullerton, Bill'; Betsy McGregor; Bob_Henszey@fws.gov; eric Rothwell; 'Klein, Joseph P
(DFG)'; 'Kevin Fetherston'; 'Matthew LaCroix'; 'Laura Arendall'; 'Mike Buntjer'; 'MaryLou Keefe'; 'Michael R. Lilly,
GW Scientific'; PHilgert@r2usa.com; rob.plotnikoff@tetratech.com; 'Benkert, Ronald C (DFG)'; susan walker;
'William Rice'; matt.cutlip@ferc.gov; Lori_Verbrugge@fws.gov; Catherine_Berg@fws.gov;
Jennifer_Spegon@fws.gov; dreiser@r2usa.com
Subject: Follow up comments from August 15-17 ILP meetings
Hi Betsy,
Thank you and AEA for hosting the August ILP meetings. We all gained a lot of insight from the meetings, and
we were pleased to be updated. Like others, as a result of the meetings, the Service has a few comments and
concerns to share with the group.
In addition to these below, other staff from the Service may provide comments relative to their study area
expertise. We hope that our collective comments will be helpful toward gaining concurrence on proposed
studies, and as we move forward with the review process of the proposed Watana dam.
Thank you,
Betsy
_________________________________________________________________________________________
_________________________________
September 7, 2012
Notes from ILP Formal Study Meetings August 15-17, 2012:
At the request of AEA and its consultants, the USFWS (Service) submits this brief summary of concerns
regarding the Susitna-Watana hydropower dam formal ILP Formal Study meetings that were held August 16-17,
2012. The Service’s concerns in this informal correspondence, along with other remaining concerns will be
further articulated in the Service’s formal response letter on AEA’s ILP Proposed Study Plan (PSP) review, due
to FERC October 15, 2012. Additional informal comments from the Service may be provided under separate
cover before the October due date.
FWS concerns highlighted during meetings relative to Instream Flow, Habitat Utilization and the
Geomorphology proposed study plans:
Overall, the Service finds that AEA’s proposed study plans for instream flow, habitat utilization and
geomorphology do not fully address agency’s resource management concerns. During the three days of ILP
study meetings, sequencing and integration of the proposed biological resource studies and the physical
process studies was not described and is still a significant outstanding information need. It is necessary to
describe the integration of these inter-related studies and how that integration will result in a comparison of the
baseline biological information and the resulting effects to biologic resources caused by the proposed project
operations. Study results must be quantifiable in order to assess potential losses to aquatic resources and their
habitats, to review the project under our relevant fish and wildlife resource conservation authorities, to inform
fishway prescription authority under Section 18 of the Federal Power Act, and to eventually develop
recommended protection, mitigation, and enhancement for the project license. We do not believe that the
current study plan proposals will yield sufficient information to allow us to adequately assess proposed project
impacts to the Nation’s fish and wildlife resources and develop adequate PME’s.
EMAIL RECORD
Record of Email Page 2 of 6
The Service has repeatedly articulated concerns about the lack of study sequencing, connectivity and
integration between the biological studies and the other proposed engineering and physical processes studies.
We reiterate and highlight the need for the collection of adequate temporal and spatial baseline biological and
fish habitat data to provide direct input to some of the proposed physical modeling efforts. Many of our
concerns, below, are related to the temporal mismatch of biological data collection with the forward momentum
of the physical modeling efforts.
-Habitat Mapping
Hierarchially-nested aquatic habitats- HDR stated at the meeting that the “habitat mapping” will be started in
September; and that the sampling will be stratified by meso-habitat type as identified in the 1980’s study reports.
The 1980’s studies did not hierarchically nest the habitat types. The Service specifically requested hierarchially
nested habitat mapping (e.g., Frissel et al, 1986). We are concerned with the proposal to use the 1980’s study
sites, which focus on the side sloughs, and do not consider the full breadth of fish habitats, which is currently
unknown and the subject of ongoing study that has not been completed or submitted for agency review and
comment. We do not endorse the use of the 1980’s sites without out first completing and then applying a
hierarchal assessment of the river reaches as a study framework. The hierarchally nested aquatic habitats
framework is needed to structure fish distribution surveys, the instream flow study and other physical process
studies. Without it, the fish surveys will be too narrowly constrained and the instream flow studies will not
represent all habitats that may be affected by the proposed project. The Service recommends the following
habitat hierarchy for the Susitna River be used for habitat mapping purposes and integration of studies:
Large River Floodplain Habitat Hierarchy
1. Geomorphic units: Large-scale geomorphic and hydraulic controls.
a. Bedrock controlled, single-channel units with shallow hyporheic exchange and thermal homogeneity.
b. Unconfined, multiple channel floodplain units with expansive hyporheic exchange and thermal
heterogeneity.
2. Macrohabitats: Primary, flood, and spring channel networks.
a. Primary channels—Perennial channels.
b. Flood channels—Seasonally connected channels.
c. Spring channels—Disconnected sloughs that discharge groundwater.
d. Floodplain ponds—Ponded spring channel networks.
3. Mesohabitats: Bed and bank morphological controls; hydraulic features.
a. Riffle-pool sequences—Run, riffle, pool, glide, tailout.
b. Backwaters, alcoves, shallow meander margins.
4. Microhabitats: Hydraulics, water quality, substrate, cover.
a. Water depth, velocity, bulk flow characteristics (e.g. Reynolds and Froude #’s).
b. Vertical hydraulic exchange (ground and surface water exchange).
c. Bed, or intragravel temperature and dissolved oxygen.
d. Substrate size, heterogeneity.
EMAIL RECORD
Record of Email Page 3 of 6
e. Elements of wood, vegetation, and rock structure.
-Fish distribution: A first step is to assess the seasonal distributions of target species and life stages and the
physical habitat criteria that influence habitat selection and suitability. As a first step, target species have to be
identified, agreed upon, and their life history and habitat use similarities to other, unstudied species (i.e., non-
target species) need to be determined and described. In the study requests of the Service and other agencies,
we recommended studying the baselines of all affected fish species and life stages, including all five species of
anadromous salmon and all resident fish.
Fish distribution data are needed to describe the baseline data to support and compliment other proposed study
objectives, including those related to fish habitat selection and utilization. A first step to acquiring adequate fish
distribution is to assess the full lateral and longitudinal profile of seasonal fish distribution, life stage periodicity,
and suitable used and unused habitats that are influential in fish habitat site selection. The fish distribution data
is needed to provide the base data layer that will support and compliment other proposed study objectives,
including those related to fish habitat selection and utilization, and instream flow (ISF) needs. This information
is also needed for resource agencies’ fishway prescription decisions under the Federal Power Act. Baseline
biological information is critical input necessary for integration with physical studies. Accordingly, the Service is
reiterating the need for multiple and continuous years of biologically relevant data in order to provide robust
integration with the physical modeling studies, and decision-support relative to fish and wildlife resources of the
Susitna River basin.
-Habitat site selection criteria: Criteria that influence habitat selection and suitability need to be identified
using statistically powerful and robust methods and current models of fish distribution including bioenergetics
and not exclusively physical habitat models (Lovtang 2005). The Service remains opposed to the proposal to
repeat the 1980’s approaches to fisheries studies. The 1980’s studies do not determine the habitat criteria
influencing fish habitat site-selection, they simply report utilization functions for water depth and velocity, or
depth and substrate. They also lack a fundamental baseline assessment of all available fish habitat and instead
focus on study of habitats that had high fish use density. The habitats that were apparently suitable but
unoccupied or underutilized by fish need to be assessed, and the entire range of habitat availability and habitat
use data need to be assessed prior to habitat study site selection.
More comprehensive data collected on nearby glacial rivers may be used to demonstrate that habitat selection
by salmon in side-sloughs can be independent of water depth and velocity and should be compiled.
Fish habitat study sites should be surveyed and identified using the full range of habitats seasonally utilized by
agreed-upon target species and life stages. The objective is to identify the bioenergetics and physical factors
that control fish habitat selection. The Service considers the assessment of habitat influential to fish habitat site
selection to be an objective of the Instream Flow and Habitat Utilization Study request. In the resource agencies
Instream Flow and Habitat Utilization Study Plan requests, this is a specifically stated objective.
Sequentially, appropriate flow-habitat models can be selected after assessment and validation of 1) the full
seasonal distribution of target species and life stages,2) the physical factors (e.g., micro-habitat data) that
influence habitat selection and suitability, and 3) the bioenergetic factors affecting fish habitat suitability and
productivity.
Thus, field visits proposed for the end of September (2012) should be considered as reconnaissance and for
discussion purposes, and not for the purpose of actual study site-selection.
-Habitat Suitability Indices: Methods for collecting site-specific habitat criteria for the glacial Susitna River
need to be collaboratively identified. (As recommended in the resource agencies study plan request for Instream
Flow and Habitat Utilization). These criteria also need to be evaluated in the context of the hierarchical habitat
model, such that habitat criteria are determined and evaluated in all habitats of importance to each agreed-upon
target species and life stage.
The 1980’s studies were inconclusive in demonstrating a relationship between fish habitat criteria and fish
distribution, and they were also narrowly focused on associations of spawning and rearing salmon with water
EMAIL RECORD
Record of Email Page 4 of 6
depth and velocity in spring channels (side sloughs). Not only is this not representative of existing habitat and
the distribution of fish within those habitats, habitat data collected from nearby glacial rivers demonstrates that
spawning habitats selection is independent of flow depth and velocity in side sloughs and may be profoundly
influenced by bioenergetics and the input of organic matter .
This indicates that traditional hydraulic modeling (e.g., PHABSIM), as proposed, may be an insufficient fish
focus/tool. So, first we need to identify criteria that are influential to habitat selection, within the full seasonal
distributions of agreed-upon target species and life stages. Only then, after this has been adequately
determined, can we begin to develop utilization functions (curves or HSC) for those criteria.
The Service has previously expressed concern with the approach of repeating the 1980’s study effort, and we
have repeatedly asked for both a complete compilation of available data, and a review of the 1980’s information
prior to accepting its use for the proposed project. Lacking that review, we independently note that, in the
1980’s sites were selected that were, presumably, heavily utilized by spawning sockeye and chum (qualitative).
Study sites need to be based on relevant criteria related to physical habitat site selection as documented by fish
distribution and lack thereof.
-Groundwater- The integration of the groundwater study efforts with the biological studies is not clear.
Specifically, how will the groundwater study be made relevant to the scale of fish habitat and fish habitat site
selection in the Susitna River? The objectives of the groundwater study should include relevance to the
hierarchially nested habitats, including macro-, meso-, and micro-habitats that are influential to fish habitat
selection. The groundwater study sampling design should be relevant to fish habitat and site selection. A
specific objective needs to be measuring the hydraulic gradient/head (upwelling or downwelling) under the
existing hydrograph and under the proposed project hydrograph release flow schedule.
-Model selection: We need to first determine what criteria are important to fish habitat site/suitability and
selection before we can choose an appropriate flow-habitat model. ADFG Marine Mammals biologist, Dr. Bob
Small also reiterated this very same point regarding model selection for the beluga whale studies. Again, the
Service notes our concern about the limited focus of the 1980’s studies and using PHABSIM. Our concerns
stated in earlier correspondence to AEA remain unaddressed and are reiterated here for emphasis.
Model sensitivity and relevant criteria (inputs) are critical to achieving statistically valid outputs. At this point, it is
premature to select a model until we have known 1) fish distribution, and 2) identification of variables influential
to fish habitat site selection.
-Biometric Review- The Service previously requested a biometric review of the 1980’s findings. This request is
remains outstanding and should be conducted prior to basing any study plans on 1980’s studies or results. In all
cases, including the usage of the 1980’s Su-hydro data results and for the Susitna-Watana study plans,
estimates of precision and accuracy of study results is required to evaluate the power of any study plan. Details
of proposed study plan sampling and design methods need to be explicit and statistically valid with a priori
determination of levels of precision and accuracy of model outputs.
-Fish genetics- During the August 15-17 meetings, AEA stated that genetic samples from the Chinook above
the proposed dam site would not be collected. The stated rationale was due to the desire to minimize the
handling of the fish after subsequent tagging of fish. Genetic samples of Chinook at locations above the
proposed Susitna-Watana dam site are crucial to informing the Service’s management goals specific to
recommending licensing conditions under the Federal Power Act, and to conservation recommendations under
the Fish and Wildlife Coordination Act, and the Anadromous Fish Act. As such, we consider our request for
collection of genetic samples from Chinook salmon, and other fish species to be necessary for our resource
evaluation of the Susitna-Watana hydropower project.
Because of this information need, if AEA does not plan to collect the information, AEA should document how
this study request is being addressed.
Fish species genetic samples used for comparisons should be less than ten years old to reflect current gene
frequencies among the sampled fish populations. Genetic samples for salmon exist for some tributaries in the
EMAIL RECORD
Record of Email Page 5 of 6
lower and middle Susitna River. Some of these samples are greater than ten years old.
Fish genetic samples should be current and include samples of the Chinook migrating above the proposed dam
location. Because gene frequencies change over time, all genetic samples should be within the most recent ten
years to allow for valid comparison. Genetic analysis should analyze the existing extent of genetic differentiation
within and between fish using distinctly different habitats. We request genetic analysis of Chinook above the
proposed dam site relative to those at other upper, middle and lower river and tributary sample locations.
-Fish Passage/fishway prescription- The Service is concerned with the lack of transparent discussion about
the potential for fish passage alternatives at the proposed Susitna-Watana dam. If fish passage is required, how
will that be accomplished? If it is not feasible, what is your alternative proposal? Where is your project
assessment of the fish passage feasibility? What are the design criteria being considered/evaluate d?
-Compensatory Mitigation- Compensatory mitigation is determined as part of a mitigation sequence after
avoidance, and minimization efforts. The Service has inquired about potential compensatory mitigation for
project impacts during several meetings. To date, this concern has not satisfactorily been addressed by the
project sponsors or project consultants. Because compensatory mitigation is a requirement in order to offset
unavoidable projects impacts to fish and wildlife resources and their habitats, it is should be considered
throughout the review process. Please explain how you plan to quantify existing habitats, and quantify primary,
secondary and cumulative (40cfr Part230 of the CWA) losses to those habitats under the proposed operational
flows over the temporal scale of the license period. How will habitats change proportionally under project
operations?
-Lower river- The Service is concerned with AEA consultants’ proposal to establish a lower boundary for the
physical studies (e.g., geomorphology, instream flow) at a location “downstream of Sunshine” at approximately
river mile 75, and not extend the study efforts further down into lower river to inform the biological studies. There
are many biological resource studies that would necessarily be informed by establishing a consistent study
boundary between the physical and biological studies. For example, studies related to the federally listed Cook
Inlet beluga whale, fish species and habitats, including the resident species, and anadromous salmon a nd
eulachon (beluga whale prey species). The lower river also includes the Susitna Flats State Game Refuge. If the
physical studies boundary is terminated at river mile 75, there will be no ability to relate or integrate biological
data to those studies (e.g., geomorphology, ISF, ice processes, flow routing). Resource agencies management
goals would effectively not be addressed below river mile 75, if project effects are not assessed to the mouth of
the river.
According to USACE (1966), 80% of the ability to produce accurate model results depends on using
appropriate bathymetry data, mesh design, and boundary conditions. The amount of time needed to collect this
information, particularly the bathymetry data, depends on the complexity of the channel’s geometry, which is
known to be complex in the lower Susitna River. Because data collection in the lower river will likely require
rigorous field collection due to the channel complexity, it is critical to initiate these efforts in a time sensitive
manner. The proposal to delay work in the lower river pending analysis at an arbitrary, and certainly non-
biologically relevant location, does not meet resource agencies objective of evaluating the potential project
impacts to fish and wildlife resources in the lower Susitna River. This is particularly true under the FERC ILP
process timeline specific to the Susitna-Watana dam project.
-Studies integration: A “map” or chart of how studies are proposed to be integrated is needed. AEA sponsors
and consultants, committed to providing this by September. Biological resource components are currently not
integrated or connected to the other studies, and appear as being treated independently of the rest of the study
requests. Study proposals must demonstrate how they will be integrated to provide needed resource
information.
Studies/components not address from the Non salmon anadromous, resident and invasives fish species
study request: During the August ILP meetings, the follow Service requests were preliminarily noted as not
being addressed or adequately addressed by AEA’s PSPs.
EMAIL RECORD
Record of Email Page 6 of 6
1) Marine derived nutrients contribution from non salmon anadromous species. The Service requested
information in our non-salmon anadromous, resident and invasive study plan request. It is not clear which study
proposal it is addressing this request, or IF it is being addressed. During the August 15-17 meetings, it was
indicated that it may be addressed in either the riparian instream flow, the terrestrial wildlife, the river
productivity or elsewhere. However, AEA’ s consultants were unable to specifically “point to it” when asked. It
does not appear to have been included in the PSPs.
2) Resource valuation of non-salmon anadromous and resident fish resources. During the meeting, AEA
consultants stated that a resource valuation would not be provided, as requested in the Service’s study request
for non salmon anadromous, resident and invasive fish study. An explanation of why this assessment will not be
addressed was not provided. We request that an explanation be provided that describes the rationale for this
determination and urge reconsideration of our study request.
3) Trophic ecology- The Service requested information on trophic ecology in the non salmon anadromous,
resident and invasive species study request. Michael Link stated that there are “significant predator-prey
dynamics” particular once fish move out of the mainstem; using this behavior to explain why fish hold there until
they are ready to dash to tributaries. He noted that the creeks are heavily preyed upon by bears, for example.
Dr. Bob Small (ADFG) recommended trophic ecology and/or foraging ecology information for the Cook Inlet
beluga whale studies. For fish, coordination with Tim Nightengale (AEA’s consultant; via teleconference) stated
that he would take gut samples from fish to see what macro-invertebrates they are eating, and when, and will
work with fish study teams to do some trophic analysis. The trophic ecology component needs to be clearly
spelled out in a study plan identifying any aspects that will and will not be addressed explained and with
appropriate rationale.
References:
Frissell, C. A., W. J. Liss, C. E. Warren, and M. D. Hurley. 1986. A hierarchical framework for stream habitat
classification: viewing streams in a watershed context. Environmental Management 10:2. Pp. 199-214.
Lovtang, J. C. 2005. Distribution, habitat use, and growth of juvenile Chinook salmon in the Metolius River
Basin, Oregon. M.S. Thesis, Oregon State University. March 2005.
USACE 1966. (Full citation will be provided in follow-up correspondence)
Betsy W. McCracken
Fishery Biologist
Conservation Planning Assistance
Ecological Services
US Fish and Wildlife Service/Region 7/Anchorage Field Office
Betsy_McCracken@fws.gov
(907) 271 - 2783
EMAIL RECORD
Record of Email Page 1 of 12
From: Michael_Buntjer@fws.gov [mailto:Michael_Buntjer@fws.gov]
Sent: Friday, September 07, 2012 5:37 PM
To: Betsy McGregor
Cc: Betsy_McCracken@fws.gov; Catherine_Berg@fws.gov; Lori_verbrugge@fws.gov; eric Rothwell; Brian
Lance; susan walker; joe.klein@alaska.gov; MaryLou Keefe; Cassie_Thomas@nps.gov; tsundlov@blm.gov
Subject: Follow up Notes from the August 2012 Work Group meeting
Hello Betsy:
Thank you for the opportunity to discuss the proposed study plans for the Susitna-Watana
Hydroelectric Project. We look forward to further discussions to clarify the details of the proposed
study plans. I have attached some initial notes, comments, and questions regarding the objectives in
our three fish study requests, our River Productivity Study Request, and those found in the proposed
study plan.
These comments are in addition to those provided during the August 2012 work group meetings, and
are intended to assist in further discussions about development of the study plans. In addition to the
attached comments, I have some overall questions, comments, and concerns about the proposed fish
studies. Based on the proposed methodologies, there does not appear to be any studies to collect
baseline biological or physical spawning habitat information between the time eggs are deposited in
redds and the time of fry emergence, and no information on the timing and movement of fish from
spawning to rearing areas, and only limited information on the distribution and abundance of juvenile
fish up to 60 mm, particularly in winter. These are the life stages most vulnerable to load-following
operations.
Although I have more questions and comments regarding linkages between proposed studies and
project details, these should serve as a starting point for the upcoming fish sub-workgroup meetings. If
you have any questions, please feel free to contact me. Thanks.
Mike
(See attached file: ELH Juvenile Adult Fish D and A Riv Pro mb initial draft comments on PSP.docx)
Mike Buntjer
US Fish and Wildlife Service, Anchorage Field Office
Conservation Planning Assistance
605 W. 4th Ave, Room G-72
Anchorage, AK 99501
(907)271-3053
(907)271-2786 FAX
EMAIL RECORD
Record of Email Page 2 of 12
ATTACHMENT: ELH Juvenile Adult Fish D and A Riv Pro mb initial draft comments on PSP.doc
For each USFWS Study Request below (including our three fish studies and River Productivity) I listed the
objectives in each study request and then followed them with the objectives I found in the PSP. I noted where
the objectives were the same, where they differed, and where our study requests were not addressed in the
PSP. I also include other notes, comments, and questions to assist in further discussions about the proposed
studies.
Early Life History and Juvenile Fish Distribution and Abundance in the Susitna River (USFWS Study
Request; Enclosure 13)
Specific study request objectives versus objectives included in PSP Study 7.5 (upper reach) and Study 7.6
(middle and lower reach):
1. Determine the seasonal distribution, relative abundance (as determined by CPUE, fish density, and
counts), and fish-habitat associations of juvenile anadromous and resident juvenile fish species in the
mainstem Susitna River (side channel, slough, backwater, and tributary confluence habitats).
1. Describe the seasonal distribution, relative abundance (as determined by CPUE, fish
density, and counts), and fish-habitat associations of resident fishes, juvenile anadromous salmonids,
and the freshwater life stages of non-salmon anadromous species; (7.5 upper reach)
- Only winter sampling I see proposed in the upper reach includes using DIDSON and video cameras
in 10 “selected” sloughs and side channels; how were/will sites be selected?; What other habitat
types are available and why are they not being sampled? Is this sufficient to get at winter
distribution and abundance for all life stages?; will not likely be able to identify juvenile species
using these techniques (therefore, no distribution and abundance information and habitat use by
species, particularly for early life stages (<60 mm); other winter sampling (using gill nets, minnow
traps, and trot lines) is listed in the schedule section (and not in methods), but it is not described.
1) Describe the seasonal distribution, relative abundance (as determined by CPUE, fish density, and
counts), and fish-habitat associations of juvenile anadromous salmonids, non-salmonid anadromous
fishes and resident fishes; (7.6 middle and lower reach).
- The list of habitat types to be sampled in this study (middle and lower reaches) appears longer than
habitats proposed for the upper reach, but otherwise same comments as listed above for Study 7.5
(upper reach).
2. Describe the seasonal movements and migratory patterns of juvenile anadromous and resident
juvenile fish species among mainstem habitats and between tributaries and mainstem habitats with
emphasis on identifying foraging and overwintering habitats.
5. Use biotelemetry (PIT and radio tags) to describe seasonal movements of selected fish species
(including rainbow trout, Dolly Varden, whitefish, northern pike, burbot, and Pacific lamprey if present)
with emphasis on identifying spawning and overwintering habitats within the hydrologic zone of
influence upstream of the project; (7.5 upper reach)
EMAIL RECORD
Record of Email Page 3 of 12
- Unclear if this includes or excludes PIT tagging juvenile anadromous salmon, particularly Chinook
salmon; i.e., none are listed
- Also, mentions installing up to six antenna arrays in selected sloughs and side channels in winter; is
that sufficient to determine movement of juveniles in and out of habitats? What about other
habitats? Unclear how sites were selected and what habitats were or were not sampled in the
1980s. Therefore, what is rationale and assumptions for selecting habitat types and sites?
- See nothing on movement (and timing) of newly emergent fish from spawning to rearing areas or
movement of juvenile fish <60 mm in winter (i.e., the post-emergent life stages most vulnerable to
load-following operations)
2) Describe seasonal movements of selected fish species such as rainbow trout, eulachon, Dolly Varden,
whitefish, northern pike, Pacific lamprey, and burbot) using biotelemetry (PIT and radio-tags) with
emphasis on identifying foraging, spawning and overwintering habitats within the mainstem of the
Susitna River and its associated off-channel habitat; (7.6 middle and lower reach)
- Unclear if this includes or excludes PIT tagging juvenile anadromous salmon; i.e., none are listed
- Also, mentions installing up to 10 antenna arrays; is that sufficient to determine movement of
juveniles in and out of habitats by reach? When, where, and how will sites be selected? What is
rationale and assumptions for selecting habitat types and sites?
- See nothing on movement (and timing) of newly emergent fish from spawning to rearing areas or
movement of juvenile fish <60 mm in winter, particularly for anadromous salmonids.
3. Document the timing of downstream movement of all juvenile fish species and outmigration for
anadromous salmon.
6. Document the timing of downstream movement and catch for fish species via outmigrant traps; (7.5
upper reach)
- Unclear if this includes or excludes addressing outmigration and winter sampling
3) Document the timing of downstream movement and catch for all fish species using outmigrant
traps; (7.6 middle and lower reach)
Unclear if this includes or excludes addressing outmigration
4. Document the age structure, growth, and condition of juvenile anadromous and juvenile resident fish
by season.
4) Characterize the age structure, growth, and condition of juvenile anadromous and
resident fish by season; (7.6 middle and lower reach)
EMAIL RECORD
Record of Email Page 4 of 12
- Is there a difference between Document (as requested) and Characterize (as proposed)? Explain
- Is this study objective limited to juveniles or should it say “all” resident fish.
- This objective is not included in upper reach; should at least characterize age structure for all
resident and anadromous fish by season
5. Collect and analyze tissue samples from juvenile salmon and opportunistically from all resident and
non-salmon anadromous fish to support the Genetic Analysis study.
3. Collect tissue samples to support the Genetic Baseline Study for Selected Fish Species (Section 7.14);
(7.5 upper reach)
- No mention of analyzing samples; analysis mentioned in Genetic Baseline Study, but
link/integration to analyzing samples collected in this study is not discussed. Will samples be
analyzed? Explain.
6) Collect tissue samples from juvenile salmon and opportunistically from all resident and non-salmon
anadromous fish to support the Genetic Baseline Study (Section 7.14). (7.6 middle and lower reach)
- Again, no mention of analyzing samples; analysis mentioned in Genetic Baseline Study, but
link/integration to analyzing samples collected in this study is not discussed. Will samples be
analyzed? Explain.
- Because PSP is not structured similarly to our study requests, why is this study objective limited to
juvenile salmon? This may be okay, because genetic sampling included in Salmon Escapement
Study, though no mention in study of analyzing samples or overall links between studies. Without
providing linkages between studies, there is a lot of searching required to find if, where, and how
information is being collected.
6. Collect and provide the Instream Flow study with habitat suitability criteria (HSC) data to support
analysis of potential project impacts.
Mention of HSC is in Study 6.5, but the study request objective is not addressed in the upper,
middle, or lower reaches for juvenile anadromous, resident fish, and non-salmonid anadromous
fish studies. It is unclear how HSC information will be collected, particularly in winter for post-
emergent fish up to 60 mm when fish will be most vulnerable to load-following operations. I see
no empirical baseline information being collected to evaluate potential project effects or for
inclusion in habitat modeling efforts. There is generic reference to developing HSC model in Study
6.5 for these species and life stages, but unclear about the source of that information.
7. Evaluate salmon incubation (embryo development, hatching success, and emergence times) and
associated water quality conditions (e.g., temperature, DO, pH) at existing spawning habitats (slough,
EMAIL RECORD
Record of Email Page 5 of 12
side channel, tributary, and mainstem) in areas with and without groundwater upwelling in the middle
and lower reaches of the Susitna River.
Study Request objectives 7-9 are not addressed in 7.5 or 7.6; there is no mention of egg incubation
(rates or success), hatching (rates or success), stranding (ramping rates) or emergence (dates and
times) sampling anywhere; no mention of baseline intragravel temperature or water quality
monitoring of spawning and pre-emergent juvenile fish habitats; no mention of characterizing
baseline water quality conditions at spawning or rearing habitats.
Only mention is in Study Goals (6.5.1.2, page 6-10); Objective 8. Conduct a variety of post-
processing comparative analyses derived from the output metrics under aquatic habitat models.
Approach appears to evaluate using only physical habitat models and without empirical sampling
post-spawning through emergence and for juveniles up to PIT tagging size (i.e., 60 mm).
8. Evaluate the potential for stranding of juvenile fish and stranding mortality by season under proposed
operational conditions.
This Study Request objective is not addressed. Stranding is mentioned in Chapter 6, but the study
approach is not discussed
9. Measure intragravel water temperature in spawning habitats and winter juvenile fish habitats at
different surface elevations and different depths to determine the potential for freezing of redds,
freezing of juvenile fish, and their habitats.
This Study Request objective is not addressed anywhere.
EMAIL RECORD
Record of Email Page 6 of 12
Adult Salmon Distribution, Abundance, Habitat Utilization and Escapement in the Susitna River (USFWS
Study Request: Enclosure 15)
Specific objectives included in study request versus objectives listed in PSP Study 7.6:
1. Capture, radio tag and track adults of the five species of Pacific salmon in proportion to their
abundance.
1. Capture, radiotag, and track adults of five species of Pacific salmon in the middle and upper
Susitna River in proportion to their abundance. Capture and tag Chinook and coho salmon in
the lower Susitna River.
2. Determine the migration behavior and spawning locations of radio-tagged fish in the lower,
middle, and upper Susitna River.
2. Characterize the migration behavior and spawning locations of radiotagged fish in the lower,
middle, and upper Susitna River.
3. Characterize adult salmon migration behavior and run timing within and above Devils Canyon.
3. Characterize adult salmon migration behavior and timing within and above Devils Canyon.
4. If shown to be an effective sampling method during the 2012 study, and where feasible, use
sonar to document salmon spawning locations in turbid water.
4. If shown to be an effective sampling method during the 2012 study, and where feasible, use
sonar to document salmon spawning locations in turbid water in 2013 and 2014.
5. Compare historical and current data on run timing, distribution, relative abundance, and
specific locations of spawning and holding salmon.
5. Compare historical and current data on run timing, distribution, relative abundance, and
specific locations of spawning and holding salmon.
6. Estimate escapement of adult salmon spawning by mainstem reaches and tributaries.
6. Generate counts of adult Chinook salmon spawning in the Susitna River and its tributaries.
Need to define “generate count” and how generated. If it is an index of abundance, then need
to identify the standardized unit of effort. Also, not sure why escapement estimate is not being
determined? This study references escapement estimates from the 1980s, but not here.
Explain.
7. Collect tissue samples to support the Genetic Analysis Study.
7. Collect tissue samples to support the Fish Genetic Baseline Study (Section 7.14).
8. Determine system-wide Susitna River escapement and run apportionment.
8. Estimate system-wide Chinook and coho salmon escapement to the Susitna River and the
distribution of those fish among tributaries of the Susitna River.
9. Determine the availability and accessibility of spawning habitats by adult salmon to mainstem
and tributary locations based upon flow regime.
Unclear if, how, or where this Study Request objective is being addressed.
EMAIL RECORD
Record of Email Page 7 of 12
Not listed as an objective in this study; section 6.5.4.3.1 (page 6-19) describes assessing
access to rearing and spawning habitats via output from flow routing models. Also,
objective 13 (shown below) in fish passage study (section 7.12); page 7-98):
13. Evaluate the potential creation of fish passage barriers within existing habitats (tributaries,
sloughs, side channels, off-channel habitats) related to future flow conditions, water surface
elevations, and sediment transport.
10. Measure critical habitat characteristics (e.g., channel type, flow, substrate, and groundwater)
at reaches used for spawning and compare these characteristics with those in adjacent
reaches that do not contain spawning adults.
Do not see this study request objective addressed or any objective that looks at characterizing use,
availability, or quality of potential spawning habitats. There appears to be no empirical baseline
information being collected; only see determining distribution and potential abundance of redds.
Also, see mention of evaluating potential dewatering or scouring of redds in Chapter 6, but no
empirical baseline information to assess daily load-following operations.
EMAIL RECORD
Record of Email Page 8 of 12
River Productivity Study (USFWS Study Request: Enclosure 11)
Specific Study Request objectives versus objectives listed in proposed study 7.8:
1. Develop a white paper on the impacts of hydropower development and operations (including
temperature and turbidity) on benthic macroinvertebrate and algal communities in cold climates.
1. Synthesize existing literature on the impacts of hydropower development and operations (including
temperature and turbidity) on benthic macroinvertebrate and algal communities;
- Any difference in developing a white paper versus synthesizing existing literature?
2. Characterize the pre-project benthic macroinvertebrate and algal communities with regard to species
composition and abundance in the lower, middle and upper Susitna River.
2. Characterize the pre-Project benthic macroinvertebrate and algal communities with
regard to species composition and abundance in the middle and upper Susitna River;
- Omission of lower reach is an apparent typo.
3. Estimate drift of benthic macroinvertebrates in habitats within the lower, middle and upper Susitna
River to assess food availability to juvenile and resident fishes.
3. Estimate drift of benthic macroinvertebrates in selected habitats within the middle and upper Susitna
River to assess food availability to juvenile and resident fishes;
- Omission of lower reach is an apparent typo.
4. Conduct a trophic analysis to describe potential changes in the primary and secondary productivity of
the riverine community following post-project construction and operation.
5. Conduct a review on the feasibility of a trophic analysis to describe potential changes in the primary
and secondary productivity of the riverine community following Project construction and operation;
- Shouldn’t this read: Conduct a trophic analysis, if feasible, to describe…? Also, why would it not be
feasible? Explain.
5. Generate habitat suitability criteria (HSC) for Susitna River benthic macroinvertebrate and algal
habitats to predict potential change in these habitats downstream of proposed dam site.
EMAIL RECORD
Record of Email Page 9 of 12
6. Generate habitat suitability criteria for Susitna benthic macroinvertebrate and algal habitats to
predict potential change in these habitats downstream of proposed dam site;
6. Characterize the benthic macroinvertebrate compositions in the diets of representative fish species in
relationship to their source (benthic or drift component).
7. Characterize the macroinvertebrate compositions in the diets of representative fish
species in relationship to their source (benthic or drift component);
- I assume this should include term “benthic”. If not, explain difference.
7. Evaluate the feasibility of reference sites on the Talkeetna and Chulitna Rivers to monitor baseline
productivity, pre- and post-construction. (deleted in PSP; and not addressed)
AEA replaced this objective (with #4 below), but based on discussion at August 15, 2012, TWG meeting
it was suggested to do both or keep the original Study Request objective. We recommend and support
that suggestion.
4. Conduct a literature/data search to identify existing river systems that could act as
surrogates in evaluating future changes to productivity in the Susitna River. (added in PSP)
8. Characterize organic matter resources (e.g., available for macroinvertebrate consumers) including
course particulate organic matter, fine particulate organic matter, and suspended organic matter in
the lower, middle, and upper Susitna River.
8. Characterize organic matter resources (e.g., available for macroinvertebrate consumers) including
course particulate organic matter, fine particulate organic matter, and suspended organic matter in
the lower, middle, and upper Susitna River.
9. Estimate benthic macroinvertebrate colonization rates in the middle and lower reaches to monitor
baseline conditions and evaluate future changes to productivity in the Susitna River.
EMAIL RECORD
Record of Email Page 10 of 12
9. Estimate benthic macroinvertebrate colonization rates in the middle and lower reaches to monitor
baseline conditions and evaluate future changes to productivity in the Susitna River.
Note: Page 7-12 of PSP states that marine derived nutrients are included in River Productivity Study,
but there is no mention of it in Chapter 7; i.e., is not addressed.
EMAIL RECORD
Record of Email Page 11 of 12
Adult and juvenile non-salmon anadromous, resident and invasive fish studies in the Susitna River
basin (RM 0 - RM 233)(USFWS Study Request; Enclosure 14)
General objectives for this study request are to:
COMMUNITIES AND ASSEMBLAGES
Characterize the seasonal (spring, summer, fall, winter) distribution, relative abundance, and habitat
utilization in the Susitna River mainstem (RM 0-RM 233) for all life stages of non-salmon anadromous,
resident, and invasive fish species. [Documenting both hierarchal nested habitat type and use-type as
described in the resource agency Instream Flow Study and Habitat Utilization Study Request].
Recommendation for hierarchical nested habitat type and use-type not addressed in PSP.
Characterize the seasonal (spring, summer, fall and winter) movement patterns of all subject fish
species and life stages as they relate to foraging, spawning, rearing and overwintering habitats. The
characterization of seasonal movements includes run timing (immigration and emigration) and extent
(periodicity) of non-salmon anadromous species in the Susitna River (RM 0-RM 233) and movement
into and out of tributary streams. [Interface with resource agency Instream Flow and Habitat
Utilization Study Request hierarchal nested habitat types and habitat mapping].
Interface with resource agency Instream Flow and Habitat Utilization Study Request hierarchal
nested habitat types and habitat mapping does not appear to be addressed.
Characterize the flow-related or synchronized life history strategies (migration, movement, spawning,
rearing, hatching, emergence) of non-salmon anadromous, resident and invasive species, and their
biological behavorial response (e.g., potential for false attraction, delayed migration or increased
holding time, synchrony of spawning, relative hatching and emergence timing) to Project-affected flow
alterations (flow, temperature, habitat, water quality).
Similar to juvenile anadromous salmonid comments above, much of this Study Request objective
does not appear to be addressed in the PSP, particularly for movement, rearing, hatching,
emergence and juvenile fish (<60 mm) in winter.
RESOURCE DATA SYNTHESIS
Synthesize existing resource data, results and information from 1980’s Susitna Hydroelectric studies,
and other relevant literature to determine applicability and utility of results and information to the
currently proposed project.
What is timeframe for completing? Not addressed in PSP
GENETICS
Collect tissue samples from all resident and non-salmon anadromous fish species for genetic
population structure database and future stock identification analysis. This is particularly important for
salmon species, anadromous lamprey, and Bering cisco of the Susitna River drainage.
TROPHIC ECOLOGY
EMAIL RECORD
Record of Email Page 12 of 12
Characterize trophic interactions using seasonal diets (stomach content analysis) of all age classes of
non-salmon anadromous, resident and invasive fish species. [Interface with the productivity study,
riparian, and instream flow study requests]
Quantify the relative contribution (biomass) of marine-derived nutrients to the ecology of the Susitna
River from adult returns of non-salmon anadromous fish species (e. g., Pacific and Arctic lamprey,
eulachon, Bering cisco).
Page 7-12 of PSP states that marine derived nutrients are included in River Productivity Study, but
there is no mention of it in Chapter 7; i.e., is not addressed.
EMAIL RECORD
Record of Email Page 1 of 4
From: Bob_Henszey@fws.gov [mailto:Bob_Henszey@fws.gov]
Sent: Tuesday, September 11, 2012 12:26 PM
To: 'Kevin Fetherston'; Betsy McGregor
Cc: Catherine_Berg@fws.gov; Ann_Rappoport@fws.gov; Betsy_McCracken@fws.gov;
Jennifer_Spegon@fws.gov; Lori_Verbrugge@fws.gov; Michael_Buntjer@fws.gov; chiska.derr@noaa.gov; Klein,
Joseph P (DFG); 'Matthew LaCroix'; 'Michael R. Lilly, GW Scientific'; eric Rothwell; susan walker; 'William Rice';
matt.cutlip@ferc.gov; dreiser@r2usa.com
Subject: PSP 6.6 Riparian Instream Flow Study Plan - Interim Comments
Kevin,
The following are some of the key differences the USFWS sees between our study plan request (USFWS 10.1,
Instream Flows for Floodplain and Riparian Vegetation Study) and AEA's proposed study plan (PSP 6.6,
Riparian Instream Flow Study). The differences and comments listed below are likely not inclusive, since we
have not had a chance to fully evaluate the PSP.
Many of the PSPs rely upon or provide data from/for other studies. Recognizing these relationships is an
important part of the Integrated Licensing Process (ILP); however, the study providing the data should describe
the methodology and oversee the data collection and analyses, while the study requiring the results should
restrict its discussion to the types of data/results required from other PSPs. Repeating the methods in a study
not responsible for the data collection and analyses is unnecessary and risks confusion if the methods differ or
are inadequate in one of the studies. Since the Riparian Instream Flow PSP will rely upon data from the
Groundwater PSP, the Riparian Instream Flow PSP should describe only the results required from the
Groundwater PSP, and then describe how those results will be used in the Riparian Instream Flow PSP (e.g.,
5.7 Groundwater PSP should be the only PSP that describes the groundwater methods). This applies to other
PSPs, such as the habitat mapping studies that may be providing data for this PSP.
Study Goals and Objectives: The USFWS requested a specific goal that included quantifying the frequency,
timing and duration of surface-water and groundwater levels required to establish, maintain, and promote
floodplain and riparian plant communities. Two ancillary goals were also requested to quantify the frequency
and rate of sediment deposition required to promote soil development, and to quantify the effect of river ice on
the establishment and persistence of riparian plant communities. Section 6.6.1.1 of the PSP has no stated goal,
and only a general approach is provided. An "overarching goal" is provided in the Section 6.6.4 Study Methods,
but this goal is also very general. While goals can be very general in nature, the specifics in our goal set the
stage for a rigorous study plan to evaluate potential project-related effects on floodplain plant communities.
The USFWS requested six objectives to help meet our goal. Three of the PSP objectives are similar to our
requests {1) Synthesize 1980s data, 2) Study sites, and 6) Seed dispersal}, but they lack the additional specifics
stated in our requested objectives. Two of the PSP objectives appear to be wholly or at least partially the
objectives for other PSPs and not appropriate as stated {3) Map riparian vegetation, and 10) Impacts to shallow
groundwater well users}. What the PSP objectives lack, however, are our specific requests for river ice,
sediment deposition, and water-level regime (USFWS Objectives 4, 5, and 6). These missing objectives may be
studied under AEA’s PSP objectives, but the USFWS prefers they be considered as standalone objectives, and
possibly integrated into a single modeling objective after they have been studied individually. The USFWS is
particularly interested in our Objective 6 to characterize the water-level regime required to maintain floodplain
and riparian plant communities. Much of the discussion so far has focused on floodplain plant succession, but
little or no discussion so far has involved maintenance flows. Succession is important, but without maintenance
flows whole floodplain plant communities may collapse or the direction of succession changed to an unnatural
target (e.g., non-floodplain plant communities).
Study Area: The USFWS agrees with the PSP study area and four river segments, with the following additional
comments. The width of the active valley should also include the distance from the River that the River
influences groundwater, as well as define the return interval for both groundwater and flooding (e.g., 100-year
event under current or climate-change induced conditions). Much discussion has centered on the downstream
EMAIL RECORD
Record of Email Page 2 of 4
influence of the Project. The PSP study area Lower Reach would extend to RM 0. Will this lower extent remain
even if all agree that the Project influence on surface- and ground-water becomes indistinguishable from normal
environmental variation?
Study Methods: The methods need to follow the order of the objectives and use section headings that refer to
the intent of the objectives. Few methods are referenced, and some references that are cited are not included
in the literature cited. The relationship with other PSPs often seems confusing. It would be more helpful to state
what results will be required from PSP "x" to evaluate a Riparian ISF objective, and potentially what results from
a Riparian ISF objective will be required by PSP "y." It is not necessary to repeat coordination for every
objective, only state the inputs required and the outputs provided by an objective. This applies across PSPs
and among a PSP's objectives. The following comments on methods follow the order of the Objectives
requested by the USFWS:
RIFS-1 Synthesize Historical Data: In addition to other North American hydro-projects, this review should also
include a review of relatively undisturbed riverine systems.
RIFS-2 Select and Design Study Sites: The number of study sites should provide sufficient replication to
address the needs of the objectives, and should include sites where Project operation is expected to cause early
channel bed degradation or aggradation. The casual reference to pseudoreplication in one of the other
objectives needs to be addressed at the study-site level. Study sites are typically the experimental unit where
replication is used for true statistical analysis. All other sampling (e.g., within the study site) is really
subsampling used to obtain a better average value for that one replicate. As envisioned by many of the PSPs,
the "representative" study sites are really only one replicate for each process-domain. For more on
pseudoreplication see:
Hurlbert, Stuart H. 1984. Pseudoreplication and the Design of Ecological Field Experiments. Ecological
Monographs 54:187–211. http://dx.doi.org/10.2307/1942661
RISF-3 Characterize Seed Dispersal and Frequency of Establishment: Not sure where this objective is
addressed in the PSP. It appears to be scattered across several sections in the methods. If the methods have
been described by other similar projects, then cite their methods if appropriate and include enough details to
help others understand the methods that will be used. How will the Susitna River bimodal peak flows be
addressed? On a float trip down the Susitna 27-29 July 2012, there were newly emerging dicot seedlings on the
sandbars. How will the fate of these "second peak" seedlings be addressed? How will the role of precipitation
in maintaining favorable soil moisture conditions be evaluated? Will soil texture be considered? If so, how will
the soil profile be described?
In Section 6.6.4.3.1.4: Is "abundance" density or some other metric? What is "elevation" referenced to: ASL,
an arbitrary datum, or some elevation that can be linked to the local river or groundwater stage (keep in mind
the river drops downstream, so that must be accounted for also)? Is there a citation for others using 2-meter
square plots? What is the shape of these plots? A square plot may not be appropriate for a narrow band of
seedlings along a specific elevation in the gradient above the river. MODFLOW is a groundwater model, and
many not be sensitive enough to quantify hydroperiod relationships for seedlings. What other metrics will be
used to quantify/separate surface water, groundwater, soil moisture, precipitation, and other potential
hydrological process that support seedling establishment and recruitment?
How will the results from this objective be used to predict potential Project-related changes in seedling
establishment and recruitment into the population?
RISF-4 Characterize the Role of Ice in the Establishment, Survival and Recruitment of Riparian Species: The
discussion on ice processes (Section 6.6.4.4.1) seems unfocused, and essentially provides no discernible
methods: "Final details of the geomorphology and ice processes modeling ... will be developed as the 2012
studies are obtained." The goal of this study should be to characterize the role of river ice in the establishment
(colonization), survival (first 3 years) and recruitment into the future reproductive population of dominant riparia n
species (e.g., balsam poplar, willows). Have others investigated the role of ice on riparian plant communities?
EMAIL RECORD
Record of Email Page 3 of 4
If so, can their methods be used here? How will the magnitude, frequency, and longitudinal distribution of ice
events affecting dominant riparian species/communities be evaluated?
RISF-5 Characterize the Role of Sediment Deposition in the Formation of Soils: The proposed soil sampling
techniques are included in Section 6.6.4.3.1.5, but based on these techniques it is unclear how the USFWS
requested objective to characterize the role of sediment deposition in the formation of floodplain and riparian
soils, and how sediment deposition affects the rate and trajectory of plant community succession. This objective
should investigate the rate of deposition, depth of sediment, and soil profile development required for natural
floodplain plant community succession, and then use the predicted sediment deposition characteristic from the
Fluvial Geomorphology Study to predict the effects of Project operation on floodplain plant communities.
Sampling to only a depth of 50 cm, and describing cumulative thickness of all organic horizons and loess
(windblown material?) without stratigraphy will likely be insufficient to meet this objective. Soil texture by feel
should follow standard techniques (e.g., Thien 1979, http://soils.usda.gov/education/resources/lessons/texture/).
RISF-6 Characterize Water-Level Regime Required to Maintain Floodplain and Riparian Plant Communities:
This is a critical objective that has not been sufficiently discussed in past workgroup meetings, possibly due to
lack of time, and the PSP methods are insufficient to evaluate if the USFWS requested objective will be met.
Suggest this objective be discussed near the beginning of future meetings to allow sufficient time for
discussion.
Objective 6 combines hydrologic information from the groundwater study (PSP 5.7) and the plant community
information from this study (PSP 6.6) and possibly the habitat mapping studies (PSPs 9.6 and 9.7) to produce
plant species/community response curves. The USFWS's Objectives RISF-3 to RISF-5 target critical stages in
plant community succession, while RISF-6 targets critical instream flows required for maintaining plant
communities as succession progresses (i.e., both succession and maintenance are important).
The methods for groundwater belong in the Groundwater PSP, and not in this PSP for reasons discussed
above. This PSP should request the required hydrologic information from PSP 5.7 and begin the discussion
from that point. The following comments, however, include the pertinent groundwater methods that should be
discussed in PSP 5.7.
Section 6.6.4.5 (Groundwater): The suggested four to six intensive study reaches instrumented with
groundwater and surface-water recording instruments may be insufficient to address this objective if plant
response will be described by process-domains (see pseudoreplication discussion above). However, hydrology
is likely the most dominant physical factor required for maintaining floodplain plant communities across the
various process-domains, and baring some other dominant physical factor (e.g., soil parent material, weather,
etc.) it may be possible to use data from the individual intensive study-site transects to build response curves
(see Henszey et al. 2004 {ne.water.usgs.gov/platte/reports/wetlands_24-3.pdf}, Figure 7 for an indication of the
number of data points required to build a response curve).
One-and-a-half growing seasons (July 2013 to September 2014) will likely provide insufficient groundwater
hydrology data to fit individual species response curves (especially for annual species), and may not be enough
data to reasonably predict groundwater relationships with river stage and to verify the model predictions with
independent data. Precipitation may also dramatically affect transient but critical groundwater levels (a few days
to a week or more of elevated water levels), which would be difficult to evaluate with limited data. How will
these potential problems be addressed?
What are the "project accuracy standards used for water-level measurements" for horizontal, vertical and
temporal measurements?
In addition to the Work Products described in Section 6.6.4.5.2, the products should provide water-level
summary statistics for each location (e.g., point, plot, or transect) that will be used to test and fit plant response
curves, such as growing season cumulative frequency, 7-day moving average, 10-day moving average, 14-day
moving average, and arithmetic mean (see Henszey et al. 2004 {ne.water.usgs.gov/platte/reports/wetlands_24-
3.pdf}, Table 1).
EMAIL RECORD
Record of Email Page 4 of 4
Section 6.6.4.7 (Succession Models and Flow Response Guilds) appears to potentially address the USFWS's
Objective 6 request; however, two critical referenced papers (Merritt et al. 2010 and Pearlstine et al. 1985) were
not included in the Literature Cited. These references were not provided until 8/28/2012, and the USFWS has
had insufficient time to review these papers in detail. The concept of the PSP response guilds is similar to the
USFWS's request to develop plant community response curves, but the PSP methods are insufficient to
evaluate if our requested Objective 6 will be met. The USFWS requested evaluating specific water-level
summary statistics (see above discussion for groundwater) with a rigorous curve-fitting technique similar to
Henszey et al. (2004). The methods should provide sufficient detail to show how quantifiable (not qualitative)
hydrologic (surface-water and groundwater) gradients will be constructed to show the optimum and range of
favorable water levels required for maintaining floodplain species/communities.
____________________________________
Robert J. Henszey, Ph.D.
Fish & Wildlife Biologist
Conservation Planning Assistance
US Fish & Wildlife Service
101 12th Avenue, Room 110
Fairbanks, AK 99701
Phone: 907-456-0323, Fax: 907-456-0208
Bob_Henszey@fws.gov
EMAIL RECORD
Record of Email Page 1 of 2
From: Eric Rothwell [mailto:eric.rothwell@noaa.gov]
Sent: Wednesday, September 12, 2012 5:37 PM
To: dreiser@r2usa.com
Cc: PHilgert@r2usa.com; Laura Arendall; Betsy McGregor; susan walker; Berg, Catherine; Betsy McCracken
(FWS); Michael_Buntjer@fws.gov
Subject: Re: Meeting on the 12th
Dudley,
Thank you for coming over and meeting today. Also, thank you for providing the meeting presentation before
hand, having it to review helped facilitate the discussion. The aerial imagery with the proposed study reaches
was also helpful in our conversation, when they are available I would like a copy.
I typed up some of my comments from today, starting with general comments, twg meeting protocol comments,
and then specific comments on the site selection process. I cc'd other agency personnel that will likely attend
the meeting Friday, hoping that it will provide some useful discussion points and I look forward to continuing the
discussion September 26-28th. Betsy, Sue, etc. the attached presentation that Dudley provided is draft and
parts will likely change prior to Friday's meeting.
General comments about all of the PSPs:
What can be determined from each of the study components, a description of deliverables (not results)
this will help us understand if our requests have been met.
How will uncertainty be determined for each of the study components? (ice processes -> hydraulic flow
routing -> winter fish and habitat effects)
How will incomplete study components, data, or results be dealt with - situations where an extension of
the study period is necessary.
General comments about TWG meetings, as Friday will start to define what TWG will look like:
An agenda should be provided with enough time to review and submit changes
All meeting materials provided with enough time for review prior to the meeting, including presentations
Relevant background material that will aid the discussion will be provided
Meeting summary and minutes within two weeks of the meeting, distributed to all attendees as a draft.
Then a two week period to submit additions and/or corrections
And - attendees (agency personnel included) will be prepared by reviewing all the materials prior to
meeting.
Comments specific to the study site selection process
The proposed methods for site selection are first to select sites in a hierarchical framework (segment by
hydrology, then geomorphology, then habitat units). Sites selected will include all the riverine habitat types that
are defined (relevant to that reach, for example MR2 may not have any upland sloughs).
The site selection will be informed by selecting sites that are 'critical', meaning that they are likely to be highly
affected/sensitive to flow changes and highly important biologically. Generally I agree with prioritizing sites that
will by hydraulically affected and are biologically important, but we have incomplete biologic information The
data from the 1980s provides some useful information about utilization of off-channel habitats that should inform
our studies but the information is limited in that it does not fully capture mainstem utilization or overwintering.
So, with new fish utilization and distribution information site selection should include some flexibility to include
sites where life histories are not assessed under the currently proposed sites. This seems to be suggested in
EMAIL RECORD
Record of Email Page 2 of 2
the site selection process schedule if it includes fish distribution/habitat utilization information, November 2013
evaluate summer 2013 data and modify/add sites as needed in collaboration with TWG
The schedule provided includes refinement of selected sites by the use of mapping results to evaluate habitat
variability, conduct statistical power analysis, refine intensive sites and identify supplementary sites. If possible
an addendum to the PSP or definitely in the RSP a description of the initial site selection (by the hierarchical
framework) and refinement (by habitat mapping results and fish studies) methods should be presented, not just
the selected sites. This depends on the fish studies being sufficient to describe the full distribution of fish and
their habitat use.
Incorporation of multiple study elements, such as ice processes, groundwater, geomorphology, and water
quality. This is especially important in habitats where one of the other study elements is driving habitat use by
fish, for example if upwelling and water temperature is a determining factor for site selecting for Chinook to
overwinter then the study site should include this habitat and integrate the WQ and GW studies to understand
distribution of thermal refugia for overwintering and how the project would affect those
processes/characteristics.
The slides presenting the 1980s electrofishing and sampling was informative, but again shows an incomplete
understanding of habitat utilization. The 1980s sampling focused on the off-channel habitats (side
sloughs/channel, upland sloughs, and confluences with tributaries). This information should be used to inform
selections but must also be put into context that we really don't know very much about mainstem utilization and
overwintering, and so need to be flexible (potential with extended study years) when a better understanding is
gained through the 2013 and 2014 fish studies.
The slides on each of the species, I had a general comment that they should be put into perspective. That the
1980s data does not represent a complete understanding so comments like no mainstem spawning should be
qualified. There likely is a riverine component to sockeye (and other species) that do spawn in the river but that
just wasn't captured in the 1980s due to the methodologies available. We do not currently know the full
spawning distribution.
Representative reaches, extrapolation of results, and replication. We touched on this and I look forward to
talking about this more. I did not review Aaserude et al. 1985 prior to our meeting but plan on reading it prior to
the Sept. 26-28 meetings.
Although not discussed, I have a concern with winter flow routing and ice processes, and how they will inform
site selection. Site selection for analyzing winter instream flow effects to fish and their habitat will depend on an
understanding of operational effects downstream (to flow timing and quantity, hydraulics, and water quality).
Also the extension of the studies downstream will depend on these results. The winter hydraulic flow routing
model will rely on ice process modeling to determine the downstream extent and magnitude of operational flow
effects. The ice process modeling will need several years of data, in addition to the ice thickness
measurements and discharge measurements at each of the cross-sections for the winter routing model. I see a
lack of time to collect data for the models (winter flow routing and ice process) calibrate the models and then
selection sites and methods to conduct ISF studies to assess project effects on fish during winter operations
under the currently proposed study period.
This was a very targeted meeting to discuss site selection, I look forward to discussing this and other parts of
the ISF and other study plans in the near future. After Friday's meeting I hope to see the selection methods
written up with consideration of the agency comments (including the proposed methods for extrapolation), this
should help us continue the discussion.
Best Regards,
Eric
EMAIL RECORD
Record of Email Page 1 of 1
From: Klein, Joseph P (DFG) [mailto:joe.klein@alaska.gov]
Sent: Tuesday, September 18, 2012 10:18 AM
To: dreiser@r2usa.com
Cc: Benkert, Ronald C (DFG); 'Mike Buntjer'; Betsy_McCracken@fws.gov; eric Rothwell; 'Michael R. Lilly, GW
Scientific'; 'Kevin Fetherston'; PHilgert@r2usa.com; 'MaryLou Keefe'; matt.cutlip@ferc.gov;
Catherine_Berg@fws.gov; Haught, Stormy B (DFG); Bob Henszey Ph. D. (Bob_Henszey@fws.gov); Betsy
McGregor
Subject: Follow up notes on Sept 14 Meeting
Dudley & Company-
I found the Instream Flow Technical Working Group meeting last Friday very helpful. I am concerned, however,
that at the pace we are going we are going to run out of time before we have the opportunity to thoroughly
discuss key elements (e.g. target species, HSC development, methods per habitat types, transect selection
criteria and number, desired outputs). I am grateful for the time extension granted by FERC and encourage you
and your staff to take advantage of this opportunity to put forth a concerted effort to hold more meetings (either
in person or via teleconference) and address the study topics mentioned.
Site selection is a key component and a good starting point. The upcoming field visit at the end of the month will
greatly enhance these discussions and understandings and perhaps during this time some of the topics
mentioned can also be discussed.
Following are comments on the meeting last Friday:
Please include a definition list for each study plan of key terms. We are not overly concerned about
consistency between groups since different specialties often have their own terminology, however a
list would help understand these differences/similarities.
After reading my notes, details about the sampling approaches discussed are not clear to me. For
example, how many intensive sites are planned? I believe the fish studies mentioned the previous day
that they were looking at 8-10 sites – would these be the same? For both instream flow and riparian
studies? What is the sampling approach for other habitats in addition to identified critical sites?
We support and agree with the approach proposed for using 2-D modeling for sampling the intensive
sites.
Likewise, we support and agree with the approach proposed for assessing surface water/ground water
interactions.
Regards,
Joe Klein, P.E.
Supervisor Aquatic Resources Unit
Alaska Department of Fish and Game
333 Raspberry Rd
Anchorage, AK 99518
(907) 267-2148
joe.klein@alaska.gov
EMAIL RECORD
Record of Email Page 1 of 2
From: Dudley Reiser [mailto:dreiser@r2usa.com]
Sent: Tuesday, September 18, 2012 4:32 PM
To: 'Klein, Joseph P (DFG)'
Cc: 'Benkert, Ronald C (DFG)'; 'Mike Buntjer'; Betsy_McCracken@fws.gov; 'eric Rothwell'; 'Michael R. Lilly, GW
Scientific'; 'Kevin Fetherston'; PHilgert@r2usa.com; 'MaryLou Keefe'; matt.cutlip@ferc.gov;
Catherine_Berg@fws.gov; 'Haught, Stormy B (DFG)'; 'Bob Henszey Ph. D.'; 'McGregor, Elizabeth A (AIDEA)';
'Laura Arendall'; 'Fullerton, Bill'
Subject: RE: Follow up notes on Sept 14 Meeting
Hi Joe – thanks for the positive feedback on the September 14th meeting and for your comments and
suggestions related to certain key study elements. They are most helpful. I want you to know that although we
share your concern about scheduling, we are confident that within the next few months we will be able to
address, or at least discuss and agree on the process, criteria, and schedule for addressing the majority of the
key instream flow related issues including those you mentioned below. As you have suggested, we are
planning on introducing and discussing several of the elements (target species and HSC development) during
the upcoming TWG meeting on September 26th, but I am sure there will be a need for additional meetings
before those and other elements are fully discussed. In fact, one of the topics we want to discuss during the
September 26th meeting is the future scheduling of other TWG meetings (some to occur via teleconference) so
that everyone is aware of when these will occur.
As for your specific comments, I have provided my preliminary responses to those at the end of each comment.
Thanks again for your comments and we will plan on seeing you next week.
Best regards,
Dudley
Dudley W. Reiser, Ph.D.
Senior Fish Scientist
R2 Resource Consultants
Phone - 425-556-1288
Fax - 425-556-1290
Cell - 425-681-6048
From: Klein, Joseph P (DFG) [mailto:joe.klein@alaska.gov]
Sent: Tuesday, September 18, 2012 11:18 AM
To: dreiser@r2usa.com
Cc: Benkert, Ronald C (DFG); 'Mike Buntjer'; Betsy_McCracken@fws.gov; eric Rothwell; 'Michael R. Lilly, GW
Scientific'; 'Kevin Fetherston'; PHilgert@r2usa.com; 'MaryLou Keefe'; matt.cutlip@ferc.gov;
Catherine_Berg@fws.gov; Haught, Stormy B (DFG); Bob Henszey Ph. D. (Bob_Henszey@fws.gov); McGregor,
Elizabeth A (AIDEA)
Subject: Follow up notes on Sept 14 Meeting
Dudley & Company-
EMAIL RECORD
Record of Email Page 2 of 2
I found the Instream Flow Technical Working Group meeting last Friday very helpful. I am concerned, however,
that at the pace we are going we are going to run out of time before we have the opportunity to thoroughly
discuss key elements (e.g. target species, HSC development, methods per habitat types, transect selection
criteria and number, desired outputs). I am grateful for the time extension granted by FERC and encourage you
and your staff to take advantage of this opportunity to put forth a concerted effort to hold more meetings (either
in person or via teleconference) and address the study topics mentioned.
Site selection is a key component and a good starting point. The upcoming field visit at the end of the month will
greatly enhance these discussions and understandings and perhaps during this time some of the topics
mentioned can also be discussed.
Following are comments on the meeting last Friday: My responses immediately follow .
Please include a definition list for each study plan of key terms. We are not overly concerned about
consistency between groups since different specialties often have their own terminology, however a
list would help understand these differences/similarities. Good suggestion and this will be provided
in each RSP.
After reading my notes, details about the sampling approaches discussed are not clear to me. For
example, how many intensive sites are planned? I believe the fish studies mentioned the previous day
that they were looking at 8-10 sites – would these be the same? For both instream flow and riparian
studies? What is the sampling approach for other habitats in addition to identified critical sites? We
will review the site selection process at the beginning of the September 26th meeting.
We support and agree with the approach proposed for using 2-D modeling for sampling the intensive
sites. 2-D modeling will be more thoroughly discussed during the September 26th meeting along
with other methods and models. We subsequently envision having a more focused discussion on
model selection during the TWG meetings scheduled for the week of October 22. While we consider
2-D modeling to be one of several models that may be used, it will not be the only method/model
we apply to the Focused Areas.
Likewise, we support and agree with the approach proposed for assessing surface water/ground
water interactions. I am sure there will be some refinements to that approach based on the
questions needing to be addressed at the different sites and as well, logistical considerations.
Regards,
Joe Klein, P.E.
Supervisor Aquatic Resources Unit
Alaska Department of Fish and Game
333 Raspberry Rd
Anchorage, AK 99518
(907) 267-2148
joe.klein@alaska.gov
APPENDIX 4
INFORMAL CONSULTATION DOCUMENTATION
SECTION 9 – FISH AND AQUATIC RESOURCES
EMAIL RECORD
Record of Email Page 1 of 3
From: Klein, Joseph P (DFG) [mailto:joe.klein@alaska.gov]
Sent: Thursday, August 23, 2012 2:48 PM
To: Betsy McGregor
Cc: Benkert, Ronald C (DFG); Burch, Mark E (DFG); Erickson, Jack W (DFG); Fair, Lowell F (DFG); Fink, Mark J
(DFG); Giefer, Joe (DFG); Haught, Stormy B (DFG); Holen, Davin L (DFG); King, Kimberly N (DFG); Miller,
Monte D (DFG); Michael_Buntjer@fws.gov; Betsy_McCracken@fws.gov; eric Rothwell; Hill, Melissa E (DNR);
Schwarz, Terence C (DNR); Sager, Kimberly R (DNR); Ashton, William S (DEC)
Subject: RE: Follow up Meeting Notes-additional comments
Following are additional comments
Baseline Water Quality
5.5.4.3.2 In-Situ Water Quality Sampling The sampling protocol currently calls for monthly in-situ water
quality monitoring for the 4 summer months. It should be revised to include continuous (hourly or so) water
quality measurements for basic parameters (pH, DO, conductivity, turbidity), year-round if possible using in-situ
semi-permanent sensors (e.g. sondes). The technology is readily available and would provide very useful
baseline information to assess any post project impacts.
River Productivity
7.8.4.4 Conduct a literature/data search to identify existing river systems that could act as surrogates in
evaluating future changes to productivity in the Susitna River. We recommend supplementing or
substituting this section using a reference reach in a similar Alaska river using a BACI design monitoring
program in order to assess post project impacts.
From: Klein, Joseph P (DFG)
Sent: Thursday, August 23, 2012 10:42 AM
To: McGregor, Elizabeth A (AIDEA)
Cc: Benkert, Ronald C (DFG); Burch, Mark E (DFG); Erickson, Jack W (DFG); Fair, Lowell F (DFG); Fink, Mark J
(DFG); Giefer, Joe (DFG); Haught, Stormy B (DFG); Holen, Davin L (DFG); King, Kimberly N (DFG); Miller,
Monte D (DFG); Michael_Buntjer@fws.gov; Betsy_McCracken@fws.gov; Eric Rothwell
(Eric.Rothwell@noaa.gov); Hill, Melissa E (DNR); Schwarz, Terence C (DNR); Sager, Kimberly R (DNR); Ashton,
William S (DEC)
Subject: Follow up Meeting Notes
Betsy-
Thank you for the opportunity to discuss the proposed study plans for the Susitna-Watana Hydroelectric project.
We look to further discussions to continue to clarify study plan details.
To assist in you and your consultants in this process, below are brief notes by ADF&G staff. We may have
additional comments/or clarifications. Please feel free to contact me if you have any questions.
Regards, Joe
Fish Distribution and abundance in Upper, Middle and Lower Susitna River
Trot lines should considered during the winter to target appropriate fish species.
Minnow trapping under ice should be used during the winter, in all habitat types.
Should evaluate the feasibility of under ice videography.
EMAIL RECORD
Record of Email Page 2 of 3
Salmon Escapement
Identify locations of adult fish weir locations described on tributary streams (7.7.4.1.5, page 7-39).
Consider placement of adult fish weir upstream of the proposed dam on prominent Chinook salmon
streams.
Instream Flow
What is the sampling strategy (e.g. representative reach, mesohabitat typing) for the defined habitat
types?
How many and at what range will discharge-calibration sets be collected for each sampling method?
Will 2D modeling include side channels and sloughs within study area?
o Based on comments at the meeting it was my understanding it would.
What criteria will be used to identify cover types and substrate sizes?
For PHABSIM, will transects be independent, dependent or a combination and accordingly, what WSE
models and composite suitability index will be used?
What criteria will be used to select and weight transect-derived models?
Per the description of study sites for fish passage/off-channel connectivity (§6.5.4.5.5), what criteria
will be used to identify "a representative number" of different habitat types?
HSI data is needed for identified target species for each defined habitat type, over 2 years.
How will the data be aggregated to evaluate single flow recommendation?
Will a DSS-type program be available to review study results and if so, information is needed on it.
How do you envision the "collaborative process" will work? When will major decisions be made (e.g.
site and transect selections) and how often do you envision the work group will get together?
What equipment will be used and how will they be calibrated?
For the eulachon and boating studies, similar information is needed on what is the study area, what
sampling strategy will be used, how many and what range of calibration-discharge sets if appropriate,
and how will HSI curves will be developed?
Varial zone modeling, may need more defined time steps during analysis phase (possibly down to 15-
minute increments) depending on the rate of flow change over time.
Groundwater
What are the monitoring well placement sampling approach (e.g. equal spacing along linear transects,
etc.) and location (e.g. for instream flow, in all habitat types?) for the various resource studies (i.e.
instream flow, riparian instream flow, water quality). Also, a description of sampling intensity would
be helpful (i.e. for instream flow purposes, will the objective be to characterize entire gw/sw
interaction throughout entire intensive study site or only at select microhabitats).
What is the duration for monitoring (I believe at the meeting it would be from installation until winter
2013-14?)
How often will monitoring wells be calibrated for various parameters to be sampled pre- post- and
during field monitoring?
For each resource discipline, what parameters will be sampled and what are range of accuracies (e.g.
for water level +/- 0.1 ft?, water temp +/- 0.2 C?, etc.).
Water Quality
EMAIL RECORD
Record of Email Page 3 of 3
Information on availability of the Sampling and Analysis Plan and Quality Assurance Project Plan is
needed.
GW Quality in Selected Habitats (Section 5.5.4.7) - need more information on study. For example,
sampling intensity/number of site measurements per slough or criteria for how they will be
determined. Will ground water level monitors be installed if so, what is the sampling intensity
(numbers per habitat type) and duration of monitoring (e.g. continuous year-round/ point samples
during field visits, etc.). If not, it is strongly recommended groundwater monitoring be performed
concurrently with water quality monitoring in this study.
Any monitors should be calibrated pre- and post-monitoring along with multiple field measurements
for post monitoring calibration.
Department of
Fish and Game
DIVISION OF SPORT FISH
Research and Technical Services
333 Raspberry Road
Anchorage, Alaska 99518-1599
Main: 907.267.2148
Fax: 907.267.2422
August 31, 2012
Wayne Dyok, Project Manager
Alaska Energy Authority
Susitna-Watana Hydroelectric Project
813 W. Northern Lights Blvd
Anchorage, AK 99503
Subject: Comments on the Watana Transportation Access Analysis Draft Report
for the Susitna-Watana Hydroelectric Project, FERC No. 14241
Dear Mr. Dyok:
Alaska Department of Fish and Game (ADF&G) has reviewed the “Watana Transportation Access
Analysis” draft report prepared by the Alaska Department of Transportation and Public Facilities
for the Susitna-Watana Hydroelectric Project (FERC No. 14241). We offer the following
comments from the Divisions of Habitat, Wildlife Conservation, and Subsistence per the Alaska
Energy Authority’s request for comments.
I. DIVISION OF HABITAT
Access Alternatives
The North Route (Seattle Creek) is ADF&G Division of Habitat’s preferred alternative. The North
Route would minimize impacts to anadromous systems resulting from construction of transportation
infrastructure. West and South Routes would each necessitate several anadromous stream
crossings.
Stream Crossings
Fish presence and distribution information is scarce for at least some portion of each proposed
access corridor, particularly in regards to resident species. Fish surveys at proposed crossing
locations should be conducted. Surveys should consist of electrofishing a distance equal to 40
wetted stream widths in the vicinity of the crossing, with a minimum survey length of 50 meters. If
initial surveys do not detect fish presence at specific crossings, at least one additional fish survey
should be conducted during a different season to verify that the stream is non-fish bearing. Fish
Wayne Dyok, Project Manager August 31, 2012
Susitna-Watana Hydroelectric Project
2
Habitat Permits will be required from ADF&G Division of Habitat for all stream crossings and Fish
Resource Permits will be required from ADF&G Division of Sport Fish for all fish surveys.
ADF&G Division of Habitat will make the final determination regarding fish presence if surveys
fail to detect fish.
Bridges and culverts utilizing the Streambed Simulation Design Method (NMFS 2011) are
recommended for stream crossings. Culverts width should be at least 1.2 times the bankfull channel
width of the stream, should have a slope that approximates the average slope of the adjacent stream
from approximately ten channel widths upstream and downstream, and should not exceed 6% slope
where closed bottom culverts are used. Culverts should be embedded not less than 30% and not
more than 50% of culvert height, and fill material should be of similar size composition as adjacent
natural streambed material.
NMFS (National Marine Fisheries Service). 2011. Anadromous Salmonid Passage Facility Design.
Chapter 7: Culverts and other road crossings. NMFS, Northwest Region, Portland, Oregon.
Improvements to Existing Infrastructure
If a northern route is chosen, replacement or improvement of existing stream crossings along the
Denali Highway will be a necessary component of upgrading the highway to accommodate project
traffic. A comprehensive survey of Denali Highway stream crossings will be required. Culverts
found to be undersized, perched, damaged or otherwise inadequate for fish passage should be
repaired or replaced with bridges or culverts designed for fish passage. The Access Study indicates
six replacement culverts along the Denali Highway (Table 5-1, page 96). ADF&G Fish Passage
Inventory records indicate at least 12 Denali Highway stream crossings between Cantwell and
Seattle creek which are currently in conditions unsuitable for fish passage (Table 1).
Table 1.–Denali Highway stream crossings between Cantwell and Seattle Creek unsuitable for fish
passage.
Stream Lat Long
Unnamed stream 63.38771 -148.88483
Jack River 63.38032 -148.86179
Fish Creek tributary 63.37249 -148.82681
Unnamed pond connection 63.37203 -148.82124
Unnamed Nenana River tributary 63.39041 -148.60771
Unnamed Nenana River tributary 63.38967 -148.56854
Edmonds Creek 63.39304 -148.52495
Unnamed Nenana River tributary 63.38359 -148.43508
Unnamed Nenana River tributary 63.38046 -148.40971
Unnamed Nenana River tributary 63.3744 -148.37766
West Fork Lily Creek 63.33508 -148.2782
East Fork Lily Creek 63.33375 -148.27148
Wayne Dyok, Project Manager August 31, 2012
Susitna-Watana Hydroelectric Project
3
II. DIVISION OF WILDLIFE AND CONSERVATION
The Seattle Creek (North) alternative may have a greater effect on moose, caribou, and ptarmigan
(willow, rock and potentially white-tailed) due to increases in hunter access. Increasing access will
likely result in increased harvest pressure in Game Management Unit (GMU) 13E. While new
access routes may help disperse hunters, conflict among hunters accessing new areas may occur
initially. Portions of the area are currently accessible by all-terrain vehicles (ATV) coming off the
Denali Highway, but the new road would mean additional highway vehicle access and would also
provide new starting points for ATV’s. Increases in harvest can be managed through the Board of
Game regulatory process by changing seasons, bag limits, methods and means. Social issues due to
competition for hunting areas and/or access routes can also be managed to some extent, but
solutions can be more elusive and often demand more creative approaches.
Current and planned telemetry studies are expected to inform the assessment of the effects on
moose, caribou and ptarmigan. Based on existing information, the Seattle Creek (North) alternative
may result in increased vehicular collisions when caribou move through the area seasonally. The
full extent to which caribou and moose utilize each of the proposed access routes will remain
speculative until ongoing research has been completed. The willow ptarmigan study is inquiring
into the extent to which the area between the impoundment and Denali Highway serves as refugia
for the greater GMU 13 ptarmigan population. To the extent that ptarmigan have been moving from
the affected area to resupply adjacent currently accessible hunting areas, loss of that area as refugia
could stress the ptarmigan population throughout the unit.
With any new access road into GMU 13E, additional trapping pressure could result which could
lead to increased harvests of certain furbearers. Again, should conservation concerns arise, harvest
can be managed through the Board of Game regulatory process.
III. DIVISION OF SUBSISTENCE
The three alternatives allow for differing levels of access. The two southern routes, the Gold Creek
and Chulitna Route, would provide road access to open up areas for a diversity of harvesting
opportunities for residents of Southcentral Alaska where a majority of the State’s population
resides. These areas are already used extensively by ATV and airplane traffic from the Talkeetna-
Willow area. No comprehensive harvest mapping efforts are available for this area currently;
however, this will be addressed through the subsistence harvest surveys planned for the
communities of Talkeetna and Trapper Creek.
The northern route, the Denali Corridor (Seattle Creek), would increase accessibility for all
harvesting activities, but especially for hunting caribou, to rural residents of Cantwell and the
Copper River Basin. Based on past mapping and ethnographic research, residents of these
communities have traditionally utilized this area for the harvest of caribou (Nelchina Herd) and
Wayne Dyok, Project Manager August 31, 2012
Susitna-Watana Hydroelectric Project
4
freshwater fish. Although a road may be beneficial to local residents, it could also increase
competition as better road access, and the upgrade of the Denali Highway, would enable easier
access for residents of the road system, both north and south of the area. As noted in the comments
above opening up the northern area would demand more creative approaches to managing social
issues.
Sincerely,
Joe Klein, Susitna-Watana FERC Coordinator
Alaska Department of Fish and Game
Cc: Doug Vincent-Lang, ADF&G
Bob Clark, ADF&G
Stormy Haught, ADF&G
Mark Burch, ADF&G
Davin Holen, ADF&G
Maria Steele, ADNR
Betsy McGregor, AEA
EMAIL RECORD
Record of Email Page 1 of 3
From: Klein, Joseph P (DFG) [mailto:joe.klein@alaska.gov]
Sent: Thursday, September 06, 2012 1:58 PM
To: Betsy McGregor
Subject: RE: Follow up Meeting Notes-additional comments
Betsy- Per a follow up to our River Productivity comment below, we wish to revise our statement to read:
We support the effort to provide a means to evaluate future changes in the Susitna River under different
operation scenarios and also recommend identifying a reference reach in a similar Alaska river for using a BACI
design monitoring program to assess post project impacts.
Regards, Joe
From: Klein, Joseph P (DFG)
Sent: Thursday, August 23, 2012 2:48 PM
To: McGregor, Elizabeth A (AIDEA)
Cc: Benkert, Ronald C (DFG); Burch, Mark E (DFG); Erickson, Jack W (DFG); Fair, Lowell F (DFG); Fink, Mark J
(DFG); Giefer, Joe (DFG); Haught, Stormy B (DFG); Holen, Davin L (DFG); King, Kimberly N (DFG); Miller,
Monte D (DFG); Michael_Buntjer@fws.gov; Betsy_McCracken@fws.gov; Eric Rothwell
(Eric.Rothwell@noaa.gov); Hill, Melissa E (DNR); Schwarz, Terence C (DNR); Sager, Kimberly R (DNR); Ashton,
William S (DEC)
Subject: RE: Follow up Meeting Notes-additional comments
Following are additional comments
Baseline Water Quality
5.5.4.3.2 In-Situ Water Quality Sampling The sampling protocol currently calls for monthly in-situ water
quality monitoring for the 4 summer months. It should be revised to include continuous (hourly or so) water
quality measurements for basic parameters (pH, DO, conductivity, turbidity), year-round if possible using in-situ
semi-permanent sensors (e.g. sondes). The technology is readily available and would provide very useful
baseline information to assess any post project impacts.
River Productivity
7.8.4.4 Conduct a literature/data search to identify existing river systems that could act as surrogates in
evaluating future changes to productivity in the Susitna River. We recommend supplementing or
substituting this section using a reference reach in a similar Alaska river using a BACI design monitoring
program in order to assess post project impacts.
From: Klein, Joseph P (DFG)
Sent: Thursday, August 23, 2012 10:42 AM
To: McGregor, Elizabeth A (AIDEA)
Cc: Benkert, Ronald C (DFG); Burch, Mark E (DFG); Erickson, Jack W (DFG); Fair, Lowell F (DFG); Fink, Mark J
(DFG); Giefer, Joe (DFG); Haught, Stormy B (DFG); Holen, Davin L (DFG); King, Kimberly N (DFG); Miller,
Monte D (DFG); Michael_Buntjer@fws.gov; Betsy_McCracken@fws.gov; Eric Rothwell
(Eric.Rothwell@noaa.gov); Hill, Melissa E (DNR); Schwarz, Terence C (DNR); Sager, Kimberly R (DNR); Ashton,
William S (DEC)
Subject: Follow up Meeting Notes
Betsy-
Thank you for the opportunity to discuss the proposed study plans for the Susitna-Watana Hydroelectric project.
We look to further discussions to continue to clarify study plan details.
EMAIL RECORD
Record of Email Page 2 of 3
To assist in you and your consultants in this process, below are brief notes by ADF&G staff. We may have
additional comments/or clarifications. Please feel free to contact me if you have any questions.
Regards, Joe
Fish Distribution and abundance in Upper, Middle and Lower Susitna River
Trot lines should considered during the winter to target appropriate fish species.
Minnow trapping under ice should be used during the winter, in all habitat types.
Should evaluate the feasibility of under ice videography.
Salmon Escapement
Identify locations of adult fish weir locations described on tributary streams (7.7.4.1.5, page 7-39).
Consider placement of adult fish weir upstream of the proposed dam on prominent Chinook salmon
streams.
Instream Flow
What is the sampling strategy (e.g. representative reach, mesohabitat typing) for the defined habitat
types?
How many and at what range will discharge-calibration sets be collected for each sampling method?
Will 2D modeling include side channels and sloughs within study area?
o Based on comments at the meeting it was my understanding it would.
What criteria will be used to identify cover types and substrate sizes?
For PHABSIM, will transects be independent, dependent or a combination and accordingly, what WSE
models and composite suitability index will be used?
What criteria will be used to select and weight transect-derived models?
Per the description of study sites for fish passage/off-channel connectivity (§6.5.4.5.5), what criteria
will be used to identify "a representative number" of different habitat types?
HSI data is needed for identified target species for each defined habitat type, over 2 years.
How will the data be aggregated to evaluate single flow recommendation?
Will a DSS-type program be available to review study results and if so, information is needed on it.
How do you envision the "collaborative process" will work? When will major decisions be made (e.g.
site and transect selections) and how often do you envision the work group will get together?
What equipment will be used and how will they be calibrated?
For the eulachon and boating studies, similar information is needed on what is the study area, what
sampling strategy will be used, how many and what range of calibration-discharge sets if appropriate,
and how will HSI curves will be developed?
Varial zone modeling, may need more defined time steps during analysis phase (possibly down to 15-
minute increments) depending on the rate of flow change over time.
Groundwater
What are the monitoring well placement sampling approach (e.g. equal spacing along linear transects,
etc.) and location (e.g. for instream flow, in all habitat types?) for the various resource studies (i.e.
EMAIL RECORD
Record of Email Page 3 of 3
instream flow, riparian instream flow, water quality). Also, a description of sampling intensity would
be helpful (i.e. for instream flow purposes, will the objective be to characterize entire gw/sw
interaction throughout entire intensive study site or only at select microhabitats).
What is the duration for monitoring (I believe at the meeting it would be from installation until winter
2013-14?)
How often will monitoring wells be calibrated for various parameters to be sampled pre- post- and
during field monitoring?
For each resource discipline, what parameters will be sampled and what are range of accuracies (e.g.
for water level +/- 0.1 ft?, water temp +/- 0.2 C?, etc.).
Water Quality
Information on availability of the Sampling and Analysis Plan and Quality Assurance Project Plan is
needed.
GW Quality in Selected Habitats (Section 5.5.4.7) - need more information on study. For example,
sampling intensity/number of site measurements per slough or criteria for how they will be
determined. Will ground water level monitors be installed if so, what is the sampling intensity
(numbers per habitat type) and duration of monitoring (e.g. continuous year-round/ point samples
during field visits, etc.). If not, it is strongly recommended groundwater monitoring be performed
concurrently with water quality monitoring in this study.
Any monitors should be calibrated pre- and post-monitoring along with multiple field measurements
for post monitoring calibration.
EMAIL RECORD
Record of Email Page 1 of 12
From: Michael_Buntjer@fws.gov [mailto:Michael_Buntjer@fws.gov]
Sent: Friday, September 07, 2012 5:37 PM
To: Betsy McGregor
Cc: Betsy_McCracken@fws.gov; Catherine_Berg@fws.gov; Lori_verbrugge@fws.gov; eric Rothwell; Brian
Lance; susan walker; joe.klein@alaska.gov; MaryLou Keefe; Cassie_Thomas@nps.gov; tsundlov@blm.gov
Subject: Follow up Notes from the August 2012 Work Group meeting
Hello Betsy:
Thank you for the opportunity to discuss the proposed study plans for the Susitna-Watana
Hydroelectric Project. We look forward to further discussions to clarify the details of the proposed
study plans. I have attached some initial notes, comments, and questions regarding the objectives in
our three fish study requests, our River Productivity Study Request, and those found in the proposed
study plan.
These comments are in addition to those provided during the August 2012 work group meetings, and
are intended to assist in further discussions about development of the study plans. In addition to the
attached comments, I have some overall questions, comments, and concerns about the proposed fish
studies. Based on the proposed methodologies, there does not appear to be any studies to collect
baseline biological or physical spawning habitat information between the time eggs are deposited in
redds and the time of fry emergence, and no information on the timing and movement of fish from
spawning to rearing areas, and only limited information on the distribution and abundance of juvenile
fish up to 60 mm, particularly in winter. These are the life stages most vulnerable to load-following
operations.
Although I have more questions and comments regarding linkages between proposed studies and
project details, these should serve as a starting point for the upcoming fish sub-workgroup meetings. If
you have any questions, please feel free to contact me. Thanks.
Mike
(See attached file: ELH Juvenile Adult Fish D and A Riv Pro mb initial draft comments on PSP.docx)
Mike Buntjer
US Fish and Wildlife Service, Anchorage Field Office
Conservation Planning Assistance
605 W. 4th Ave, Room G-72
Anchorage, AK 99501
(907)271-3053
(907)271-2786 FAX
EMAIL RECORD
Record of Email Page 2 of 12
ATTACHMENT: ELH Juvenile Adult Fish D and A Riv Pro mb initial draft comments on PSP.doc
For each USFWS Study Request below (including our three fish studies and River Productivity) I listed the
objectives in each study request and then followed them with the objectives I found in the PSP. I noted where
the objectives were the same, where they differed, and where our study requests were not addressed in the
PSP. I also include other notes, comments, and questions to assist in further discussions about the proposed
studies.
Early Life History and Juvenile Fish Distribution and Abundance in the Susitna River (USFWS Study
Request; Enclosure 13)
Specific study request objectives versus objectives included in PSP Study 7.5 (upper reach) and Study 7.6
(middle and lower reach):
1. Determine the seasonal distribution, relative abundance (as determined by CPUE, fish density, and
counts), and fish-habitat associations of juvenile anadromous and resident juvenile fish species in the
mainstem Susitna River (side channel, slough, backwater, and tributary confluence habitats).
1. Describe the seasonal distribution, relative abundance (as determined by CPUE, fish
density, and counts), and fish-habitat associations of resident fishes, juvenile anadromous salmonids,
and the freshwater life stages of non-salmon anadromous species; (7.5 upper reach)
- Only winter sampling I see proposed in the upper reach includes using DIDSON and video cameras
in 10 “selected” sloughs and side channels; how were/will sites be selected?; What other habitat
types are available and why are they not being sampled? Is this sufficient to get at winter
distribution and abundance for all life stages?; will not likely be able to identify juvenile species
using these techniques (therefore, no distribution and abundance information and habitat use by
species, particularly for early life stages (<60 mm); other winter sampling (using gill nets, minnow
traps, and trot lines) is listed in the schedule section (and not in methods), but it is not described.
1) Describe the seasonal distribution, relative abundance (as determined by CPUE, fish density, and
counts), and fish-habitat associations of juvenile anadromous salmonids, non-salmonid anadromous
fishes and resident fishes; (7.6 middle and lower reach).
- The list of habitat types to be sampled in this study (middle and lower reaches) appears longer than
habitats proposed for the upper reach, but otherwise same comments as listed above for Study 7.5
(upper reach).
2. Describe the seasonal movements and migratory patterns of juvenile anadromous and resident
juvenile fish species among mainstem habitats and between tributaries and mainstem habitats with
emphasis on identifying foraging and overwintering habitats.
5. Use biotelemetry (PIT and radio tags) to describe seasonal movements of selected fish species
(including rainbow trout, Dolly Varden, whitefish, northern pike, burbot, and Pacific lamprey if present)
with emphasis on identifying spawning and overwintering habitats within the hydrologic zone of
influence upstream of the project; (7.5 upper reach)
EMAIL RECORD
Record of Email Page 3 of 12
- Unclear if this includes or excludes PIT tagging juvenile anadromous salmon, particularly Chinook
salmon; i.e., none are listed
- Also, mentions installing up to six antenna arrays in selected sloughs and side channels in winter; is
that sufficient to determine movement of juveniles in and out of habitats? What about other
habitats? Unclear how sites were selected and what habitats were or were not sampled in the
1980s. Therefore, what is rationale and assumptions for selecting habitat types and sites?
- See nothing on movement (and timing) of newly emergent fish from spawning to rearing areas or
movement of juvenile fish <60 mm in winter (i.e., the post-emergent life stages most vulnerable to
load-following operations)
2) Describe seasonal movements of selected fish species such as rainbow trout, eulachon, Dolly Varden,
whitefish, northern pike, Pacific lamprey, and burbot) using biotelemetry (PIT and radio-tags) with
emphasis on identifying foraging, spawning and overwintering habitats within the mainstem of the
Susitna River and its associated off-channel habitat; (7.6 middle and lower reach)
- Unclear if this includes or excludes PIT tagging juvenile anadromous salmon; i.e., none are listed
- Also, mentions installing up to 10 antenna arrays; is that sufficient to determine movement of
juveniles in and out of habitats by reach? When, where, and how will sites be selected? What is
rationale and assumptions for selecting habitat types and sites?
- See nothing on movement (and timing) of newly emergent fish from spawning to rearing areas or
movement of juvenile fish <60 mm in winter, particularly for anadromous salmonids.
3. Document the timing of downstream movement of all juvenile fish species and outmigration for
anadromous salmon.
6. Document the timing of downstream movement and catch for fish species via outmigrant traps; (7.5
upper reach)
- Unclear if this includes or excludes addressing outmigration and winter sampling
3) Document the timing of downstream movement and catch for all fish species using outmigrant
traps; (7.6 middle and lower reach)
Unclear if this includes or excludes addressing outmigration
4. Document the age structure, growth, and condition of juvenile anadromous and juvenile resident fish
by season.
4) Characterize the age structure, growth, and condition of juvenile anadromous and
resident fish by season; (7.6 middle and lower reach)
EMAIL RECORD
Record of Email Page 4 of 12
- Is there a difference between Document (as requested) and Characterize (as proposed)? Explain
- Is this study objective limited to juveniles or should it say “all” resident fish.
- This objective is not included in upper reach; should at least characterize age structure for all
resident and anadromous fish by season
5. Collect and analyze tissue samples from juvenile salmon and opportunistically from all resident and
non-salmon anadromous fish to support the Genetic Analysis study.
3. Collect tissue samples to support the Genetic Baseline Study for Selected Fish Species (Section 7.14);
(7.5 upper reach)
- No mention of analyzing samples; analysis mentioned in Genetic Baseline Study, but
link/integration to analyzing samples collected in this study is not discussed. Will samples be
analyzed? Explain.
6) Collect tissue samples from juvenile salmon and opportunistically from all resident and non-salmon
anadromous fish to support the Genetic Baseline Study (Section 7.14). (7.6 middle and lower reach)
- Again, no mention of analyzing samples; analysis mentioned in Genetic Baseline Study, but
link/integration to analyzing samples collected in this study is not discussed. Will samples be
analyzed? Explain.
- Because PSP is not structured similarly to our study requests, why is this study objective limited to
juvenile salmon? This may be okay, because genetic sampling included in Salmon Escapement
Study, though no mention in study of analyzing samples or overall links between studies. Without
providing linkages between studies, there is a lot of searching required to find if, where, and how
information is being collected.
6. Collect and provide the Instream Flow study with habitat suitability criteria (HSC) data to support
analysis of potential project impacts.
Mention of HSC is in Study 6.5, but the study request objective is not addressed in the upper,
middle, or lower reaches for juvenile anadromous, resident fish, and non-salmonid anadromous
fish studies. It is unclear how HSC information will be collected, particularly in winter for post-
emergent fish up to 60 mm when fish will be most vulnerable to load-following operations. I see
no empirical baseline information being collected to evaluate potential project effects or for
inclusion in habitat modeling efforts. There is generic reference to developing HSC model in Study
6.5 for these species and life stages, but unclear about the source of that information.
7. Evaluate salmon incubation (embryo development, hatching success, and emergence times) and
associated water quality conditions (e.g., temperature, DO, pH) at existing spawning habitats (slough,
EMAIL RECORD
Record of Email Page 5 of 12
side channel, tributary, and mainstem) in areas with and without groundwater upwelling in the middle
and lower reaches of the Susitna River.
Study Request objectives 7-9 are not addressed in 7.5 or 7.6; there is no mention of egg incubation
(rates or success), hatching (rates or success), stranding (ramping rates) or emergence (dates and
times) sampling anywhere; no mention of baseline intragravel temperature or water quality
monitoring of spawning and pre-emergent juvenile fish habitats; no mention of characterizing
baseline water quality conditions at spawning or rearing habitats.
Only mention is in Study Goals (6.5.1.2, page 6-10); Objective 8. Conduct a variety of post-
processing comparative analyses derived from the output metrics under aquatic habitat models.
Approach appears to evaluate using only physical habitat models and without empirical sampling
post-spawning through emergence and for juveniles up to PIT tagging size (i.e., 60 mm).
8. Evaluate the potential for stranding of juvenile fish and stranding mortality by season under proposed
operational conditions.
This Study Request objective is not addressed. Stranding is mentioned in Chapter 6, but the study
approach is not discussed
9. Measure intragravel water temperature in spawning habitats and winter juvenile fish habitats at
different surface elevations and different depths to determine the potential for freezing of redds,
freezing of juvenile fish, and their habitats.
This Study Request objective is not addressed anywhere.
EMAIL RECORD
Record of Email Page 6 of 12
Adult Salmon Distribution, Abundance, Habitat Utilization and Escapement in the Susitna River (USFWS
Study Request: Enclosure 15)
Specific objectives included in study request versus objectives listed in PSP Study 7.6:
1. Capture, radio tag and track adults of the five species of Pacific salmon in proportion to their
abundance.
1. Capture, radiotag, and track adults of five species of Pacific salmon in the middle and upper
Susitna River in proportion to their abundance. Capture and tag Chinook and coho salmon in
the lower Susitna River.
2. Determine the migration behavior and spawning locations of radio-tagged fish in the lower,
middle, and upper Susitna River.
2. Characterize the migration behavior and spawning locations of radiotagged fish in the lower,
middle, and upper Susitna River.
3. Characterize adult salmon migration behavior and run timing within and above Devils Canyon.
3. Characterize adult salmon migration behavior and timing within and above Devils Canyon.
4. If shown to be an effective sampling method during the 2012 study, and where feasible, use
sonar to document salmon spawning locations in turbid water.
4. If shown to be an effective sampling method during the 2012 study, and where feasible, use
sonar to document salmon spawning locations in turbid water in 2013 and 2014.
5. Compare historical and current data on run timing, distribution, relative abundance, and
specific locations of spawning and holding salmon.
5. Compare historical and current data on run timing, distribution, relative abundance, and
specific locations of spawning and holding salmon.
6. Estimate escapement of adult salmon spawning by mainstem reaches and tributaries.
6. Generate counts of adult Chinook salmon spawning in the Susitna River and its tributaries.
Need to define “generate count” and how generated. If it is an index of abundance, then need
to identify the standardized unit of effort. Also, not sure why escapement estimate is not being
determined? This study references escapement estimates from the 1980s, but not here.
Explain.
7. Collect tissue samples to support the Genetic Analysis Study.
7. Collect tissue samples to support the Fish Genetic Baseline Study (Section 7.14).
8. Determine system-wide Susitna River escapement and run apportionment.
8. Estimate system-wide Chinook and coho salmon escapement to the Susitna River and the
distribution of those fish among tributaries of the Susitna River.
9. Determine the availability and accessibility of spawning habitats by adult salmon to mainstem
and tributary locations based upon flow regime.
Unclear if, how, or where this Study Request objective is being addressed.
EMAIL RECORD
Record of Email Page 7 of 12
Not listed as an objective in this study; section 6.5.4.3.1 (page 6-19) describes assessing
access to rearing and spawning habitats via output from flow routing models. Also,
objective 13 (shown below) in fish passage study (section 7.12); page 7-98):
13. Evaluate the potential creation of fish passage barriers within existing habitats (tributaries,
sloughs, side channels, off-channel habitats) related to future flow conditions, water surface
elevations, and sediment transport.
10. Measure critical habitat characteristics (e.g., channel type, flow, substrate, and groundwater)
at reaches used for spawning and compare these characteristics with those in adjacent
reaches that do not contain spawning adults.
Do not see this study request objective addressed or any objective that looks at characterizing use,
availability, or quality of potential spawning habitats. There appears to be no empirical baseline
information being collected; only see determining distribution and potential abundance of redds.
Also, see mention of evaluating potential dewatering or scouring of redds in Chapter 6, but no
empirical baseline information to assess daily load-following operations.
EMAIL RECORD
Record of Email Page 8 of 12
River Productivity Study (USFWS Study Request: Enclosure 11)
Specific Study Request objectives versus objectives listed in proposed study 7.8:
1. Develop a white paper on the impacts of hydropower development and operations (including
temperature and turbidity) on benthic macroinvertebrate and algal communities in cold climates.
1. Synthesize existing literature on the impacts of hydropower development and operations (including
temperature and turbidity) on benthic macroinvertebrate and algal communities;
- Any difference in developing a white paper versus synthesizing existing literature?
2. Characterize the pre-project benthic macroinvertebrate and algal communities with regard to species
composition and abundance in the lower, middle and upper Susitna River.
2. Characterize the pre-Project benthic macroinvertebrate and algal communities with
regard to species composition and abundance in the middle and upper Susitna River;
- Omission of lower reach is an apparent typo.
3. Estimate drift of benthic macroinvertebrates in habitats within the lower, middle and upper Susitna
River to assess food availability to juvenile and resident fishes.
3. Estimate drift of benthic macroinvertebrates in selected habitats within the middle and upper Susitna
River to assess food availability to juvenile and resident fishes;
- Omission of lower reach is an apparent typo.
4. Conduct a trophic analysis to describe potential changes in the primary and secondary productivity of
the riverine community following post-project construction and operation.
5. Conduct a review on the feasibility of a trophic analysis to describe potential changes in the primary
and secondary productivity of the riverine community following Project construction and operation;
- Shouldn’t this read: Conduct a trophic analysis, if feasible, to describe…? Also, why would it not be
feasible? Explain.
5. Generate habitat suitability criteria (HSC) for Susitna River benthic macroinvertebrate and algal
habitats to predict potential change in these habitats downstream of proposed dam site.
EMAIL RECORD
Record of Email Page 9 of 12
6. Generate habitat suitability criteria for Susitna benthic macroinvertebrate and algal habitats to
predict potential change in these habitats downstream of proposed dam site;
6. Characterize the benthic macroinvertebrate compositions in the diets of representative fish species in
relationship to their source (benthic or drift component).
7. Characterize the macroinvertebrate compositions in the diets of representative fish
species in relationship to their source (benthic or drift component);
- I assume this should include term “benthic”. If not, explain difference.
7. Evaluate the feasibility of reference sites on the Talkeetna and Chulitna Rivers to monitor baseline
productivity, pre- and post-construction. (deleted in PSP; and not addressed)
AEA replaced this objective (with #4 below), but based on discussion at August 15, 2012, TWG meeting
it was suggested to do both or keep the original Study Request objective. We recommend and support
that suggestion.
4. Conduct a literature/data search to identify existing river systems that could act as
surrogates in evaluating future changes to productivity in the Susitna River. (added in PSP)
8. Characterize organic matter resources (e.g., available for macroinvertebrate consumers) including
course particulate organic matter, fine particulate organic matter, and suspended organic matter in
the lower, middle, and upper Susitna River.
8. Characterize organic matter resources (e.g., available for macroinvertebrate consumers) including
course particulate organic matter, fine particulate organic matter, and suspended organic matter in
the lower, middle, and upper Susitna River.
9. Estimate benthic macroinvertebrate colonization rates in the middle and lower reaches to monitor
baseline conditions and evaluate future changes to productivity in the Susitna River.
EMAIL RECORD
Record of Email Page 10 of 12
9. Estimate benthic macroinvertebrate colonization rates in the middle and lower reaches to monitor
baseline conditions and evaluate future changes to productivity in the Susitna River.
Note: Page 7-12 of PSP states that marine derived nutrients are included in River Productivity Study,
but there is no mention of it in Chapter 7; i.e., is not addressed.
EMAIL RECORD
Record of Email Page 11 of 12
Adult and juvenile non-salmon anadromous, resident and invasive fish studies in the Susitna River
basin (RM 0 - RM 233)(USFWS Study Request; Enclosure 14)
General objectives for this study request are to:
COMMUNITIES AND ASSEMBLAGES
Characterize the seasonal (spring, summer, fall, winter) distribution, relative abundance, and habitat
utilization in the Susitna River mainstem (RM 0-RM 233) for all life stages of non-salmon anadromous,
resident, and invasive fish species. [Documenting both hierarchal nested habitat type and use-type as
described in the resource agency Instream Flow Study and Habitat Utilization Study Request].
Recommendation for hierarchical nested habitat type and use-type not addressed in PSP.
Characterize the seasonal (spring, summer, fall and winter) movement patterns of all subject fish
species and life stages as they relate to foraging, spawning, rearing and overwintering habitats. The
characterization of seasonal movements includes run timing (immigration and emigration) and extent
(periodicity) of non-salmon anadromous species in the Susitna River (RM 0-RM 233) and movement
into and out of tributary streams. [Interface with resource agency Instream Flow and Habitat
Utilization Study Request hierarchal nested habitat types and habitat mapping].
Interface with resource agency Instream Flow and Habitat Utilization Study Request hierarchal
nested habitat types and habitat mapping does not appear to be addressed.
Characterize the flow-related or synchronized life history strategies (migration, movement, spawning,
rearing, hatching, emergence) of non-salmon anadromous, resident and invasive species, and their
biological behavorial response (e.g., potential for false attraction, delayed migration or increased
holding time, synchrony of spawning, relative hatching and emergence timing) to Project-affected flow
alterations (flow, temperature, habitat, water quality).
Similar to juvenile anadromous salmonid comments above, much of this Study Request objective
does not appear to be addressed in the PSP, particularly for movement, rearing, hatching,
emergence and juvenile fish (<60 mm) in winter.
RESOURCE DATA SYNTHESIS
Synthesize existing resource data, results and information from 1980’s Susitna Hydroelectric studies,
and other relevant literature to determine applicability and utility of results and information to the
currently proposed project.
What is timeframe for completing? Not addressed in PSP
GENETICS
Collect tissue samples from all resident and non-salmon anadromous fish species for genetic
population structure database and future stock identification analysis. This is particularly important for
salmon species, anadromous lamprey, and Bering cisco of the Susitna River drainage.
TROPHIC ECOLOGY
EMAIL RECORD
Record of Email Page 12 of 12
Characterize trophic interactions using seasonal diets (stomach content analysis) of all age classes of
non-salmon anadromous, resident and invasive fish species. [Interface with the productivity study,
riparian, and instream flow study requests]
Quantify the relative contribution (biomass) of marine-derived nutrients to the ecology of the Susitna
River from adult returns of non-salmon anadromous fish species (e. g., Pacific and Arctic lamprey,
eulachon, Bering cisco).
Page 7-12 of PSP states that marine derived nutrients are included in River Productivity Study, but
there is no mention of it in Chapter 7; i.e., is not addressed.
EMAIL RECORD
Record of Email Page 1 of 6
From: Betsy_McCracken@fws.gov [mailto:Betsy_McCracken@fws.gov]
Sent: Friday, September 07, 2012 4:02 PM
To: Betsy McGregor
Cc: Bryan Carey; 'Fullerton, Bill'; Betsy McGregor; Bob_Henszey@fws.gov; eric Rothwell; 'Klein, Joseph P
(DFG)'; 'Kevin Fetherston'; 'Matthew LaCroix'; 'Laura Arendall'; 'Mike Buntjer'; 'MaryLou Keefe'; 'Michael R. Lilly,
GW Scientific'; PHilgert@r2usa.com; rob.plotnikoff@tetratech.com; 'Benkert, Ronald C (DFG)'; susan walker;
'William Rice'; matt.cutlip@ferc.gov; Lori_Verbrugge@fws.gov; Catherine_Berg@fws.gov;
Jennifer_Spegon@fws.gov; dreiser@r2usa.com
Subject: Follow up comments from August 15-17 ILP meetings
Hi Betsy,
Thank you and AEA for hosting the August ILP meetings. We all gained a lot of insight from the meetings, and
we were pleased to be updated. Like others, as a result of the meetings, the Service has a few comments and
concerns to share with the group.
In addition to these below, other staff from the Service may provide comments relative to their study area
expertise. We hope that our collective comments will be helpful toward gaining concurrence on proposed
studies, and as we move forward with the review process of the proposed Watana dam.
Thank you,
Betsy
_________________________________________________________________________________________
_________________________________
September 7, 2012
Notes from ILP Formal Study Meetings August 15-17, 2012:
At the request of AEA and its consultants, the USFWS (Service) submits this brief summary of concerns
regarding the Susitna-Watana hydropower dam formal ILP Formal Study meetings that were held August 16-17,
2012. The Service’s concerns in this informal correspondence, along with other remaining concerns will be
further articulated in the Service’s formal response letter on AEA’s ILP Proposed Study Plan (PSP) review, due
to FERC October 15, 2012. Additional informal comments from the Service may be provided under separate
cover before the October due date.
FWS concerns highlighted during meetings relative to Instream Flow, Habitat Utilization and the
Geomorphology proposed study plans:
Overall, the Service finds that AEA’s proposed study plans for instream flow, habitat utilization and
geomorphology do not fully address agency’s resource management concerns. During the three days of ILP
study meetings, sequencing and integration of the proposed biological resource studies and the physical
process studies was not described and is still a significant outstanding information need. It is necessary to
describe the integration of these inter-related studies and how that integration will result in a comparison of the
baseline biological information and the resulting effects to biologic resources caused by the proposed project
operations. Study results must be quantifiable in order to assess potential losses to aquatic resources and their
habitats, to review the project under our relevant fish and wildlife resource conservation authorities, to inform
fishway prescription authority under Section 18 of the Federal Power Act, and to eventually develop
recommended protection, mitigation, and enhancement for the project license. We do not believe that the
current study plan proposals will yield sufficient information to allow us to adequately assess proposed project
impacts to the Nation’s fish and wildlife resources and develop adequate PME’s.
EMAIL RECORD
Record of Email Page 2 of 6
The Service has repeatedly articulated concerns about the lack of study sequencing, connectivity and
integration between the biological studies and the other proposed engineering and physical processes studies.
We reiterate and highlight the need for the collection of adequate temporal and spatial baseline biological and
fish habitat data to provide direct input to some of the proposed physical modeling efforts. Many of our
concerns, below, are related to the temporal mismatch of biological data collection with the forward momentum
of the physical modeling efforts.
-Habitat Mapping
Hierarchially-nested aquatic habitats- HDR stated at the meeting that the “habitat mapping” will be started in
September; and that the sampling will be stratified by meso-habitat type as identified in the 1980’s study reports.
The 1980’s studies did not hierarchically nest the habitat types. The Service specifically requested hierarchially
nested habitat mapping (e.g., Frissel et al, 1986). We are concerned with the proposal to use the 1980’s study
sites, which focus on the side sloughs, and do not consider the full breadth of fish habitats, which is currently
unknown and the subject of ongoing study that has not been completed or submitted for agency review and
comment. We do not endorse the use of the 1980’s sites without out first completing and then applying a
hierarchal assessment of the river reaches as a study framework. The hierarchally nested aquatic habitats
framework is needed to structure fish distribution surveys, the instream flow study and other physical process
studies. Without it, the fish surveys will be too narrowly constrained and the instream flow studies will not
represent all habitats that may be affected by the proposed project. The Service recommends the following
habitat hierarchy for the Susitna River be used for habitat mapping purposes and integration of studies:
Large River Floodplain Habitat Hierarchy
1. Geomorphic units: Large-scale geomorphic and hydraulic controls.
a. Bedrock controlled, single-channel units with shallow hyporheic exchange and thermal homogeneity.
b. Unconfined, multiple channel floodplain units with expansive hyporheic exchange and thermal
heterogeneity.
2. Macrohabitats: Primary, flood, and spring channel networks.
a. Primary channels—Perennial channels.
b. Flood channels—Seasonally connected channels.
c. Spring channels—Disconnected sloughs that discharge groundwater.
d. Floodplain ponds—Ponded spring channel networks.
3. Mesohabitats: Bed and bank morphological controls; hydraulic features.
a. Riffle-pool sequences—Run, riffle, pool, glide, tailout.
b. Backwaters, alcoves, shallow meander margins.
4. Microhabitats: Hydraulics, water quality, substrate, cover.
a. Water depth, velocity, bulk flow characteristics (e.g. Reynolds and Froude #’s).
b. Vertical hydraulic exchange (ground and surface water exchange).
c. Bed, or intragravel temperature and dissolved oxygen.
d. Substrate size, heterogeneity.
EMAIL RECORD
Record of Email Page 3 of 6
e. Elements of wood, vegetation, and rock structure.
-Fish distribution: A first step is to assess the seasonal distributions of target species and life stages and the
physical habitat criteria that influence habitat selection and suitability. As a first step, target species have to be
identified, agreed upon, and their life history and habitat use similarities to other, unstudied species (i.e., non-
target species) need to be determined and described. In the study requests of the Service and other agencies,
we recommended studying the baselines of all affected fish species and life stages, including all five species of
anadromous salmon and all resident fish.
Fish distribution data are needed to describe the baseline data to support and compliment other proposed study
objectives, including those related to fish habitat selection and utilization. A first step to acquiring adequate fish
distribution is to assess the full lateral and longitudinal profile of seasonal fish distribution, life stage periodicity,
and suitable used and unused habitats that are influential in fish habitat site selection. The fish distribution data
is needed to provide the base data layer that will support and compliment other proposed study objectives,
including those related to fish habitat selection and utilization, and instream flow (ISF) needs. This information
is also needed for resource agencies’ fishway prescription decisions under the Federal Power Act. Baseline
biological information is critical input necessary for integration with physical studies. Accordingly, the Service is
reiterating the need for multiple and continuous years of biologically relevant data in order to provide robust
integration with the physical modeling studies, and decision-support relative to fish and wildlife resources of the
Susitna River basin.
-Habitat site selection criteria: Criteria that influence habitat selection and suitability need to be identified
using statistically powerful and robust methods and current models of fish distribution including bioenergetics
and not exclusively physical habitat models (Lovtang 2005). The Service remains opposed to the proposal to
repeat the 1980’s approaches to fisheries studies. The 1980’s studies do not determine the habitat criteria
influencing fish habitat site-selection, they simply report utilization functions for water depth and velocity, or
depth and substrate. They also lack a fundamental baseline assessment of all available fish habitat and instead
focus on study of habitats that had high fish use density. The habitats that were apparently suitable but
unoccupied or underutilized by fish need to be assessed, and the entire range of habitat availability and habitat
use data need to be assessed prior to habitat study site selection.
More comprehensive data collected on nearby glacial rivers may be used to demonstrate that habitat selection
by salmon in side-sloughs can be independent of water depth and velocity and should be compiled.
Fish habitat study sites should be surveyed and identified using the full range of habitats seasonally utilized by
agreed-upon target species and life stages. The objective is to identify the bioenergetics and physical factors
that control fish habitat selection. The Service considers the assessment of habitat influential to fish habitat site
selection to be an objective of the Instream Flow and Habitat Utilization Study request. In the resource agencies
Instream Flow and Habitat Utilization Study Plan requests, this is a specifically stated objective.
Sequentially, appropriate flow-habitat models can be selected after assessment and validation of 1) the full
seasonal distribution of target species and life stages,2) the physical factors (e.g., micro-habitat data) that
influence habitat selection and suitability, and 3) the bioenergetic factors affecting fish habitat suitability and
productivity.
Thus, field visits proposed for the end of September (2012) should be considered as reconnaissance and for
discussion purposes, and not for the purpose of actual study site-selection.
-Habitat Suitability Indices: Methods for collecting site-specific habitat criteria for the glacial Susitna River
need to be collaboratively identified. (As recommended in the resource agencies study plan request for Instream
Flow and Habitat Utilization). These criteria also need to be evaluated in the context of the hierarchical habitat
model, such that habitat criteria are determined and evaluated in all habitats of importance to each agreed-upon
target species and life stage.
The 1980’s studies were inconclusive in demonstrating a relationship between fish habitat criteria and fish
distribution, and they were also narrowly focused on associations of spawning and rearing salmon with water
EMAIL RECORD
Record of Email Page 4 of 6
depth and velocity in spring channels (side sloughs). Not only is this not representative of existing habitat and
the distribution of fish within those habitats, habitat data collected from nearby glacial rivers demonstrates that
spawning habitats selection is independent of flow depth and velocity in side sloughs and may be profoundly
influenced by bioenergetics and the input of organic matter .
This indicates that traditional hydraulic modeling (e.g., PHABSIM), as proposed, may be an insufficient fish
focus/tool. So, first we need to identify criteria that are influential to habitat selection, within the full seasonal
distributions of agreed-upon target species and life stages. Only then, after this has been adequately
determined, can we begin to develop utilization functions (curves or HSC) for those criteria.
The Service has previously expressed concern with the approach of repeating the 1980’s study effort, and we
have repeatedly asked for both a complete compilation of available data, and a review of the 1980’s information
prior to accepting its use for the proposed project. Lacking that review, we independently note that, in the
1980’s sites were selected that were, presumably, heavily utilized by spawning sockeye and chum (qualitative).
Study sites need to be based on relevant criteria related to physical habitat site selection as documented by fish
distribution and lack thereof.
-Groundwater- The integration of the groundwater study efforts with the biological studies is not clear.
Specifically, how will the groundwater study be made relevant to the scale of fish habitat and fish habitat site
selection in the Susitna River? The objectives of the groundwater study should include relevance to the
hierarchially nested habitats, including macro-, meso-, and micro-habitats that are influential to fish habitat
selection. The groundwater study sampling design should be relevant to fish habitat and site selection. A
specific objective needs to be measuring the hydraulic gradient/head (upwelling or downwelling) under the
existing hydrograph and under the proposed project hydrograph release flow schedule.
-Model selection: We need to first determine what criteria are important to fish habitat site/suitability and
selection before we can choose an appropriate flow-habitat model. ADFG Marine Mammals biologist, Dr. Bob
Small also reiterated this very same point regarding model selection for the beluga whale studies. Again, the
Service notes our concern about the limited focus of the 1980’s studies and using PHABSIM. Our concerns
stated in earlier correspondence to AEA remain unaddressed and are reiterated here for emphasis.
Model sensitivity and relevant criteria (inputs) are critical to achieving statistically valid outputs. At this point, it is
premature to select a model until we have known 1) fish distribution, and 2) identification of variables influential
to fish habitat site selection.
-Biometric Review- The Service previously requested a biometric review of the 1980’s findings. This request is
remains outstanding and should be conducted prior to basing any study plans on 1980’s studies or results. In all
cases, including the usage of the 1980’s Su-hydro data results and for the Susitna-Watana study plans,
estimates of precision and accuracy of study results is required to evaluate the power of any study plan. Details
of proposed study plan sampling and design methods need to be explicit and statistically valid with a priori
determination of levels of precision and accuracy of model outputs.
-Fish genetics- During the August 15-17 meetings, AEA stated that genetic samples from the Chinook above
the proposed dam site would not be collected. The stated rationale was due to the desire to minimize the
handling of the fish after subsequent tagging of fish. Genetic samples of Chinook at locations above the
proposed Susitna-Watana dam site are crucial to informing the Service’s management goals specific to
recommending licensing conditions under the Federal Power Act, and to conservation recommendations under
the Fish and Wildlife Coordination Act, and the Anadromous Fish Act. As such, we consider our request for
collection of genetic samples from Chinook salmon, and other fish species to be necessary for our resource
evaluation of the Susitna-Watana hydropower project.
Because of this information need, if AEA does not plan to collect the information, AEA should document how
this study request is being addressed.
Fish species genetic samples used for comparisons should be less than ten years old to reflect current gene
frequencies among the sampled fish populations. Genetic samples for salmon exist for some tributaries in the
EMAIL RECORD
Record of Email Page 5 of 6
lower and middle Susitna River. Some of these samples are greater than ten years old.
Fish genetic samples should be current and include samples of the Chinook migrating above the proposed dam
location. Because gene frequencies change over time, all genetic samples should be within the most recent ten
years to allow for valid comparison. Genetic analysis should analyze the existing extent of genetic differentiation
within and between fish using distinctly different habitats. We request genetic analysis of Chinook above the
proposed dam site relative to those at other upper, middle and lower river and tributary sample locations.
-Fish Passage/fishway prescription- The Service is concerned with the lack of transparent discussion about
the potential for fish passage alternatives at the proposed Susitna-Watana dam. If fish passage is required, how
will that be accomplished? If it is not feasible, what is your alternative proposal? Where is your project
assessment of the fish passage feasibility? What are the design criteria being considered/evaluate d?
-Compensatory Mitigation- Compensatory mitigation is determined as part of a mitigation sequence after
avoidance, and minimization efforts. The Service has inquired about potential compensatory mitigation for
project impacts during several meetings. To date, this concern has not satisfactorily been addressed by the
project sponsors or project consultants. Because compensatory mitigation is a requirement in order to offset
unavoidable projects impacts to fish and wildlife resources and their habitats, it is should be considered
throughout the review process. Please explain how you plan to quantify existing habitats, and quantify primary,
secondary and cumulative (40cfr Part230 of the CWA) losses to those habitats under the proposed operational
flows over the temporal scale of the license period. How will habitats change proportionally under project
operations?
-Lower river- The Service is concerned with AEA consultants’ proposal to establish a lower boundary for the
physical studies (e.g., geomorphology, instream flow) at a location “downstream of Sunshine” at approximately
river mile 75, and not extend the study efforts further down into lower river to inform the biological studies. There
are many biological resource studies that would necessarily be informed by establishing a consistent study
boundary between the physical and biological studies. For example, studies related to the federally listed Cook
Inlet beluga whale, fish species and habitats, including the resident species, and anadromous salmon a nd
eulachon (beluga whale prey species). The lower river also includes the Susitna Flats State Game Refuge. If the
physical studies boundary is terminated at river mile 75, there will be no ability to relate or integrate biological
data to those studies (e.g., geomorphology, ISF, ice processes, flow routing). Resource agencies management
goals would effectively not be addressed below river mile 75, if project effects are not assessed to the mouth of
the river.
According to USACE (1966), 80% of the ability to produce accurate model results depends on using
appropriate bathymetry data, mesh design, and boundary conditions. The amount of time needed to collect this
information, particularly the bathymetry data, depends on the complexity of the channel’s geometry, which is
known to be complex in the lower Susitna River. Because data collection in the lower river will likely require
rigorous field collection due to the channel complexity, it is critical to initiate these efforts in a time sensitive
manner. The proposal to delay work in the lower river pending analysis at an arbitrary, and certainly non-
biologically relevant location, does not meet resource agencies objective of evaluating the potential project
impacts to fish and wildlife resources in the lower Susitna River. This is particularly true under the FERC ILP
process timeline specific to the Susitna-Watana dam project.
-Studies integration: A “map” or chart of how studies are proposed to be integrated is needed. AEA sponsors
and consultants, committed to providing this by September. Biological resource components are currently not
integrated or connected to the other studies, and appear as being treated independently of the rest of the study
requests. Study proposals must demonstrate how they will be integrated to provide needed resource
information.
Studies/components not address from the Non salmon anadromous, resident and invasives fish species
study request: During the August ILP meetings, the follow Service requests were preliminarily noted as not
being addressed or adequately addressed by AEA’s PSPs.
EMAIL RECORD
Record of Email Page 6 of 6
1) Marine derived nutrients contribution from non salmon anadromous species. The Service requested
information in our non-salmon anadromous, resident and invasive study plan request. It is not clear which study
proposal it is addressing this request, or IF it is being addressed. During the August 15-17 meetings, it was
indicated that it may be addressed in either the riparian instream flow, the terrestrial wildlife, the river
productivity or elsewhere. However, AEA’ s consultants were unable to specifically “point to it” when asked. It
does not appear to have been included in the PSPs.
2) Resource valuation of non-salmon anadromous and resident fish resources. During the meeting, AEA
consultants stated that a resource valuation would not be provided, as requested in the Service’s study request
for non salmon anadromous, resident and invasive fish study. An explanation of why this assessment will not be
addressed was not provided. We request that an explanation be provided that describes the rationale for this
determination and urge reconsideration of our study request.
3) Trophic ecology- The Service requested information on trophic ecology in the non salmon anadromous,
resident and invasive species study request. Michael Link stated that there are “significant predator-prey
dynamics” particular once fish move out of the mainstem; using this behavior to explain why fish hold there until
they are ready to dash to tributaries. He noted that the creeks are heavily preyed upon by bears, for example.
Dr. Bob Small (ADFG) recommended trophic ecology and/or foraging ecology information for the Cook Inlet
beluga whale studies. For fish, coordination with Tim Nightengale (AEA’s consultant; via teleconference) stated
that he would take gut samples from fish to see what macro-invertebrates they are eating, and when, and will
work with fish study teams to do some trophic analysis. The trophic ecology component needs to be clearly
spelled out in a study plan identifying any aspects that will and will not be addressed explained and with
appropriate rationale.
References:
Frissell, C. A., W. J. Liss, C. E. Warren, and M. D. Hurley. 1986. A hierarchical framework for stream habitat
classification: viewing streams in a watershed context. Environmental Management 10:2. Pp. 199-214.
Lovtang, J. C. 2005. Distribution, habitat use, and growth of juvenile Chinook salmon in the Metolius River
Basin, Oregon. M.S. Thesis, Oregon State University. March 2005.
USACE 1966. (Full citation will be provided in follow-up correspondence)
Betsy W. McCracken
Fishery Biologist
Conservation Planning Assistance
Ecological Services
US Fish and Wildlife Service/Region 7/Anchorage Field Office
Betsy_McCracken@fws.gov
(907) 271 - 2783
RECORD OF
TELEPHONE
CONVERSATION
Record of Telephone Conversation Page 1 of 1
AEA Team Member Other Party
Name: Dani Evenson Name: Randy Brown
Organization: R2 Resource Consultants Organization: USFWS
Study Area: Fish & Aquatics - Fish Distribution and
Abundance Study Plan
Phone
Number: (907) 456-0295
Date: 9/18/12 Time: 3:30 PM – 4:45 PM
Call Placed by: X AEA Team Other Party
Others on Call:
N/A
Subject: Fish Distribution and Abundance Study Plan
Discussion:
Discussed Randy Brown’s recent research on whitefish and Dolly Varden on Susitna River.
1. Humpback whitefish. Has n=20 otoliths from Yentna (ADF&G) and n=20 from Upper Su (from J.
Buckwalter @ ADF&G. Will analyze otoliths to determine anadromy.
2. Round whitefish. Only has n=60 otoliths. Less migratory; little to no time in salt/brackish water.
3. Bering cisco. 4 years of recent data (2008-2011)
a. Spawn in mainstem downstream of 3 rivers confluence; most of the population is within the 5
river miles below Montana Creek.
b. Enter the Susitna in August from the sea.
c. Spawn 2nd week in October
d. Otolith microchemistry analysis suggests they all go to sea.
e. Sampled on spawning grounds for genetic tissues; no results yet.
f. Length distributions are the same as in the 1980’s. Aging methods may be suspect, but lengths
are not. Consistent lengths between now and the 1980’s suggest stability and validate 80’s
data.
g. Did not think additional data on cisco are warranted.
4. Dolly Varden. Lots of variability; some venturing into brackish water- semi-anadromous.
Randy shared his unpublished data with D. Evenson
RECORD OF
TELEPHONE
CONVERSATION
Record of Telephone Conversation Page 1 of 1
AEA Team Member Other Party
Name: Dani Evenson Name: Matt Evenson
Organization: R2 Resource Consultants Organization: ADF&G-Division of Sport Fish
Study Area: Fish & Aquatics - Fish Distribution and
Abundance Study Plan
Phone
Number: (907) 459-7273
Date: 9/19/12 Time: 10:00 AM – 11:00 AM
Call Placed by: X AEA Team Other Party
Others on Call:
N/A
Subject: Fish Distribution and Abundance Study Plan
Discussion:
Matt reviewed his burbot research on the Tanana River.
1. Suggested reviewing Bernard et al 1991 for description of hoop traps.
2. Indicated that trot lines are lethal sampling for burbot; suggested using hoop traps to capture fish for
tagging. Offered to loan AEA consultants their traps.
3. Methods:
a. Sampling is best right before freeze up. Suggested sampling in late August-early Oct.
b. Burbot prefer slack water in the mainstem. Deploy hoop traps near cut banks or snags where
they can easily be anchored.
c. Soak overnight, but not too long as accumulation of sediment can be lethal.
d. Catch rates highest in spring and fall.
e. Bait traps with herring.
f. Tag and release in open water.
g. Spread out sampling above and below proposed dam site.
h. Only tag fish >550mm.
4. Would like to participate in burbot sampling if possible.
5. Would like info on when burbot spawn.
APPENDIX 4
INFORMAL CONSULTATION DOCUMENTATION
SECTION 10 – WILDLIFE RESOURCES
Documentation of Consultation on Wildlife Resources Study Plans
(from release of PSP on July 16, 2012 through Interim Draft RSP on October 31, 2012)
08/16/2012 Telephone conversation between Mark Burch, ADF&G, and Brian Lawhead,
ABR
09/06/2012 Notes from Small Group Meeting on Shorebirds and Landbirds
09/13/2012 Notes from Small Group Meeting on Selected Mammals
09/22/2012 Email from Steve Matsuoka, USFWS, to Brian Lawhead, ABR
09/24/2012 Email from Mark Burch, ADF&G, to Brian Lawhead, ABR
09/24/2012 Telephone conversation between Mark Burch, ADF&G, and Brian Lawhead,
ABR
10/04/2012 Notes from Small Group Meeting on Waterbirds
10/12/2012 Email (re: wolverine study) from Mark Burch, ADF&G, to Brian Lawhead,
ABR
10/12/2012 Email (re: Dall’s sheep study) from Mark Burch, ADF&G, to Brian
Lawhead, ABR
10/31/2012 Email from Mark Burch, ADF&G, to Brian Lawhead, ABR
11/21/2012 Telephone conversation between Mark Burch, ADF&G, and Brian Lawhead,
ABR
11/29/2012 Telephone conversation between Sarah Bullock, BLM, and Brian Lawhead,
ABR
12/04/2012 Telephone conversation between Howard Golden, ADF&G, and Brian
Lawhead, ABR
12/04/2012 Telephone conversation between Merav Ben-David, University of Wyoming
and Brian Lawhead, ABR
12/7/2012 Email from Mark Burch, ADF&G, to Brian Lawhead, ABR
RECORD OF TELEPHONE
CONVERSATION
Record of Telephone Conversation Page 1 of 1
AEA Team Member Other Party
Name: Brian Lawhead Name: Mark Burch
Organization: ABR, Inc. Organization: Alaska Dept. of Fish & Game
Study Area: Various Phone
Number: 907-861-2109
Date: 24 Sep 2012 Time: ~14:00
Call Placed by: X AEA Team Other Party
Others on Call: None
Subject: Expansion of ADF&G role in 2013–2014 wildlife study plans
Discussion:
Brian called Mark to initiate further discussion on ADF&G’s potential interest in expanding the agency’s role in
the 2013–2014 study plans, first discussed at the September 13 meeting at ADF&G. Mark is currently trying to
organize internal ADF&G meetings to follow up on specifics with the appropriate departmental staff.
Specific items of discussion included the following:
Wolverine study: ADF&G is potentially interested in participating in the proposed survey effort, using the
Sample-Unit Probability Estimator (SUPE) method. ABR could potentially provide some observers if ADF&G
needs additional help.
Dall’s sheep study: ADF&G is potentially interested in conducting the proposed aerial survey in the study area.
Other items being considered by ADF&G are the possibility of genetic sampling to elucidate the degree of
isolation of the sheep inhabiting the Watana Creek Hills (north of the proposed reservoir inundation zone), as
well as the extent of the aerial survey area needed on the southern side of the Susitna River.
Large carnivores study: ADF&G is pursuing the feasibility of conducting the density modeling (discussed at the
Sep. 13 meeting) with David Miller of the University of Rhode island. They also will discuss their potential
involvement in the DNA and stable isotope sampling proposed for bears using anadromous fish spawning
streams downstream from the dam in the middle reach of the Susitna River drainage.
Aquatic furbearer study: ADF&G is willing to assist in obtaining hair samples for preconstruction
characterization of mercury levels in aquatic furbearers, although the small number of trappers, and the small
number of piscivorous furbearers likely harvested, in the reservoir inundation zone and stream drainages
immediately downstream from the proposed dam site would be problematic for obtaining samples. Hair snags
might be a better way to obtain samples.
Also discussed minor revisions to the Proposed Study Plans for caribou (drop calf survival estimation from
objectives) and moose (GeoSpatial Population Estimator [GSPE] survey is being planned for November 2012,
so, if successful, then the GSPE effort could be dropped from the 2013–2014 study plan. If not successful in
2012 due to unsuitable survey conditions, then the GSPE survey effort would be retained in the study plan. See
follow-up email about the caribou and moose plan revisions from Mark Burch to Brian Lawhead on same date.
RECORD OF TELEPHONE
CONVERSATION
Record of Telephone Conversation Page 1 of 1
AEA Team Member Other Party
Name: Brian Lawhead Name: Mark Burch
Organization: ABR, Inc. Organization: Alaska Dept. of Fish & Game
Study Area: Dall’s Sheep & Wolverine Phone
Number: 907-861-2109
Date: 5 Oct 2012 Time: (not recorded)
Call Placed by: X AEA Team Other Party
Others on Call: None
Subject: Expansion of ADF&G role in 2013–2014 wildlife study plans
Discussion:
Mark called Brian to discuss ADF&G’s interest in expanding the agency’s role in the 2013–2014 study plans, as
discussed at the small-group follow-up meeting at ADF&G September 13 and in a phone conversation on
September 24.
Specific items of discussion included the following:
Dall’s sheep study: ADF&G is interested in conducting the proposed aerial survey in the study area, focusing on
Game Management Unit 13E east of the Parks Highway, using their standard summer survey timing in late July
or early August, shortly before the hunting season begins. Another potential study component being considered
by ADF&G is the possibility of radio-collaring sheep at the Jay Creek mineral lick to examine movements in
sheep range north of the Susitna River. He requested an electronic version of the most current version of the
study plan for revision.
Wolverine study: ADF&G is interested in conducting the proposed survey effort, using the Sample-Unit
Probability Estimator (SUPE) method and possibly extending the sampling over 2 years to allow for occupancy
modeling. He requested an electronic version of the most current version of the study plan for revision.
RECORD OF TELEPHONE
CONVERSATION
Record of Telephone Conversation Page 1 of 1
AEA Team Member Other Party
Name: Brian Lawhead Name: Mark Burch
Organization: ABR, Inc. Organization: Alaska Dept. of Fish & Game
Study Area: Various Phone
Number: 907-861-2109
Date: 21 Nov 2012 Time: ~12:00
Call Placed by: X AEA Team X Other Party
Others on Call: None
Subject: Follow-up on ADF&G comments on selected wildlife study plans for 2013–2014 Revised Study Plan
Discussion:
Brian returned Mark’s call, which was a follow-up to an email from Brian requesting a conversation to discuss
ADF&G comments in an email from Mark to Brian on November 19, 2012.
Specific items of discussion included the following:
Wood frog study (Section 10.18): Brian described ABR’s proposed response to Mark’s email comment (dated
Monday, November 19, 2012) regarding the need to conduct two visits to each sampling site for frog surveys.
As proposed, the frog study plan will incorporate removal sampling, which should be slightly more efficient than
the standard design for estimating occupancy rate and will allow sampling of more ponds in the failry short time
period available for sampling, which will help meet the objective to sample a broad area throughout the entire
Project area.
Aquatic furbearer study (Section 10.11): Brian asked for clarification on the PSP comment regarding the use of
transects for river otter surveys, and Mark suggested that Brian contact Howard Golden of ADF&G DWC for
further discussion.
Moose study (Section 10.5): The GeoSpatial Population Estimator (GSPE) survey planned for November 2012
has not yet been conducted because of insufficient snow cover in the study area during preliminary stratification
survey flights. They will keep trying, but the cut-off date is December 5. If the GSPE cannot be flown in 2012
due to unsuitable survey conditions, then it will be retained in the study plan for November 2013 or March 2014.
RECORD OF
TELEPHONE
CONVERSATION
Record of Telephone Conversation Page 1 of 1
AEA Team Member Other Party
Name: Brian Lawhead Name: Sarah Bullock
Organization: ABR, Inc. Organization: Bureau of Land Management
Study Area: Project area Phone
Number: (907) 822-3217
Date: 29 November 2012 Time: 3:00 PM
Call Placed by: X AEA Team Other Party
Others on Call: None
Subject: 2013–2014 Revised Study Plans for Willow Ptarmigan and Small Mammals
Discussion:
Willow Ptarmigan (Section 10.17): Brian described the comment response received by email on 16 August
2012 from the Alaska Department of Fish and Game and the University of Alaska Fairbanks, sent in response to
Sarah’s comment on the study request in BLM’s May submittal and discussed at the Terrestrial Resources
Technical Work Group meeting on 9 August 2012. Although Brian had received the original email from Mark
Burch, she was not cc’d and Brian did not forward it to Sarah for her records. Brian discussed the response with
Sarah and she was satisfied with the response. After the call, Brian forwarded the email response to Sarah for
her records.
Small Mammals (Section 10.12): Brian described the proposed conversion of the small mammal study from one
with both desktop and field components to a desktop-only analysis, as proposed at the Terrestrial Resources
Technical Work Group meeting on 16 October 2012. He explained the rationale for doing so, which is that,
based on the intensive work conducted using appropriate sampling methods by the University of Alaska
Museum in the early 1980s for the original APA Susitna Hydroelectric Project, additional field trapping using the
same sampling methods is unlikely to provide significant new information on the occurrence and habitat use of
small mammal species in the Project area. The combination of the existing data with the habitat map to be
produced for the Project area is expected to provide sufficiently detailed information to fulfill the goal of the
study. Sarah appreciated the call and was satisfied with the proposed change. After the call, Brian forwarded
some information and publications to Sara on the Alaska tiny shrew, which is listed by BLM as a sensitive
species.
RECORD OF
TELEPHONE
CONVERSATION
Record of Telephone Conversation Page 1 of 1
AEA Team Member Other Party
Name: Brian Lawhead Name: Howard Golden
Organization: ABR, Inc. Organization: Alaska Dept. of Fish and Game
Study Area: Project area Phone
Number: (907) 267-2177
Date: 4 December 2012 Time: 11:10 AM
Call Placed by: X AEA Team Other Party
Others on Call: Alex Prichard, ABR, Inc.
Subject: 2013–2014 Revised Study Plan for Aquatic Furbearers
Discussion:
Aquatic Furbearers (Section 10.11): Brian and Alex called Howard to discuss ADF&G’s comment on the draft
interim Revised Study Plan, dated 14 November 2012, in which it was suggested that transect surveys or
occupancy modeling might be considered as part of the study design. Howard suggested that transect surveys
to count tracks intercepting the flight lines (marked as GPS waypoints and quantified as tracks per kilometer)
would be more useful for river otters than would an occupancy model design.
The discussion focused on layout of transects perpendicular to the main Susitna River drainage and tributary
drainages, rather than following the watercourses, as proposed in the plan. The purpose of the perpendicular
transects would be to attempt to detect river otters using lakes away from streams and crossing from one
drainage into adjacent ones.
Howard also described the design of the modified snare he suggested using to sample otter hair for mercury
sampling. Following the call, Howard sent an article describing the otter hair snare design he suggested.
RECORD OF
TELEPHONE
CONVERSATION
Record of Telephone Conversation Page 1 of 1
AEA Team Member Other Party
Name: Brian Lawhead Name: Merav Ben-David
Organization: ABR, Inc. Organization: University of Wyoming
Study Area: Project area Phone
Number: (307) 766-5307
Date: 4 December 2012 Time: 11:40 AM
Call Placed by: X AEA Team Other Party
Others on Call: Alex Prichard and Rick Johnson, ABR, Inc.
Subject: 2013–2014 Revised Study Plan for Aquatic Furbearers
Discussion:
Aquatic Furbearers (Section 10.11): Brian, Alex, and Rick called Dr. Ben-David to discuss her suggestions for
potential sampling methods and study design considerations for aquatic furbearers. Rather than using measures
of relative abundance or snow-tracking transects, she favors using noninvasive sampling of sampling of hair
obtained with snags or scats collected from latrine sites for DNA genotyping, combined with capture–recapture
methods, to derive population estimates, which would require an intensive ground-based sampling effort in an
area as large as the Project area. Following the call, she emailed several articles describing various hair and
fecal sampling techniques.
APPENDIX 4
INFORMAL CONSULTATION DOCUMENTATION
SECTION 12 – RECREATION AND AESTHETIC RESOURCES
MEETING RECORD
Record of Meeting Page 1 of 1
AEA Team Member Other Party
Name: Bridget Easley Name: Cassie Thomas
Organization: URS Organization: National Park Service
Study Area: Recreation/Aesthetics/Boating Phone
Number: 907-257-2622
Date: July 25, 2012 Time: 2:30 PM
Meeting held by: x AEA Team Other Party
Others at meeting:
Amy Rosenthal, Louise Kling, and Tim Kramer, URS; John Gangemi, Oasis; Donna Logan and Robert
Koenitzer, McDowell Group.
Subject:
Study coordination, and in-person introductions, as out-of-town team members had assembled in Anchorage.
Discussion:
The study team asked questions about how the NPS views the project; Ms. Thomas’ experiences on
similar projects; and the NPS’ role in hydro projects. Methods for collecting qualitative and quantitative
recreation use data were discussed. Methods for collecting data from widely dispersed recreationists
were also discussed.
Ms. Thomas described a forthcoming (personal) trip to float the Susitna River to become more familiar
with the study area. She agreed to utilize the Incidental Observation form submitted by URS if she
spotted any other recreationists during her trip. The study team was also planning a site visit, so that
was also described.
Ms. Thomas said that she perceives that the quality of recreation opportunities should be
emphasized. This includes attributes such as flow rates preferable for different types of boating, and
sound associated with activities. For example, the sound of rushing water could be a desirable
attribute for whitewater rafters; and silence, a desirable attribute for birdwatching.
Action Item:
Continuing coordination with the National Park Service.
1
Easley, Bridget
From:Cassie_Thomas@nps.gov
Sent:Wednesday, August 01, 2012 10:45 AM
To:Easley, Bridget
Cc:Rosenthal, Amy; Donna Logan; Kling, Louise; hbwillia44@gmail.com
Subject:Re: Thank you and I/O from
Hi everyone,
Our Lower Susitna float trip went very well. Fourteen people participated, from a variety of state and federal
agencies, consultant companies, NGOs, and a local rafting outfitter. We floated about 42 miles. Flows at Gold
Creek ranged from 18,00 to 22,000 cfs during our trip.
We put in at Indian River (M 138.5) the evening of 7/27, having chartered two Mahay's jet boats for our
participants and gear. We spent the night there, then floated down to an island near Lane Creek (M 113.5),
where we camped on 7/28. The following day we floated the rest of the way down to the beach at Talkeetna,
just below the confluence of the Susitna and Talkeetna (M 97). The rafting guide helped us get our boat and
gear off the beach using a four-wheeler and trailer -- Talkeetna lacks good access to the Susitna by vehicle,
having blocked the beach in order to discourage rowdy parties.
The segment of river we floated is Class I, with some mid-channel rocks, rootwads, sweepers, and 2-3' high
standing waves at the flows we experienced. We used an 18' cataraft, three 14' rafts, one 12' raft, and an
inflatable kayak and had no problems avoiding (or enjoying!) these obstacles despite the relatively fast flows
and challenges of reading opaque glacial water. Gravel bars and beaches large enough for our large party to
camp on were available at Indian River and numerous islands from just above Curry all the way down to
Talkeetna. Camping at Gold Creek (AK RR put-in) would have been more challenging due to the narrow
beaches there. Also, the AK RR prohibits passengers from transporting any kind of fuel (white gas, propane, or
small butane canisters), making overnight camping a challenge. Note that this post 9/11 NTSB policy was
successfully modified for the AK RR's Spencer Lake whistle stop on the Kenai Peninsula after USFS
intervened; recreationists would benefit from a similar change in policy for Susitna whistlestops.
One alternative to the put-in we used would have been to go farther upstream to the confluence of Portage
Creek and the Susitna, just downstream from the mouth of Devil's Canyon. This area is not large enough for a
group of 14 to use as a camp, however.
On the put-in day and during most of the next day, we had clear skies, affording us spectacular views of the
Alaska Range as we set off from Talkeetna by jet boat, and also highly attractive views of K'esugi Ridge on RR
for the first several miles of our float. Farther downstream, Curry Ridge on RR and tundra above steeply
forested hillsides on RL also provided visual interest. Unvegetated riprap and shiny-rusted galvanized culverts
(some in poor repair and most perched well above river levels) where the AK RR parallels the shoreline on RL
in many locations detracted somewhat from our aesthetic enjoyment. As we floated the last 12 or so miles to
Talkeetna, aircraft flying relatively low (coming and going from TKA
airport) became more and more common, as would be expected on a Sunday in July.
We saw one young (second year?) cow moose swimming across the river, from west to east, around M 117.
Moose tracks were common on the beaches we stopped at to camp, eat lunch, and rest. We saw no bears and
very little bear sign. There were both wolf and lynx tracks on the island we camped at on 7/28. Bald eagles --
2
juvenile and adult -- were relatively common. We saw one osprey and what we suspected was its nest. There
were a few spawned out salmon carcasses in the river.
We saw Mahay's Devil's Canyon jet boats coming and going on both days of our float (and most of us had been
passengers on this tour on 7/27). We also saw AK RR passenger trains heading in both directions, and heard
what we assumed to be freight trains at night. We saw relatively few other recreational users of the river during
our 2.5 days of observations.
Here's what I recorded on your incidental observation form (I served as the recorder for our group):
7/27/12 1:00 PM Five people (and one dog) shore fishing at Indian
River (M 138.5). Their jet boat was nearby.
7/27/12 1:45 PM Two packrafters floating by on RR in the vicinity
of 4th of July Creek (M 131). These packrafters were later observed
(~5:30) stopped on an island around M 122. We assumed they were camping there that night as they had their
boats pulled pretty far up on the beach but they were still wearing their drysuits and no tents had been set up.
7/27/12 7:00 PM Two men in a jet boat arrived at the mouth of
Indian River as we were eating our dinner. They fished the mouth of the river (clearwater) from their boat and
while wading for an hour or two before travelling downstream about 1/4 mile from our camp where they spent
the night. They were still there when we left at 10 AM the next morning.
7/27/12 8:00 PM A jet boat passed our camp at Indian River heading
upstream. presumably to fish in the mouth of Portage Creek.
We saw no new parties on Saturday or Sunday, apart from Mahay's boats, fish wheel monitoring staff, and Mike
Wood who came down from his house to float alongside us as we traveled the last mile or so back to Talkeetna.
(He was using the river for transportation on this particular trip.)
That's all I can think of for now -- let me know if you have questions. I look forward to seeing many of you
next Wednesday and am grateful that the schedule was changed to allow me to attend the workgroup meeting.
I'll be on vacation from August 9th through the 23rd.
Cassie Thomas
Program Analyst
WASO Park Planning & Special Studies Division AK Coordinator, NPS Hydropower Assistance Program
907 350-4139
11081 Glazanof Dr., Rm 108
Anchorage AK 99507
`·.¸¸.·´¯`·.¸.·´¯`·...¸><((((º>`·.¸¸.·´¯`·.¸.·´¯`·...¸
"Easley, Bridget"
<bridget.easley@u
rs.com> To
"Cassie_Thomas@nps.gov"
07/25/2012 09:51 <Cassie_Thomas@nps.gov>
3
PM cc
"Rosenthal, Amy"
<amy.rosenthal@urs.com>, "Kling,
Louise" <louise.kling@urs.com>,
Donna Logan
<Donna.Logan@mcdowellgroup.net>
Subject
Thank yiou and I/O from
Thank you, Cassie. for coming over to URS G Street today. We met with the BLM and the USFS on this day
also, and we are so impressed with all of the the thoughtfulness, creativity, data, and work, that is going into this
project. URS, McDowell, and Oasis all intend to give this our finest concentration and effort.
The Incidental Observation Form is attached. We are looking forward to the (private citizen) dream-float-team
trip reports!
Bridget
.
This e-mail and any attachments contain URS Corporation confidential
information that may be proprietary or privileged. If you receive this
message in error or are not the intended recipient, you should not retain,
distribute, disclose or use any of this information and you should destroy
the e-mail and any attachments or copies.
[attachment "Recreation Observation Form.pdf" deleted by Cassie Thomas/WASO/NPS]
NPS Preliminary Comments on Proposed Study Plans for Susitna-
Watana Project
These informal comments focus on the three recreation-related study plans released by AEA on
July 15th 2012, i.e., the Recreation Resources, Aesthetics Resources, and Recreational
Boating/River Access study plans.
Overall Comments
Common to all three PSP’s:
- Gap Analyses/PAD: Contrary to the opening language of the three PSP’s, the Gap
Analyses for Recreation and Aesthetics Resources were not included in the PAD and were
made available only after numerous complaints from NPS, other agencies, and stakeholders
shortly before our original comments on the PAD and study requests were due.
- Disciplinary/Study Interdependencies: NPS and others have repeatedly requested AEA
to develop a schedule that ensures coordination between the numerous interdependent
resource studies associated with the Watana project. Of particular interest to NPS are the
recreation and aesthetics studies, which are dependent on the results of other biophysical
resource studies such as the hydrology, instream flow, fluvial geomorphology, ice processes,
fisheries and game studies. Despite these requests, the July 2012 PSPs make only vague
references to the issue. There remains no visible sign that this coordination is being conducted
at a project-wide, discipline-wide level. For example, none of the tables depicting the various
study schedules includes any reference to when the results of the “input” studies will be
available, or how the dependent studies might be modified if these input studies reveal and
need to change the dependent studies’ substantive, temporal or geographic scopes.
Critical Path Method or some comparable project management mechanism should be a key
element of this project, especially with some 58 studies in play, many occurring concurrently.
There should be a transparent process for tracking the critical milestones and progress of the
PSP’s with the interdependencies identified in each study plan. A summary of the overall critical
path schedule should be included as a separate plan, and made available on the project
website for the stakeholders to access.
- Availability of 2012 Study results and schedule: According to the current published
schedule, comments on the July 2012 PSP’s are due on 10/15/12; AEA files revised PSP’s on
11/14/12; comments on the revised PSP’s are due on 11/29/12; and FERC will make final
determination on study plans on 12/14/12. This schedule means that agencies and
stakeholders will not have the results of critical 2012 reconnaissance and baselining studies that
are key to determining the scope and adequacy of the 2013-14 ILP studies before our final
opportunity to comment on the ILP studies. We are being asked to take the Applicant’s word
that if the results of 2012 studies indicate a need to modify the ILP studies, such modifications
will be made voluntarily.
- Socioeconomics – NPS maintains that the metrics and analyses regarding the
socioeconomic costs and benefits of the project should extend beyond the estimated value of
increased recreation and tourism. We recognize that it is less straightforward to determine
some non-market values, e.g. ecosystem services and existence values, than it is to estimate
the future value of commercial tourism in the project area. That does not mean that these non-
market values are zero, however. NPS continues to assert that a full accounting of all project-
related impacts on the social environment must include an estimate of these values. While it
will of course be up to FERC to decide how reliable the various economic value estimates are
(just as the uncertainty associated with the future value of energy production v. project
construction and operation costs must be accounted for), and thus to determine much weight to
give the various types of estimated socioeconomic values in its “equal consideration” analysis,
nowhere does the FPA as amended by ECPA instruct FERC or license applicants to ignore
such values outright, especially in light of emerging valuation methodology.
With respect to Benefits Transfer methodology, this method is most reliable when the reference
and study sites and projects are very similar, and when the economic impact valuation study at
the reference site was performed at the highest standard. Given the dearth of large original
hydropower projects licensed on free-flowing rivers in remote locations in recent decades, NPS
believes it will be challenging to identify an appropriate reference project for Watana. Just as
with ecosystem services valuation methods, there will be numerous assumptions and
approximations associated with application of the benefits transfer method to this project. In
contrast to the lack of appropriate reference sites for a benefits transfer analysis, however, the
value of ecosystem services – including services associated with the Susitna River -- is
currently being studied with some rigor in Mat-Su Borough.
From the “Socioeconomic and Transportation Study, Regional Economic Evaluation Study,” p.
263 of the PSP document:
“The economic impact of the Project on local tourism establishments (e.g., river sport
fishing, whitewater boating) and the regional economy will be estimated using the results
of the Recreation and Aesthetics study. Calculations will be based on information
obtained from the recreation survey, including the estimated recreation-related
expenditures per recreational day or trip and changes in the number of days or trips per
year. The regional economic impact of changes in subsistence-related expenditures due to
the proposed Project will be estimated using the results of the Subsistence study.
Approximate cash expenses to generate each pound of subsistence harvest will be based
on published information (Goldsmith 1998).
In addition, the benefits transfer approach will be used to supplement or compare unit
values (e.g., value per-day of sport fishing) for recreational goods and services obtained
from primary valuation methods. Benefits transfer involves the application of unit value
estimates, functions, data, and/or models from one or more previously conducted
valuation studies to estimate benefits associated with the resource under consideration
(Black et al. 1998). The basis of the method is the assumption that the recreational
experience is enhanced by high quality sites (e.g., clean water, abundant recreational
fisheries), hence the net willingness to pay for, and hence the value of, recreational trips
depends on site quality.
Different model specifications can be used to value specific qualities of the resource and
attributes of the recreational experience. To value these types of amenities, economists
typically rely on a variant of the basic travel cost model referred to as a discrete choice or
random utility model. Whereas basic travel cost models are most appropriate in analyzing
the number of trips people make to a site, random utility models can be used to assess
how people choose between multiple sites based on the qualities of the sites. Travel cost
approaches require data on site visitation, place of residence, substitute sites, and user
characteristics (such as income) (Black et al. 1998). These data will be obtained from the
recreation survey conducted for the Recreation and Aesthetics Study.”
The PSP for Socioeconomics appears to rely largely on results generated through the
Recreation and Aesthetics Resources studies. Having not seen the survey instruments and
protocol, we don’t know how socioeconomic data will be gleaned from those surveys. We would
like to participate in reviewing the proposed survey methodology, ideally before our ability to
comment on the ILP study plans expires.
Section by Section Comments
10. RECREATION AND AESTHETIC RESOURCES
10.1. Introduction
The Alaska Energy Authority (AEA) proposes a Recreation Resources Study, a Recreational
River Flow Study, and an Aesthetic Resources Study in order to document baseline conditions
and help assess potential impacts on recreation and aesthetic resources from construction and
operation of the proposed Susitna-Watana Project (Project). The proposed Recreation Resources
Study has been prepared in consultation with agencies and licensing participants.
The Recreation Resources Study (Section 10.5) will research, describe, and quantify recreation
demand and capacity of facilities, and assess reasonably foreseeable recreation needs associated
with development of the proposed Susitna–Watana Hydroelectric Project.”
NPS – The study is focusing on recreational uses and demand rather than recreational
opportunities and experiences. Need to be qualitative, not just quantitative, because
experiences are likely to change post project. We are relying on the recreation surveys to tease
out qualitative information (quality of experience, preferences, etc.). Without seeing the survey
instruments and protocol, we don’t have assurance that they will be able to characterize these.
10.5. Recreation Resources Study
10.5.1. General Description of the Proposed Study
The Recreation Resources Study is designed to identify recreation resources and activities that
may be affected by the construction and operation of the proposed Susitna-Watana Project
(Project), and to help assess the potential impacts of Project construction and operation on those
resources and activities. The specific goals of the study are to:
Identify and document recreation resources and facilities that support both commercial
and non-commercial recreation in the Project area;
Identify the types and levels of current recreational uses and future reasonably
foreseeable future uses based on surveys and interviews, consultation with licensing
participants, regional and statewide plans, and other data;
Evaluate the potential impacts of Project construction and operation on recreation
resources, needs, and uses in the Project area; and
Use the results of analyses to develop an RMP for the Project.
NPS: Incorporate the results of the 2012 studies
10.5.2. Existing Information and Need for Additional Information
Existing information was compiled in the Recreation Data Gap Analysis (AEA 2011a) and
recreation resource descriptions and inventory presented in AEA's Pre-application Document
(PAD) (AEA 2011b).
NPS - This claim that existing info was compiled in Rec Data Gap analysis and included
in PAD is incorrect. Note that the claim was repeated (cut and paste) in the two other
rec/aesthetic studies. The PAD was filed in December 2011 but we did not receive
AEA’s “2011” gap analysis until March 2012, after much pleading. To our knowledge,
the 2011 publication date for this document is inaccurate since it was not made public
until 2012. There was no project-specific info in the PAD on rec and aesthetics, just a
regurgitation of the scanty, methodologically primitive information developed for a
different hydro project thirty years ago, at a time when FERC did not have to give equal
consideration to these resource values in deciding whether to license a project.
A recreation study was initiated in 2012 to gather data to inform the 2013-
2014 study plan, including the following elements:
— Interviews with key representatives of agencies and organizations, including Alaska
Native entities knowledgeable about regional and state recreation management and issues
— A compilation of existing recreation inventory and capacity information
— An inventory of Project area access
— Incidental Observation Survey Data (completed by field crews)
— Coordination with other study disciplines and incorporation of data
— Geo-referenced mapping
— Field reconnaissance
— Identification of future trends and issues
— A description of the management framework
Available information from the 2012 data gathering efforts will be used to develop the Revised
Study Plan.
NPS- Agencies and stakeholders will not have the results from the “2012 data gathering
efforts” until they are reported out in 11/5/12. We will not be able to incorporate any
comments on them by the 10/15 due date for our PSP comments. It is also unclear how
much of this information AEA and its consultants will have far enough in advance of their
11/14 RSP deadline to help inform the revised plans.
10.5.3. Study Area
The Project area is shown in Figure 1.2-1. The study area includes the Susitna River watershed,
focusing on recreation opportunities and use patterns in and around the immediate Project area.
10.5.4. Study Methods
Both water-based and land-based recreation uses and access will be analyzed. Seasonal uses that
relate to ice and snow conditions will also be analyzed. Specialized study of river flow-
dependent activities will also be conducted, as described in Section 10.7. The Recreation
Resources Study is interdependent with analyses conducted in other disciplines, both biophysical
(e.g., aquatics and hydrology) and social (e.g., transportation and socioeconomics), and
systematic coordination of data with those study groups will be required.
NPS – with respect to interdependent analyses, and the reliance of the rec and aesthetics
studies on results from other disciplines, there is no detail in this PSP explaining how the
timing will work. The schedule table at end of each PSP with study seasons and
deliverables does not mention this, either. We need details of how the sequence will work.
AEA can’t just say it will happen when it does not appear that the results of other studies will
be available before the delivery date for this one.
Methods for the components of the proposed Recreation Resources Study Plan for 2013-14 are
described below.
Regional Recreation Analysis
NPS – This study plan should note, early-on, the distinction with subsistence hunting and
fishing v. sport activities. May be confusing to some stakeholders and readers as the
process goes on.
The regional recreation resources context will be defined in coordination with agencies, technical
workgroups, and other participants, including Alaska Native entities. Regional and local data
related to recreation use will be collected and analyzed, including examination of various land
management regimes within the area. Existing resource management plans relevant to the
recreational resources of the study area will be reviewed and compiled. The analysis will be
conducted in accordance with existing and proposed community and regional plans, and private
sector plans. Plans that will be incorporated include:
NPS - “Existing resource management plans . . . will be reviewed and compiled.” Isn’t this
being done in 2012?
Alaska’s Outdoor Legacy Statewide Comprehensive Outdoor Recreation Plan (SCORP)
2009–2014 (Alaska Department of Natural Resources [ADNR] 2009)
Alaska Recreational Trails Plan (ADNR 2000)
Chase Comprehensive Plan (MSB 1993)
Cultural Resource Management Plan for the Denali Highway Lands (VanderHoek 2005)
Denali State Park Management Plan (Alaska Division of Parks and Outdoor Recreation
[DPOR] 2006)
DPOR Ten Year Strategic Plan 2007–2017 (DPOR 2007)
East Alaska Resource Management Plan (Bureau of Land Management [BLM] 2006)
MSB Comprehensive Development Plan (MSB 2005)
MSB Trails Plan (MSB 2008)
MSB Comprehensive Economic Development Strategy (TIP Strategies Inc. 2010)
MSB Parks and Recreation Open Space Plan (MSB 2000)
South Denali Implementation Plan and Environmental Impact Statement (National Park
Service [NPS] 2006)
Susitna Area Plan (ADNR 1985)
Susitna Basin Recreation Rivers Management Plan (ADNR 1991)
Susitna Matanuska Area Plan (ADNR 2011)
Talkeetna Comprehensive Plan (MSB 1999)
NPS - 2012 info will be used to develop RSP. Will we see this prior to the 10/15 due date
for our PSP comments? If not, how will agencies and the public ensure that the 2012 data
is applied correctly? Timing problem points to larger problem of trying to finalize study plans
for a project before reconnaissance level work is compete. This applies to two other PSPs
(Aesthetics and Instream Recreation), too.
Trails leading into and within the Project area will be identified using aerial imagery. These
include multiple formal and informal trails and routes, several formally identified Revised
Statute (RS) 2477 trails, and Alaska Native Claims Settlement Act (ANCSA) 17(b) trails. The
trails will then be mapped, and “ground-truthed.” This will identify trails that have historical use,
and are legal under State “generally allowed uses,” but have not been named or identified by
ADNR. Management responsibilities for 17(b) easement trails will also be clarified wherever
possible.
Recreation Activity Areas (per SCORP planning) and the Recreation Opportunity Spectrum
(USFS 1979) “primitive” class will also be described as they relate to the study area. Scenic
Byways, Wild and Scenic Rivers (WSR), and other special resource use designations will be
identified and described. There are two river segments within the Project area that have been
identified by BLM as eligible for inclusion into the WSR System: Brushkana Creek and the
portion of the Susitna River from the headwaters to the confluence of Kosina Creek. BLM has
stated that they will conduct a suitability determination for these eligible river segments (Social
Sciences Technical Workgroup Meeting, April 3, 2012). The George Parks Highway between
MP 132 and 248 is designated as an Alaska State Scenic Byway (ADOT&PF 2008; 2012).
Recreation Use and Demand
Currently, the recreation uses of the Project area are widely dispersed. Visitors to the area
participate in a wide variety of activities; including sport hunting, sport fishing, recreational
boating, skiing, snowshoeing, and snow-machining. The amount, extent, and potential impact of
Project-related dispersed recreation use on the proposed Project area’s land and water resources
is currently unquantified.
A baseline of developed and dispersed recreation uses, including types, levels, and access will be
determined and described. High use locations will be identified by activity, along with daytime
and overnight visits, and seasonal patterns. User preferences and opinions about the quality of
recreation resources will also be described. Data will be collected through a literature review and
a comprehensive survey and interview program. Salient existing data will also be incorporated.
Future recreation demand will be estimated, based on socioeconomic indicators, foreseeable non-
Project recreation developments, and identified issues and trends. Effects of the Project features
(e.g., reservoir and access roads) on hunting and trapping opportunities and on non-consumptive
uses (bird-watching, hiking, camping, boating, etc.) in the vicinity and downstream of the
proposed Project reservoir will be assessed. Additionally, the recreation effects of any Project-
induced changes in ice formation the Susitna River will be evaluated. There are also potential
effects of induced recreation along the Denali Highway and downstream from the Susitna River
bridge on the Denali Highway to the proposed Watana Reservoir. The effects of Project
construction and operational activities (e.g. noise, dust, limitations on access, and recreation
activities of construction workers) on recreation will also be analyzed. Recreation demand within
the study will be estimated within the study area in the reasonably foreseeable future.
NPS – AEA needs to analyze effects of project operations, not just “features.” Nowhere in
the PSP is it explicitly acknowledged that the project may have effects on things like fish
abundance (affecting sportfishing opportunities), moose, caribou, waterfowl and upland
game bird populations due to migration barriers and alteration of habitat due to altered
fluvial morphology and riparian vegetation.
Survey results and an inventory of current and projected recreation opportunities, commercial
services, and facilities will inform the Socioeconomic Resource Study in regard to the economic
contribution of recreation in the study area.
NPS - Socioeconomic study needs to determine value of rec., not just contribution to local
economy. This value includes “consumers” outside the local market. AEA needs to expand
their inquiry into alternative socioeconomic methods and models beyond “Benefits Transfer”.
Also see our comment under “Overall Comments.”
Recreation Carrying Capacity
There are no existing developed recreation facilities on the Susitna River at the Watana Dam site.
In the broader Project area, both public and private recreation facilities exist. These are primarily
located along the road system.
The existing physical carrying capacity of recreation resources in the Project area will be
estimated. Public facilities will be inventoried and described as to condition, capacity, adequacy
and operational cost. Private facilities will also be inventoried to the extent practicable. Public
access to recreation sites will also be described, including Americans with Disabilities Act
(ADA) compliance, if appropriate.
NPS –Physical carrying capacity is just one of the four elements of “carrying capacity”
(physical, ecological, social, and spatial). The area’s physical capacity may or may not be
the most limiting, especially if the project results in greater access, which could cause use to
exceed the area’s social carrying capacity. This is one reason why it’s so important to study
the experiential aspect of pre- and post-project recreational use. On rivers in particular,
social capacity is almost always more sensitive than other aspects of capacity, with
concerns about group size and encounter rates; competition for space at put-ins, take-outs
and campsites; and crowding at fishing holes, play boating features, etc.
The need for and capacity of additional reasonably foreseeable recreational facilities will be
forecast. Carrying capacity guidelines and standards will be applied in order to develop
recommendations for future recreation facilities and sites.
Data Collection
The collection of recreation user data will be accomplished through multiple survey processes.
The study design will describe target respondents, geographic locations, target days and months,
and questionnaire content; survey methods, in the context of consultation with agencies,
workgroups, Alaska Natives, and others Survey instruments will be designed to collect
information typical of and compatible with other FERC efforts. This includes the survey
conducted for the 1985 studies (Harza-Ebasco 1985b) and other surveys such as the SCORP
(DNR 2009) and the Alaska Visitor Statistic Program (AVSP) (McDowell 2012).
Identification and Analysis of Salient Data from Existing Survey Research
Recreation supply and demand data from other recreation planning sources applicable to the
region will be synthesized. Existing data can inform estimates of levels (e.g., “recreation days”)
and types of participation in recreation uses. The estimates will include a discussion and
comparison of participation rates in activities regionally, statewide, and nationally. Recreation
trends, as forecast in other studies, will also be described.
NPS – The existing survey research appears to be biased towards “industrial tourism.” This
is not the only population that uses the project area. This analysis needs to capture use by
independent tourists, e.g. people driving up the AK Highway and on to Denali Hwy., and
local (unguided AK resident) users, many of whom are able to access the area without
relying on air taxis or het boat charters.
The AVSP Survey (McDowell 2012) is a statewide research program commissioned by the
Alaska Department of Commerce, Community and Economic Development that included 6,747
visitors to Alaska in the summer of 2011 and 1,361 visitors in the Fall/Winter 2011/2012. The
SCORP (ADNR 2009) survey database will also be used quantify recreation uses and demand. In
addition, Alaska Travel Industry Association research (GMA 2011) about nonresident travel to
Alaska will be reviewed and summarized as it pertains to recreation and aesthetic appeal of
Alaska’s visitor market. NPS– Excludes the Spring season
These data will be utilized to describe year-round nonresident (non-Alaskan) experiences by
visitors in three major communities in the MSB (Palmer, Wasilla, and Talkeetna), passengers on
the Alaska Railroad, and cruise passengers (visiting McKinley Princess Lodge).
The existing data include
Lodging types
Activities
Length of stay
Purpose of trip
Previous travel to Alaska
Modes of transportation used within the State
Trip spending
Communities visited (overall and overnight)
Demographics (origin, age, income, party size)
This nonresident data will be evaluated along with existing data relating to recreation use by
Alaska Resident, in the context of the overall study plan.
Incidental Observation Survey
The purpose of the incidental observation survey is to capture information from field researchers
about dispersed recreational use. The survey will gather information on the date and time of day
the activity was observed, the type of activity observed, number of people recreating, and the
location of observed activity. This survey will not have statistical value, but will help identify
types of recreational use in the study area. A protocol will accompany the survey to inform field
crews how to complete and submit the survey. The survey will be used throughout the study.
Telephone Surveys of Railbelt Residents
The purpose of this survey is to interview a sample of residents about their recreation use in the
area and to collect perspectives about recreational opportunities. The survey will be administered
to a statistical sample of 600-900 randomly-selected Railbelt residents within a four-hour drive
of the study area (Fairbanks, Denali Borough, Mat-Su Borough, and Anchorage). This survey
will be central to the estimation of resident recreation demand. The SCORP survey instrument
will be reviewed for any benchmark questions to be considered in the survey design. The overall
sample size will be refined after considering desired subgroup samples.
NPS – We believe that the Phone survey has very little value. Given the sample size, very
few subjects are likely to be familiar with the project area, and the SCORP questions are too
general to yield useful information about the specific kinds of recreational opportunities in
the area (SCORPs for states as large and geographically diverse as AK are a problem in
and of themselves). Instead we suggest the resources be focused on “executive interviews”
-- use snowball sampling method to find actual users of this area and others like it.
Expecting great cooperation from vendors and outfitters, who are being asked to take the
time and effort to hand over private info on “actual users,” may also be difficult. This
underscores our need to review the survey instruments and protocols ASAP. Even though
the project is unique, such survey templates are fairly standard and should already have
been developed and disseminated to agencies and stakeholders.
The survey instrument design will capture
Past and current recreation use within the study area
Year-round seasonal, and day/night recreation use in the study area
Nature of use or recreational interest, including, but not limited to, fishing, boating,
camping, picnicking, hiking, off-roading, snowmachining, snowshoeing, skiing, horseback
riding, biking, rock/ice climbing, dogsledding, photography, mushroom/berry picking, scenic
touring, wildlife viewing, and hunting
Guided or unguided uses
Recreation preferences (such as pristine, primitive, semi-primitive, or developed)
Expected future recreation use within the study area, including how use may change with
Project development and operational alternatives
Means of access to the study area
Quality of the recreational opportunity
Importance of and satisfaction with current recreation facilities (such as boat launches
and trails)
Attractiveness of the study area for recreational activities
Accessibility and conditions/availability
Visual quality of the scenery in the study area
Distance that users are willing to travel for weekend recreational opportunities
Demographics of household and respondents.
Questions that elicit information central to related disciplines, such as the Regional Economic
Evaluation Study, may also be included.
Intercept Surveys and Structured Observation Visitor Counts
The purpose of these surveys would be to capture specific recreation use data from users
accessing the area by boat, rail, air, snowmachine, or other modes. The survey would be
conducted in person based on a sampling plan that captures peak seasonal uses.
Access points may include, but are not limited to, boat launches (e.g., Susitna Landing, Willow
Creek, Talkeetna, Deshka Landing), railroad whistle stops, trail heads (e.g., East-West
snowmachine trail head on the Parks Highway, along the Denali Highway), air strips, and
campgrounds (e.g., Brushkana Creek).
NPS - Where is the detail on this and other methods? Again, we need to be developing
instruments now, or at least deciding when they will be developed (prior to our last chance
to comment in mid-Oct.).
The survey instrument design would capture, but would not be limited to
Number in party and demographics
Community of residence
Participation in type and location of recreation activity
Rating of quality of recreation experience
Level of satisfaction with facilities/recreation activities, including aesthetics
Guided or unguided use
Past use and intention for future use
Trip expenses
Means of access to the recreation area
Accessibility, conditions, and availability
Other opportunities within same distance that offers similar experiences
Preferences
Interest in potential new recreation facilities and opportunities.
On sample days, the survey crews will observe key characteristics of recreation use (e.g., the
number of people present, the number of vehicles entering/exiting the access site, types of
recreation activities evident) and record this information on pre-printed forms. Users to be
surveyed in person will be selected by availability and willingness to participate.
Executive Interviews
The purpose of the executive interviews is to gather specific information about commercial (e.g.,
guides, tours, etc.) and private recreation use the study area. It is anticipated that between 50 and
70 private sector recreation businesses, associations, and other entities will be interviewed.
These interviews will be conducted by telephone. The executive interview process will be
necessary to develop trust with businesses and organizations with recreation-related interests in
the study area, in order to collect proprietary economic data for use in the Regional Economic
Evaluation Study. The process of developing a list of potential respondents includes the
identification of organizations, associations, government agencies, and businesses with
recreation-related interests in study area. This list will be developed through existing and referred
contacts, internet searches, and interviews. Contacts may include, but will not be limited to
Mat-Su Borough Convention and Visitors Bureau
Federal Agencies, such as BLM, NPS, etc.
State Agencies, such as DNR, Alaska Department of Fish and Game (ADF&G), etc.
Alaska Railroad
Regional governments
ANCSA corporations and tribal organizations
Community councils
Alaska Outdoor Council and other recreation organizations
Alaska Outdoors Bulletin Board
Citizen groups
Environmental organizations
Business representatives to be interviewed may include those associated with
Remote lodges/cabin rentals/accommodations/campgrounds
Restaurants
Airstrips and flying services/flightseeing
Guide services
Whitewater rafting/boat trips
Tour operators (all modes)
Recreational mining operations
Transportation services, including buses and Alaska Railroad
The interview protocol (guide) may include, but is not limited to the following topics:
Nature of business/service (e.g., guide, tour operator, accommodations, etc.)
Employment
Season of operation (e.g., year-round, summer, winter, hunting, etc.)
Means of access to destination (e.g., fly-in, boat, road, etc.)
Specific areas of operation within the study area
Years of operation
Estimated number of clients per year
Client/membership information, including origin, party size, general perceptions of age,
or other demographic features
Fees charged
Ways that use might change under the various operational alternatives identified and
potential impacts on area image, fishing, hunting, and other recreation activities
Past and current plans, programs, business operations, membership, activity, etc.
Geographic areas of highest recreational interest (and reasons why)
Recreation infrastructure used or needed
Identification of any trends (anecdotal and data sources) in recreational use levels or
patterns
Information about other projects proposed in the study area that could directly or
indirectly affect recreation, tourism, or access to the previously inaccessible areas
Suggestions for prioritizing the highest potential recreation demand in the area
Other data needed for socioeconomic baseline or other social science research
GIS Maps and Figures
Recreational sites, facilities, and access routes (RS 2477 rights-of-way, 17(b) easements, and
other recreation use trails) will be identified and digitized in a GIS using existing agency and
licensing participant datasets and aerial photography. These recreation features will be
“groundtruthed” (via ground- and air-based observations) and geo-referenced where possible.
Focus group interviews, discussions with licensing participants, coordination with other resource
study disciplines, and user intercept surveys will augment recreation facilities and trails mapping.
Significant recreation facilities and access points will be photographed for inclusion in the
Recreation Resources Report.
10.5.5. Consistency with Generally Accepted Scientific Practice
The methods and work efforts outlined in this Study Plan are the same or consistent with
analyses used by applicants and licensees and relied upon by the Commission in other
hydroelectric licensing proceedings. The proposed methodology for analysis for demand and
capacity estimates and survey sampling are commonly employed in the development of
hydroelectric project license applications.
10.5.6. Schedule
Upon approval for implementation, it is estimated that the term of the study would be
approximately two years.
Table 10.5-1. Recreation Resources Study Schedule. Description Start Date Completion Date
Data Collection (including seasonal field visits and surveys) January 2013 November 2014
Inventory January 2013 October 2014
Analysis November 2013 November 2014
Initial Study Report December 2013
Updated Study Report December 2014
NPS - Only one December (2013) will be sampled. There is no “wiggle room” should
weather or other conditions render the limited sample seasons inadequate to represent
actual project area conditions. There is no mention of when results of other studies – ice,
morphology, fish and game populations, etc. – will be in hand, and how these results will be
incorporated in the rec study report. See our comment under Overall Comments regarding
interdependent studies.
10.5.7. Level of Effort and Cost
The estimate of the two-year recreation study is $570,000.
10.5.8. Literature Cited
Alaska Energy Authority (AEA). 2011a. Susitna-Watana Hydroelectric Project, Socioeconomic,
Recreation, Air Quality and Transportation Data Gap Analysis. Prepared by HDR, Inc.,
Anchorage.
—. 2011b. Pre-application Document: Susitna-Watana Hydroelectric Project FERC Project
No. 14241. Prepared for the Federal Energy Regulatory Commission, Washington, DC.
Alaska Department of Natural Resources (ADNR). 1985. Matanuska-Susitna Borough Susitna
Area Plan. Alaska Department of Natural Resources, Alaska Department of Fish and
Game and Matanuska-Susitna Borough, Anchorage.
—. 1991. Susitna Basin Recreation Rivers Management Plan. Alaska Department of Natural
Resources and Alaska Department of Fish and Game, Juneau.
—. 2000. Alaska Recreational Trails Plan. Alaska Department of Natural Resources. Division
of Parks and Outdoor Recreation. Juneau, Alaska.
—. 2009. Alaska’s Outdoor Legacy Statewide Comprehensive Outdoor Recreation Plan
(SCORP) 2009-2014. Alaska Department of Natural Resources, Juneau.
—. 2011. Susitna Matanuska Area Plan. Alaska Department of Natural Resources, Juneau.
Alaska Department of Transportation and Public Facilities (ADOT&PF). 2008. George Parks
Highway Scenic Byway Corridor Partnership Plan. Published online at:
http://dnr.alaska.gov/parks/plans/georgeparkshwyscenicbyway.pdf
—. 2012. George Parks Highway Scenic Byway Master Interpretive Plan (in draft).
Published online at:
http://dot.alaska.gov/stwdplng/scenic/assets/DRAFT_Parks_Hwy_MIP.pdf
Alaska Division of Parks and Outdoor Recreation (DPOR). 2006. Denali State Park
Management Plan. Alaska Department of Natural Resources, Juneau.
—. 2007. Alaska’s Division of Parks and Outdoor Recreation Ten Year Strategic Plan 2007-
2017. Alaska Department of Natural Resources, Juneau.
Bureau of Land Management (BLM). 2006. East Alaska Resource Management Plan. U.S.
Department of the Interior, Bureau of Land Management. Glennallen Field Office.
GMA Research Corporation. 2011. Images of Alaska. Alaska Travel Industry Association.
Harza-Ebasco Susitna Joint Venture (Harza-Ebasco). 1985. Pre-Application Document Appendix
4.9-3, Aesthetic Value and Visual Absorption Capability Ratings.
Matanuska-Susitna Borough (MSB). 1993. Chase Comprehensive Plan. Matanuska-Susitna
Borough Planning and Land Use Department, Palmer.
—. 1999. Talkeetna Comprehensive Plan. MSB Planning and Land Use Department, Palmer.
—. 2000. MSB Parks and Recreation Open Space Plan. Matanuska-Susitna Borough Planning
and Land Use Department, Palmer.
—. 2005. Matanuska-Susitna Borough Comprehensive Development Plan. Matanuska-Susitna
Borough Planning and Land Use Department, Palmer.
—. 2008. Matanuska-Susitna Borough Recreational Trails Plan. Adopted March 2000,
Updated August 2008. Matanuska-Susitna Borough Planning and Land Use Department,
Palmer.
McDowell Group, 2012. Alaska Visitor Statistics Program. Alaska Department of Commerce,
Community, and Economic Development.
National Park Service (NPS). 2006. Final South Denali Implementation Plan and
Environmental Impact Statement. U.S. Department of the Interior, Denali National Park
and Preserve, Denali Park, Alaska.
TIP Strategies Inc. 2010. Matanuska-Susitna Borough, Alaska Comprehensive Economic
Development Strategy. Prepared for the Matanuska-Susitna Borough, Palmer.
USDA Forest Service (USFS). 1979. The Recreation Opportunity Spectrum: A Framework for
Planning, Management, and Research. US Department of Agriculture, Forest Service.
VanderHoek, R. 2005. Cultural Resource Management Plan for the Denali Highway Lands,
Central Alaska. Office of History and Archaeology, Division of Parks and Outdoor
Recreation, Alaska Department of Natural Resources, Anchorage.
10.6. Aesthetics Resources Study
10.6.1. General Description of the Proposed Study
The goals and objectives for the Aesthetic Resources Study are to inventory and document
baseline aesthetic (e.g., visual, auditory) conditions in the Project area and evaluate the potential
effects on aesthetic resources, beneficial or adverse, that may result from construction and
operation of the proposed Project.
10.6.2. Existing Information and Need for Additional Information
Existing information was compiled in the Recreation Data Gap Analysis (AEA 2011a) and
recreation resource descriptions and inventory presented in AEA's Pre-application Document
(PAD) (AEA 2011b). A recreation study was initiated in 2012 to gather data to inform the 2013-
2014 study plan, including the following elements:
NPS - There was no aesthetics inventory, as would be understood by that term in 2011-12
as opposed to 1984, in the PAD – nor a gap analysis.
Interviews with key representatives of agencies and organizations, including Alaska
Native entities, knowledgeable about regional and state recreation management and
issues
A compilation of existing recreation inventory and capacity information
An inventory of Project area access
Incidental Observation Survey Data (completed by field crews)
Coordination with other study disciplines and incorporation of data
Geo-referenced mapping
Field reconnaissance
Identification of future trends and issues
A description of the management framework
Interviews with key representatives of agencies and organizations
Assessment of management frameworks for pertinent agencies
Identification of broad Project area viewsheds and preliminary KOPs using those
identified in the 1985 license application
Photography
Field reconnaissance
Description of Project area soundscape
Through the prior processes, the FERC scoping process and incorporation of work group and
other licensing participant recommendations, study methods for 2013-2014 were developed.
Issues, trends, original data collection strategies, and items for detailed analysis are incorporated
into the 2013-2014 Study Plan.
NPS - “Through the prior processes, the FERC scoping process . . . .study methods for
2013-14 were developed [emphasis added]” This is incorrect, they are still being
developed! We find this very strange language to include in a proposed study plan. NPS
has in fact had little time and opportunity to see products and engage consultants so far, so
it is extremely premature to claim this as fait accompli.
10.6.3. Study Area
The overall Project area is shown in Figure 1.2-1. The specific study area for Aesthetic
Resources will be developed as part of the analysis and in coordination with information from
other disciplines, such as hydrology. It will be based on a viewshed model of proposed Project
features, including the dam structure, transmission and road corridors, and the resulting Watana
reservoir. The study area will also include portions of the Susitna River located downstream of
the Watana Dam site down to Talkeetna.
NPS – As NPS and other agencies have noted, deciding to limit the downstream scope of
this and other studies to Talkeetna is totally unfounded. Until we get the results of the
instream flow, ice, fluvial geomorphology, fish, and other studies, no one can say how far
downstream the project’s measurable effects on visual and auditory resources will go. For
example, as previously noted by numerous commenters numerous times, the project’s
proposed, artificially high and variable winter load following flows are highly likely to alter the
formation of stable ice on the Susitna far downstream of the project. Spring flushing flows
and sediment transport may be largely eliminated, and summer flows will be very low, in all
probability leading to major changes in the formation and maintenance of islands, sloughs,
side channels, beaches, and riparian vegetation. Again, no one yet knows how far
downstream of the Talkeetna and Chulitna confluence these major changes will be evident.
All of these altered features will be visible. NPS vehemently disagrees about this premature
decision, which contradicts statements elsewhere in this and other PSPs acknowledging the
need to rely on the results of other studies. We will not have these results prior to 10/15,
when NPS comments must be finalized, or 12/14, when FERC’s determination on SPs will
be made.
10.6.4. Study Methods
The visual resource impact analysis will follow methods developed by the BLM (BLM 1986).
Specific methodology will be augmented with relevant portions of the USFS Visual Management
System (VMS) / Scenery Management System (SMS) (USFS 1995) methods, as consideration of
this approach will be an important aspect of bridging data collected during the 1985 PAD
(Harza-Ebasco 1985) and that collected during the current study effort. It is also expected that
the Visual Sensitivity Analysis will be expanded beyond what is used by the BLM at the
planning level to incorporate surveys, focus groups, and information collected through the
scoping process. Data collection and analysis will be completed across all four seasons. The
Aesthetic Resources Study is interdependent with analyses conducted in other disciplines, both
biophysical (e.g., hydrology) and social (e.g., transportation), and coordination of data with other
study groups will be significant.
NPS – Again, this acknowledges interdependency of this study on results of other studies,
but provides no detail on timing of those deliverables and proposed schedule for finalizing
details of this. See also our comments under “Overall Comments.”
Define Study Area
The preliminary study area identified as part of the 2012 work will be refined based on updated
Project design and siting. The viewshed will be generated for all Project features, including roads
and transmission lines, and refined in coordination with federal, state, and local agencies. The
study area will be sufficient in size to address all established indicators of change, including
potential indirect effects to recreation, cultural resources, subsistence, and socioeconomics. It is
expected that this area will include the Susitna River drainage and upland areas where views of
the basin are expected to change based on construction and/or operation of the proposed Project.
Viewshed models will be developed for pre-and post-Project conditions to depict expected
changes in viewshed areas (i.e., creation of new views, loss of others). The study area will also
include common air transportation routes used for transportation and recreational air tours. Maps
displaying the viewsheds and geographic boundary of the analysis area will be created.
Important views and vistas identified through other resource reviews will be identified and
placed on the viewshed map.
Establish Key Observation Points
A final list of KOPs will be developed using information from the 1985 license application
(Harza-Ebasco 1985), field observations in 2012, ongoing interdisciplinary/interagency
coordination, and Project scoping. It is expected that KOPs will differ by landscape analysis
factors, such as their distance from the Project, predominant angle of observation, dominant use
(i.e., recreation or travel), and average travel speed at which the Project could be viewed. KOPs
may represent views experienced across all seasons or may be specific to a particular season.
NPS - KOPs – Do NPS, other resource agencies and stakeholders get a say on these?
When? This is supposed to be The Plan, not a plan to plan.
Baseline Data Collection
Field data collection will include a combination of site visits by helicopter and travel of upstream
segments of the Susitna River by boat. Additional information describing access, existing
lighting, and movement will be recorded. Baseline photography will be collected at a resolution
sufficient for use in computer-generated visual simulations.
Data on existing aesthetic resource values will be collected using the BLM’s Visual Resource
Inventory (VRI) methodology (BLM 1986). Data collection efforts will include an inventory of
scenic quality, visual sensitivity, and distance zones within the Study Area. All areas will be
evaluated within the context of viewer experiences. For example, views from roadways or from
the perspective of a boater traveling downriver will be established as “linear” or “roving” KOPs.
Data collection methods are described below.
Scenic Quality
Scenic quality of the Project area will be determined through the VRI process (BLM 1986). This
process entails dividing the landscape into Scenic Quality Rating Units (SQRUs) based on
conspicuous changes in physiography or land use and ranking scenic quality within each SQRU
based on the assessment of seven key factors: landform, vegetation, water, color, adjacent
scenery, scarcity, and cultural modification. Each key factor is scored, and the value of each is
added to derive an overall score for the unit. Based on these results, each SQRU is assigned a
scenic quality rating of A, B, or C, with A representing the highest scenic quality and C
representing the lowest scenic quality.
Visual Sensitivity
Viewer sensitivity will be classified using the BLM Visual Sensitivity Level Analysis (SLA)
(BLM 1986). The SLA will be completed in two steps: (1) delineation of Sensitivity Level
Rating Units (SLRUs), and (2) rating visual sensitivity within each SLRU. By definition, SLRUs
represent a geographic area where public sensitivity to change of the visual resources is shared
amongst constituents. The unit boundaries may be defined by a single factor driving the
sensitivity consideration, or factors driving sensitivity may extend across numerous SLRUs.
Units are thus derived, in part, by the consideration of factors analyzed in the SLA. Visual
sensitivity within each SLRU is estimated as high, medium, or low, based on the types of users,
amount of use, public interest, adjacent land use, and land use designations. Information required
for this analysis will be obtained through land use plan review, data collected by other resource
disciplines, and surveys and/or focus groups. The data collected through surveys and focus
groups will be coordinated with the set conducted for the Recreation Resources Study.
Respondents will be asked about their place-based visual preferences.
Visual Distance Zones
Distance zones represent the distance from which the landscape is most commonly viewed.
These zones will be established by buffering common travel routes and viewer locations at
distances of 3 miles, 5 miles, and 15 miles using GIS (BLM 1986).
NPS - There is no mention of assessing the aesthetics of varying flows. This is a high
volume glacial river flowing at up to 25 mph – the sight and sound of its flows, color of its
water, mixing at clear water tributaries are major components of river-related recreation.
Need to do this at KOPs along the river, in all seasons, using videography (sound). Need to
add to Sound analysis, too.
Photo Simulations
To support the visual resource impact analysis and to disclose expected visibility of Project
components from various vantage points, photo simulations will be prepared. Simulations will be
produced by rendering Project components (turbines, substations, access roads, etc.) with 3-
dimensional (3D) computer models and superimposing these images onto photographs taken
from KOPs. Model parameters will account for environmental factors, such as seasons, viewing
angle, and light conditions, resulting in an accurate virtual representation of the appearance of
the proposed Project. Simulations will be produced to illustrate (1) the structure, (2) downriver
landscape characteristics, (3) reservoir landscape characteristics, (4) access roads and
transmission lines, (5) views of reservoir from upland areas, and (6) views of potential
construction-related impacts. Additional simulations and/or videography will be produced as
needed in key areas. Simulations will be completed by seasons and under daylight and nighttime
conditions.
Visual Resources Analysis
BLM contrast rating procedures will be used (BLM 1986). The visual resource impact analysis
focuses on established indicators of change. Indicators will include, but will not be limited to, the
following:
Impacts to visual resources, measured by the degree of visual contrast created by the
Project
Change in existing VRI values of scenic quality, visual sensitivity, and distance zones
Introduction of new sources of light and glare
Change in the viewshed area, including both the elimination and creation of views and
vistas
Change in the mechanism of view (e.g., transition from mobile view traveling downriver
to a static view when situated on the reservoir)
Change in visibility that may result from Project-related dust
Methodology used to address each indicator is described below.
Contrast Rating Analysis
The BLM Contrast Rating procedure will be used to determine visual contrast that may result
from the construction and operation of the Project based on photo simulations depicting Project
features. This method assumes that the extent to which the Project results in adverse effects to
visual resources is a function of the visual contrast between the Project and the existing
landscape character. Impact determinations will be based on the identified level of contrast and
are not a measure of the overall attractiveness of the Project (BLM 1986).
At each KOP, Project features will be evaluated using photo simulations and described using the
same basic elements of form, line, color, and texture used during the baseline evaluation. The
level of perceived contrast between the proposed Project and the existing landscape will be
classified using the following definitions:
None: The element contrast is not visible or perceived.
Weak: The element contrast can be seen but does not attract attention.
Moderate: The element contrast begins to attract attention and begins to dominate the
characteristic landscape.
Strong: The element contrast demands attention, would not be overlooked, and is
dominant in the landscape.
The level of contrast will be assessed for all Project components used during construction,
operations and maintenance, and decommissioning of the proposed Project.
Visual Resource Inventory Analysis
The VRI analysis will be used to identify expected change to VRI classes based on changes to
the visual resource values of scenic quality, visual sensitivity, and/or distance zones that may
result from operation of the proposed Project. This analysis will be completed within the
framework study area, with the goal of understanding how visual resource values and resulting
VRI class may shift based on operation of the proposed Project (including the dam, access roads,
and transmission lines). Impacts to VRI components will be evaluated by ranking each key factor
used to classify scenic quality, visual sensitivity, and distance zones under operational
conditions, and comparing those values to that determined through the established pre-Project
VRI.
Light and Glare
The impact analysis for light and glare will focus on potential impacts that may result from
nighttime artificial lighting and/or daytime glare. The analysis of artificial lighting will identify
potential impacts to human activity at nearby off-site locations that may result from the proposed
Project. Photo simulations will be produced to demonstrate views of the proposed Project at
night from selected KOPs.
Change in Viewshed Area and Mechanism of View
Viewshed analysis performed for both pre- and post-Project conditions will be compared to
identify the changes in viewshed and mechanism of view. These data will quantify the extent of
changes in views, and the degree to which access to views changes with the development of
roads and the elevation of the viewer within the inundated portions of the reservoir.
Change in Visibility
Data generated by the Air Quality Resource discipline will be used to determine the potential for
changes in visibility that may result from construction and/or operation of the proposed Project
and related recreation resource values. Results from the air quality dust analysis will be
incorporated in this study.
Sound Analysis
A systematic sound study will be conducted to characterize the existing ambient sound
environment in the vicinity of the proposed Project and estimate the potential impact associated
with construction and operational activities.
The steps in the sound analysis are described below.
Review Documentation and Develop Data Needs
Relevant Project data will be reviewed, including the most current Project description, operating
and construction equipment rosters, construction schedules. Ambient sound data recorded in the
area or in a similar area will be obtained. Based upon this review, itemized data requirements
will be developed that would be needed to perform predictive sound emission modeling. Based
on this review a set of outdoor ambient sound level surveys in the vicinity of the Project area will
be obtained. The data requirements will include anticipated categories of stationary and mobile
construction equipment and their frequency of operation, locations of nearest representative
noise-sensitive receivers (NSR), recreation sites (RS), and sound data or specifications
associated with intended operating dam systems and processes. Laws, ordinances, regulations,
and standards that may influence the sound impact assessment for this study will also be
inventoried.
Seasonal Surveys of Ambient Sound Levels
Ambient sound level measurements will be collected in the Project vicinity. These will include
unattended long-term ([LT]”, a minimum of 24 continuous hours, up to a single week) sound
level monitoring at up to a total of four representative NSR or RS locations and up to a total of
16 attended short-term ([ST], e.g., 15-20 minutes duration each) daytime and nighttime sound
measurements to help characterize the affected environment. Observations of perceived and
identifiable sources of sound contributing to the ambient sound environment and the conditions
during which they occur will be documented as part of the field survey. This survey will be
conducted up to four times, associated with up to four distinct seasons (e.g., summer, fall, winter,
spring) but for a minimum of two seasons consistent with NPS Natural Sounds Program (NSP)
published guidelines (NPS 2012). To the extent practicable, the survey locations will be the
same for each surveyed season.
NPS - When do we decide where the four LT and 16 ST locations will be? What if we think
there should be more? Again, need to agree about this prior to 10/15/12. NPS would like to
have enough advance detail to involve our Soundscapes staff in reviewing this
methodology.
Modeling of Project Sound Levels.
Up to three scenarios or alternatives of future Project operational sound levels will be estimated
with System for the Prediction of Acoustic Detectability (SPreAD). Computer Aided Noise
Abatement (CADNA/A), an industry-accepted outdoor sound propagation modeling program,
could also be used (Sound Advice Acoustics Ltd, 2012). Predicted sound level isopleths or
“sound contours” will be superimposed on suitable aerial photographs or maps of the Project
vicinity and will include specific sound level prediction at selected measurement and/or
assessment locations from the ambient sound field surveys of Task 2. Predicted sound emissions
associated with both Project construction and operation using different transportation route
options will also be assessed.
GIS Maps and Figures
Viewsheds, KOPs, and soundscapes will be mapped as GIS layers according to Project
standards. Mapping will also identify relevant management standards within the study area.
Significant visual features will be photographed for inclusion in the Aesthetic Resources Report.
Visual simulations depicting the appearance of the proposed Project will be produced for a
subset of KOPs, and used to inform the impact analysis.
10.6.5. Consistency with Generally Accepted Scientific Practice
The methods and work efforts outlined in this Study Plan are the same or consistent with
analyses used by applicants and licensees and relied upon by the Commission in other
hydroelectric licensing proceedings. The Aesthetics studies are based on the BLM’s visual
resources methodology. The sound analysis is consistent with National Park Service Guidelines.
10.6.6. Schedule
Upon implementation, it is estimated that the term of the studies will be approximately two
years.
Table 10.6-1. Aesthetic Resources Study Schedule. Description Start Date Completion Date Duration
(months)
Data Collection(including seasonal field visits and sound monitoring) January 2013 November 2013 11
Inventory January 2013 October 2013 10
Initial Study Report October 2013 December 2013 3
Analysis November 2013 March 2014 5
Updated Study Report April 2014 December 2014 8
NPS - very short, and no work in any December. Initial study report is scheduled for 12/13 –
will this allow integration of results of other biophysical studies?
10.6.7. Level of Effort and Cost
The estimate of $500,000 includes the following components over two full years of study.
10.6.8. Literature Cited
AEA (Alaska Energy Authority). 2011a. Susitna-Watana Hydroelectric Project, Socioeconomic,
Recreation, Air Quality and Transportation Data Gap Analysis. Prepared by HDR, Inc.,
Anchorage.
—. 2011b. Pre-application Document: Susitna-Watana Hydroelectric Project FERC Project
No. 14241. December 2011. Prepared for the Federal Energy Regulatory Commission,
Washington, DC.
Air Resource Specialists (ARS). 2012. Win Haze Modeling Software. Published online at
http://vista.cira.colostate.edu/improve/Tools/tools.htm. Accessed 6/18/12.
Bureau of Land Management (BLM). 1986. Visual Resource Inventory. BLM Handbook 8410-1.
Washington, D.C.
Harza-Ebasco Susitna Joint Venture (Harza-Ebasco). 1985. Pre-Application Document Appendix
4.9-3, Aesthetic Value and Visual Absorption Capability Ratings. Prepared for the Alaska
Power Authority. Anchorage, Alaska.
National Park Service (NPS). “In the Field.” 2012. Published online at
http://nature.nps.gov/sound/field.cfm. Accessed 6/17/2012.
Reed, S.E., J.L. Boggs and J.P. Mann. 2010. SPreAD-GIS: an ArcGIS toolbox for modeling the
propagation of engine noise in a wildland setting. Version 2.0. The Wilderness Society,
San Francisco, CA. U.S. Department of the Interior, National Park Service, Alaska
Regional Office. March 7, 2012.
Sound Advice Acoustics, Ltd. 2012. “CADNA Prediction Software.” Published online at
http://www.soundadviceacoustics.co.uk/prediction_software.php. Accessed 06/18/12.
TIP Strategies Inc. 2010. Matanuska-Susitna Borough, Alaska Comprehensive Economic
Development Strategy. Prepared for the Matanuska-Susitna Borough, Palmer.
USDA Forest Service. (USFS) 1974. The Visual Management System. Agriculture Handbook
Number 462.
—. 1995. Landscape Aesthetics: A Handbook for Scenery Management.
10.7. Recreational Boating / River Access Study
NPS– Consider changing the title of this study to “Flow Dependent Recreation,” reflecting
the broader affected activities beyond boating and fishing. The Study’s title and some initial
statements about scope are contradictory. Study goal is not merely to contribute data
concerning recreational boating and access – it is to look at all forms of flow-dependent rec.
That would include activities like fishing that are affected by flows (e.g. if salmon disappear
because no more spawning habitat, or if you can’t ski, mush, or snow machine the river
anymore due to unstable ice) regardless of whether you’re doing it in a boat or from shore.
NPS - Aesthetics can be flow dependent (stillwater in res. v. free-flowing stream, lost sight
and sound of whitewater at high flows in DC, morphological and vegetation changes
downstream due to changed flow regime). There is no mention of this in this or the
Aesthetics PSP.
NPS – There is also no mention of whether impacts on rec access and experiences due to
changed ice and snow cover resulting from changed flow regime will be assessed under this
PSP. It should be included.
10.7.1. General Description of the Proposed Study
This study incorporates and contributes to data and analysis conducted as part of the Recreation
Resources Study (Section 10.5). In the overall recreation study, recreational boating uses and
river access points will be identified. Current and future use of the river by both motorized and
non-motorized boat users will also be estimated therein. Because the Project will affect river
flow regimes, including the inundation of about 39 miles of the river, and because changes in
river flow regimes may directly impact boating and other flow-dependent recreation activities, a
specific methodology of recreational flow analysis is also proposed.
Study Goals and Objectives
The goal of the Recreational Boating / River Access Study is to contribute data to the
Recreation Resource Study concerning recreational boating and access.
The goal and objective of the study is to contribute to the Recreation Resource Study concerning
the relationship between river flows and recreation opportunities and uses, by:
developing flow preference curves for each major river reach by type of use and
equipment; NPS: Doubt you can develop a preference curve for winter activities that require
stable river ice. It will either be present or absent. What method will be used to assess this
effect?
describing the potential effects of altered river flows on existing and potential boating
activity and other recreational uses of the Susitna River; and
describing any new boating or other flow-dependent recreational opportunities that may
be created by Project construction and operation.
10.7.2. Existing Information and Need for Additional Information
Existing information was compiled in the Recreation Data Gap Analysis (AEA 2011a) and
recreation resource descriptions and inventory presented in AEA's Pre-application Document
(PAD) (AEA 2011b). A recreation study was initiated in 2012 to gather data to inform the 2013-
2014 study plan, including the following elements:
— Interviews with key representatives of agencies and organizations, including Alaska
Native entities, knowledgeable about regional and state recreation management and
issues
— A compilation of existing recreation inventory and capacity information
— An inventory of Project area access
— Incidental Observation Survey Data (completed by field crews)
— Coordination with other study disciplines and incorporation of data
— Geo-referenced mapping
— Field reconnaissance
— Identification of future trends and issues
— A description of the management framework
— compilation of existing baseline boating recreation information and access;
— hydrology data review;
— field reconnaissance and photography;
— identification of future trends and issues; and
— description of the management framework and special river designations.
— compilation of existing baseline boating recreation information and access;
— hydrology data review;
— field reconnaissance and photography;
— identification of future trends and issues; and
— description of the management framework and special river designations.
Available information from the 2012 data gathering efforts will be used to develop the Revised
Study Plan.
Through the consultation events including the FERC scoping process and work group meetings,
other licensing participant recommendations including input on study methods were used for
development of the 2013-2014 study plans.
10.7.3. Study Area
The reaches of the Susitna River, shown in Figure 10.7-1, will be subdivided into smaller units
as a result of physical studies in other disciplines and field observations conducted in the
Recreational River Flow Study. Areas of concentration will include areas where the proposed
reservoir would create the most flow changes.
NPS – We do not understand the statement: “areas where the proposed reservoir would
create the most flow changes.” What is the threshold for “most”? Who decides? When?
Even assuming consensus on the standard to be used, how can this decision be made
before the results of the instream flow, flow routing, ice processes, etc. studies are in hand?
What if we and others disagree with AEA’s geographic scope decision? This needs to be
nailed down by 10/15/12.
The Recreation River Flow Study will focus on those reaches of the Susitna River directly
affected by the Project. These include the section of river that would be inundated by the
proposed reservoir, Devils Canyon, and the reach downstream of Devils Canyon to the
confluence with the Talkeetna River.
NPS - Again, it is totally unfounded for AEA to arbitrarily stop at Talkeetna River. This
contradicts prior commitments to rely on the results of other studies to inform impacts on
recreation. Those studies will not be completed for several years.
10.7.4. Study Methods
The Recreation River Flow Study is interdependent with analyses conducted in other disciplines,
especially physical (e.g., hydrology) and social (e.g., transportation), and input of data from
those study groups will be significant.
This Study is designed to identify the minimum and optimum instream flow needed for
motorized, non-motorized, and whitewater boating, as well as other flow-dependent recreational
activities, on the Susitna River.
Using accepted practices for recreational flow study design, as described in Whittaker et al.
(1993, 2005), a progressive sequence of levels of study will be undertaken. These include: Level
1, desktop analysis; Level 2, limited reconnaissance; and Level 3, intensive field studies. This
process maximizes study efficiency by characterizing recreation activities for respective river
segments in the desktop phase, confirming assessments in the reconnaissance phase, and then
focusing intensive field studies to those activities and river segments warranting detailed study
and analysis. This process also contributes to early identification of potential Project effects and
user conflicts, and information needed to evaluate potential Project effects on river-based
recreation.
Level 1: Desktop analyses integrate existing information about channel characteristics,
hydrology, river recreational opportunities, access points, and flows in order to determine what
recreational boating resources are present that could be affected by the potential Project.
Level 2: Reconnaissance efforts gather first-hand information on the river resource, types of
recreation opportunities, and associated attributes as well as the recreational user groups
accessing the river. The reconnaissance also provides valuable information on access sites,
logistics, travel to and from the site, local resources and people, and, lastly, potential safety
concerns. Motorized and non-motorized watercraft may be used during the reconnaissance to
better understand recreation opportunities on the river.
Level 3: Intensive field studies will document the existing flow-dependent recreation
opportunities (motorized and non-motorized watercraft) and the associated attributes for the
respective opportunities, and will quantify the flow preferences (minimum acceptable and
optimum) for each opportunity. This is done through a combination of field observations,
interviews with licensing participant groups, focus group sessions, and an instream flow
recreation survey targeting recreation opportunities for a given river segment. The survey work
will be conducted in coordination with surveys associated with the overall Recreation Study.
NPS – Again, this underscores why we need to see the proposed survey instruments,
protocol, etc. to determine if the Rec Survey adequately addresses these issues.
Elements of recreational boating flow research include:
Data collection - Water recreation attributes for discrete sections on the Susitna River
will be described, including types of river recreation, reach length, gradient, character,
whitewater difficulty classification, and recommended range of flows for respective
recreation activities. Activities will be identified by type of motorized and non-motorized
water craft, including whitewater kayaks and packrafts; commercial and non-commercial
uses; and trip purposes, trip length, frequency of use, and seasonal considerations.
Reconnaissance – River recreation opportunities and associated instream flow attributes
will be observed and described. Existing and potential sites for recreational boating
access along the river corridor and the area inundated by the proposed reservoir will also
be described.
Consultations - Boaters, land and resource managers, guides, user groups and others will
be interviewed to determine the types and locations of boating activity occurring on the
Susitna River. Interviews will be conducted with boaters and other experts with
experience on the Susitna River to determine a range of conditions generally acceptable
to various types of watercraft and skill levels.
Consultation methods include the following:
Interviews will be conducted with river recreation users with previous experience on the
Susitna, including motorized, non-motorized, and whitewater boaters.
Focus group sessions will contribute additional information about flow preferences,
recreation use patterns for respective reaches and groups, whitewater difficulty, safety,
campsites, significant rapids, and recreational access. The focus group sessions will be
coordinated with national, regional, or local water recreation clubs.
Outcomes of the process include the following:
Motorized and non-motorized boating opportunities and associated attributes for the
range of flows will be examined. This includes, where applicable, the level of whitewater
difficulty, portage requirements, length of trip, and characterization of experiences.
Includes tourism boating up to Devils Canyon.
Flow preference curves for each reach will be developed for respective river recreation
opportunities.
The frequency for the range of preferred flows for respective opportunities will be
quantified for existing conditions and likely proposed Project operations.
Put-in and take-out sites and related needs (e.g., scouting and remote camping) that may
be associated with respective recreation opportunities in a particular river segment will be
identified.
10.7.5. Consistency with Generally Accepted Scientific Practice
The methods and work efforts outlined in this Study Plan are the same or consistent with
analyses used by applicants and licensees and relied upon by the Commission in other
hydroelectric licensing proceedings. The proposed methodology is often used in analysis for
development of hydroelectric license applications to fulfill the FERC’s Exhibit E requirements
for documentation and development of mitigation measures for flow dependent recreation.
10.7.6. Schedule
Upon implementation, it is estimated that the term of the studies will be approximately two
years.
Table 10.7-1. Recreational Boating / River Access Study Schedule. Description Start Date Completion Date Duration
(months)
Data Collection (including seasonal field visits and consultations) January 2013 November 2013 11
Inventory January 2013 October 2013 10
Initial Study Report December 2013
Analysis November 2013 March 2014 5
Updated Study Report April 2013 December 2014 8
NPS - No information about when/how the Level 1-3 analyses fit in with this schedule.
Much of this study plan appears to have been cut and paste from the NPS/OSU guide,
without an explanation of how the methods will be applied to this particular project. We
need specifics and an agreement on who makes mid-point decisions to proceed, e.g., from
Level 1 to 2, or 2 to 3, based on what criteria.
NPS - There is only one winter and one summer of study, and no Novembers or
Decembers. This does not indicate a sincere concern for impacts on winter recreation.
Arguably, AK’s winter rec season is longer than its summer season. It is certainly important
to users, as well as purveyors of equipment (e.g. snow machines) and the local economy.
One year of study is also not an adequate sample size to support conclusions about
important flow-dependent activities like sportfishing and float hunting. Note the emergency
Chinook closure this year – how can you study the most sought-after fish species in SC AK
if harvest is prohibited during the only year of study? Likewise, the upland game hunting
season is dependent on variable weather etc. – one season is just not enough to document
baseline opportunities and experiences when they are dependent on highly variable
interannual conditions.
10.7.7. Level of Effort and Cost
The estimated cost of the two-year study is $100,000.
10.7.8. Literature Cited
AEA (Alaska Energy Authority). 2011a. Susitna-Watana Hydroelectric Project, Socioeconomic,
Recreation, Air Quality and Transportation Data Gap Analysis. Prepared by HDR, Inc.,
Anchorage.
—. 2011b. Pre-application Document: Susitna-Watana Hydroelectric Project FERC Project
No. 14241. December 2011. Prepared for the Federal Energy Regulatory Commission,
Washington, DC.
Harza-Ebasco Susitna Joint Venture (Harza-Ebasco). 1985. Susitna Hydroelectric Project
Recreation Survey Report. Prepared for the Alaska Power Authority. Anchorage, Alaska.
Reed, S.E., J.L. Boggs and J.P. Mann. 2010. SPreAD-GIS: an ArcGIS toolbox for modeling the
propagation of engine noise in a wildland setting. Version 2.0. The Wilderness Society,
San Francisco, CA. U.S. Department of the Interior, National Park Service, Alaska
Regional Office. March 7, 2012.
Whittaker, D., B. Shelby, W. Jackson. 1993. Instream flows for recreation: a handbook on
concepts and research methods. U.S. Department of Interior, National Park Service
Rivers and Trails Conservation Program, Oregon State University, and National Park
Service. Water Resources Division.
Whittaker, D., B. Shelby, and J. Gangemi. 2005. Flows and recreation: a guide to studies for
river professionals. Report for Hydropower Reform Coalition and National Park Service
– Hydropower Recreation Assistance.
1
Easley, Bridget
From:Harry Williamson <hbwillia44@gmail.com>
Sent:Tuesday, August 14, 2012 1:46 PM
To:Bob Koenitzer
Cc:Cassie Thomas; Easley, Bridget
Subject:Review of Boundary Project Recreation Study Report
Bob, Again, thanks for directing me to the final recreation study report for Boundary. I have discussed this
project and their consultants' approaches with Susan Rosebrough of our Seattle office. She represented NPS
during those proceedings. Susan and I had worked with EDAW and Tetra Tech on various projects in our
region and consider their work to be good. I'm pleased that McDowell Gr. is using the Boundary project
approach for the user survey effort for several reasons.
- They recognized the utility of employing various survey methods to support a number of other elements of
the recreation studies such as the regional recreation analysis, dispersed recreation use, access, and future
recreation use analysis. Similarly, the surveys will also inform other areas currently included in the "Social
Sciences Studies" such as transportation and socio-economics in Watana.
- Importantly, at the City of Seattle's (licensee) urging, the recreation studies were developed and implemented
in a highly collaborative fashion. Numerous meetings were held with agencies and stakeholders once the initial
proposed study plans were issued and leading up to acceptable revised study plans. This included involvement
in developing the field surveying program, sampling methods, and even decisions on locations, frequency, level
of effort, etc. It was clearly a deliberate, iterative process. Since Boundary was also conducted under FERC's
ILP this demonstrates the value of a proactive, collaborative approach.
- Boundary is somewhat similar to Watana in that recreation around the project is highly dispersed and the
population centers were limited. They used active user surveying as well as more passive means such as: visitor
registries at key facilities, interviews with providers, questionnaires to local residents (via mail), and focus
groups. I think that these are all techniques that are applicable to Watana.
The only other FERC proceeding that we've been involved in recently for an original license is Bear River
Narrows in Idaho (FERC # 12486). Although much smaller scale than Watana, I'll take a look at the user
survey approach used there. In reviewing various other recreation studies from other projects, I'm seeing a great
deal of homogeneity and generally things that are reflected in Boundary's. That is to be expected since they
were relatively routine relicensings and many of the studies were conducted by a handful of qualified
consultants at the time. I guess that these could be considered "off-the-shelf" and but they do represent
established, accepted methods. So I agree that there is no need to reinvent the wheel, but there will certainly be
a great deal of site-specific adaptation given the uniqueness of Watana.
Cassie Thomas returns to Anchorage in another week. I should be available until, and after, she returns. So,
again, we would appreciate the opportunity to confer and review any preliminary materials as they become
available.
Thanks, Harry
MEETING RECORD
Record of Meeting Page 1 of 1
AEA Team Member Other Party
Name: Bob Koenitzer Name: Rebecca Schwanke
Organization: McDowell Group Organization: ADF&G Wildlife Biologist, Glennallen
Study Area: Recreation Resources 10.5 Phone
Number: 474-6926
Date: 8/21/2012 Time: 2:00 PM
Meeting held by: AEA Team X Other Party
gMMcDowell
Others at meeting: None
Subject:
Recreation surveys
Discussion:
Extensive discussion of the availability and level of detail for hunter effort and harvest in GMU 13.
Action Item:
NPS Comments on 9/20/12 Draft Survey Instruments and Methodology
Summary of Recreation Resources Survey Methodology
A. Study Area Definition
NPS contends that changes in flows, sediment transport, and ice formation could likely result in
significant changes in post-construction recreational opportunities downstream of Talkeetna. Thus
baseline boating , fishing, and winter use of the Susitna River corridor from Talkeetna to its mouth needs
to be assessed in order to determine the project’s impacts on recreation and aesthetics. We believe the
FERC will need this information in order to balance the power and non-power uses of the Susitna River
in its licensing decision, and NPS will also need it in order to develop appropriate Section 10(a)
recommended terms and conditions for the license. Only if studies of the river’s post-project flows,
morphology, ice processes, fish habitat, etc. determine that there will be a negligible effect on relevant
biophysical conditions in the river corridor downstream of Talkeetna should the recreational and
aesthetics study areas be restricted to the river corridor upstream of the confluence with the Talkeetna
and Chulitna rivers.
C.1 Access Points
In NPS’s opinion, study efficiency could benefit if resources were reprogrammed away from certain
areas along the Richardson and Glenn highways, e.g. Chickaloon, Sourdough, and Paxson Lake. This
would presumably help keep study costs in line while including summer and winter access points
downstream of Talkeetna. If the goal of intercepting Chickaloon area residents is to sample subsistence
activities, this effort is more appropriate under the Subsistence survey.
The description of access points along the Parks Highway leaves the impression that Talkeetna is on the
Parks. It might be better to say that it runs past the Talkeetna Spur Road.
Fixed Wing Aircraft
Will any effort be made to intercept private aircraft at Talkeetna airport? If not, why not, in light of
planned intercepts at Willow airport and float plane dock?
3. Survey Content
While the Boundary project surveys provide a useful template for the Watana, the crucial difference
between these two projects must be keep in mind. Boundary project area visitors were, for example,
asked about the quality of their recreational experiences, whether there was over-crowding, and
whether project facilities and services were adequate. Better questions to capture baseline recreational
resource conditions in the Watana study area would focus more on the recreational experiences
currently being sought by visitors to the area, in terms of attributes like remoteness, solitude, self-
reliance, low encounter rates, absence of “combat fishing” atmosphere, etc. Instead of asking about
the adequacy of existing facilities and services – none of which are provided by AEA – better questions
for capturing pre- and post-project differences would endeavor to assess demand for potential new
facilities such as reservoir-based fishing, serviced campgrounds, maintained trails, a hut system, etc. It is
also important to determine whether some current visitors to the area might go elsewhere if the project
significantly changed the recreational character of the area.
AEA proposes to collect party size information to inform the “shared expenses” portion of the
economics study. Party size is an important recreational use parameter in its own right (e.g. it helps
characterize visitor experience), so this information should be collected early in the intercept survey.
While the basic structure of the intercept survey will likely work as an online survey, some elements will
need revision, e.g. we suggest that the “don’t know” and “refused” options be deleted from each
question.
D. Mail and Online Survey
By surveying only registered voters, the sample will be somewhat skewed in terms of demographics.
Younger visitors are less likely to be registered in Alaska, as are military members and their dependents.
Snowbirds may also be registered in another state, even if they own property in or near the study area.
Is it possible to use power utility customer lists to generate a random sample? DMV records may also
yield a less biased sample population.
Contingency plan: Does AEA have a plan for gathering recreation and aesthetics resource information if
the study area is affected by floods, other unusual or extreme weather, wildfires, earthquakes, road or
railroad closures, etc. during critical survey periods? Or if the Susitna is subject to additional emergency
Chinook sportfishing closures? These factors can have a drastic effect on the number of recreational
users who want to or are able to access the study area. The study plans should include a detailed
strategy for altering survey methods and/or extending the study period in the event the study area is
affected by these forces beyond AEA’s control.
AEA proposes to reduce intercept survey frequency (fortnightly instead of weekly) to save money, if a
sufficient sample size can otherwise be ensured. NPS believes that AEA should also consider
reprogramming its survey efforts as the season progresses in order to respond to unforeseen weather,
access, and regulatory conditions.
Executive Interviews
Project description: NPS thinks it would be helpful to provide more information for interview subjects
about the project’s possible effects on recreation and aesthetics. Many non-specialists have no context
for the study area, and the project’s footprint will be more than just a high dam and a large reservoir.
Before the project’s final operations are determined (e.g. habitat maintenance, sediment flushing, and
ramping flows, which subtract from the volume of water available to make power), and before total
project costs are known, NPS feels it is inappropriate to tell survey subjects that the project will “meet
nearly 50% of the Railbelt’s electrical demand.” The goal of the executive interviews is to gather more
information about baseline conditions and potential project effects, not to “sell” the project to
recreationists.
NPS suggest adding to the executive survey intro a brief description of the new road, new powerline,
changes in natural flows downstream of the dam, potential changes in snow and ice cover, etc.
As with the intercept survey, it would be useful to learn more about the kinds of recreational experiences
executive survey subjects seek in the project area.
“Day use areas” could be added to examples of new facilities in Q. 7.
Survey subjects: based on the 9/20 meeting, it appears that members of paddling clubs as well as highly
skilled kayakers who have run Devil’s Canyon will be surveyed – good.
Northern Economics Survey Request
NPS was encouraged to hear about the RUM approach to monetizing the value recreation in the project
area. However, we disagree with the assumption that the project will lead to “increases in visitation.”
Some kinds of baseline project area uses will likely decrease post-project, e.g. hunting in the area
inundated by the reservoir, floating the upper Susitna downstream from the Denali Highway, and
potentially activities dependent on the existing amount of fish habitat and existing extent and duration
of stable winter ice cover.
Recreational activities that will likely be affected by the project also include kayaking and ATV use.
Intercept Survey
We recognize the need to keep the length of this survey short enough that subjects will agree to
complete it. Some of the questions seem more appropriate to a relicensing situation, where the
adequacy of existing licensee-provided facilities and management is under review. In Watana’s case,
the primary need at this point is more information about baseline recreational use in the area that could
be affected by the project. Such use can be further characterized by attributes such as experiences
sought and opportunities provided to the public.
Here are our specific suggestions about the survey instrument:
Q. 3 – Why are subjects not being asked if they drove the Parks Highway?
Q. 13 & 14 Quality of Experience and Crowdedness and Q. 19 Experiences Sought
We suggest re-ordering these questions. Put what is now Q. 19 before Q. 13. Then reword Q. 13 and 14
to find out if the project area lacks facilities or management that would enhance recreational
experiences if provided. Given the low density and high dispersion of recreational use in the project
area, linear quality and crowdedness assessments are unlikely to yield information useful to project
design and management decisions.
Q. 15, 16, 17 – Again, these questions seem more appropriate for assessing how well an existing
recreation management plan is working at an existing hydro project than for assessing the probability of
displacement from areas that will be utilized or affected by this project. While there may be existing
conflicts between visitors to the project area, they are not necessarily AEA’s responsibility to fix.
Presumably AEA will want to exert – or be required to exert – more active management of project lands
and waters post-construction, reducing conflicts due to littering, vandalism, gunfire too close to roads,
trails and campsites, etc.
Until we know more about the kinds of new recreational facilities Watana may provide; how project
operations will affect boating, fishing, etc. downstream; and the management and access policies for the
dam, road, transmission corridor right of way, and reservoir, it will not be possible to design survey
questions that will yield meaningful feedback on public preferences for such facilities and policies. NPS
respectfully suggests that an additional survey regarding such preferences will be needed after more is
known about the location of the new road and transmission corridor, reservoir operations, the
boatability of the river downstream of the dam, etc.
Q. 20(f) & (g) – We suggest that subjects be asked about the adequacy both of trails and trailheads.
This table should also ask about the need for Information and Education resources: kiosks, signage, trail
information, points of interest, geologic, historic and/or cultural information. Subjects could also be
asked about management: level of maintenance, staff presence, etc.
Q. 21 & 22 – We suggest reversing the order of these questions to ascertain which areas are most
important to visitors before assessing whether anything interfered with their aesthetic enjoyment. Note
that our Aesthetic Resources study plan request included natural sounds, not just scenic values.
Q. 23 – This questions should be closer to the start of the survey. It provides context for many of the
more specific questions that follow. It could be combined with Q. 10 to help keep the survey from being
too long.
Q. 24 – We suggest that party size be determined earlier in the survey. It is an important recreational
attribute so it’s important to capture this information before subjects potentially abandon the interview.
Incidental Observation Survey
Is it possible to get an update on the effectiveness of this survey prior to release of the 2012 study
report?
MEETING RECORD
Record of Meeting Page 1 of 1
AEA Team Member Other Party
Name: Bob Koenitzer Name: Harry Williamson
Organization: McDowell Group Organization: NPS
Study Area: Recreation Resources Phone
Number: 425-322-4151
Date: 9/20/2012 Time: 3:00 pm
Meeting held by: AEA Team X Other Party
gMMcDowell
Others at meeting: None
Subject:
Recreation survey design
Discussion:
The purpose of the teleconference was to get some initial feedback from NPS on the first survey and
sample plan drafts and facilitate the design process. Harry expressed that he had had limited time to
review the survey and sample plan and that both he and Cassie would have further comments but he
felt that the draft survey and sample plan were a good start. Bob stated that nothing discussed would
be final until AEA had approved the survey. The following are questions, issues, and concerns that
were discussed:
• He requested the exclusion of “don’t know” and “refused” from the mail and online surveys.
McDowell group concurred.
• Q1a- Harry inquired as to the Alaska resident check box. That is provided so that if we have a
respondent refuse to give us their zip code we can still ask if they are an Alaska resident.
• Q20e/f- Harry requested rewording of the questions to capture both the number of trails
(measured by trailheads) and total amount of trails (measured by length). McDowell Group
concurred.
• A question will be added to capture group size in addition to party size.
• Q20a- Harry requested cultural and educational resources (signage, kiosks, points of interest)
be added to this table. McDowell group concurs.
• Both parties agreed to further review the qualitative questions.
Action Item:
Bob will try and incorporate these changes before the 10/3 meeting. NPS will send further comments
as soon as possible. Both agreed that these informal meetings will speed the complex process of
survey design. Again, the survey content is not final until AEA approves.
APPENDIX 4
INFORMAL CONSULTATION DOCUMENTATION
SECTION 14 – SUBSISTENCE RESOURCES
APPENDIX 4
INFORMAL CONSULTATION DOCUMENTATION
SECTION 15 – SOCIOECONOMIC AND TRANSPORTATION
RESOURCES
This comment is in regards to the proposed Susitna Watana Dam.
I want to point out that there are a significnat number of private land owners
(200 or so) congregated along the Alaska Railroad corridor between Gold Creek
and Hurricane, Alaska. FERC appears to recognize the community of people who own
land along the railroad south of Gold creek (Chase community for example) but do
not appreciate the large number of landowners to the north of Gold Creek. This
is likely due to the fact that we are not formally organized like the Chase
community is.
Landowners along the railroad corridor(I am one of them), particularly between
Gold Creek and Hurricane, stand to be disproportionately affected by two access
roads under consideration (South Road and Hurricane alternatives-DOT
transportation access study (http://www.susitna-watanahydro.org/type/studies/).
Though these landowners are not formally organized - but they do represent a
"community" that may be affected disproportionately compared to the population
at-large, particularly by the possible access roads from Hurricane and/or Gold
Creek.
Under the Environmental Justice language in the National Environmental Policy
Act I feel that we should be recognized as a community under NEPA and as lead
permitting agency FERC should open direct dialogue with this community to
insure: 1) accurate information is delivered directly to members of this
community, 2) that public meetings are held at locations that facilitate members
of this community to particpate in the NEPA process, and 3) that the community's
points of view (for or against project components) be given their weight during
the development of the project alternatives portion of the EIS process.
I appreciate that some effort is required to identify and communicate with an
unorganized "community" such as this but nonetheless you must. I am offering to
help with the 90 or so landowners nearest Chulitna.
20120802-5003 FERC PDF (Unofficial) 8/1/2012 9:30:18 PM
Document Content(s)
14780.TXT.............................................................1-1
20120802-5003 FERC PDF (Unofficial) 8/1/2012 9:30:18 PM
NPS Preliminary Comments on Proposed Study Plans for Susitna-
Watana Project
7KHVHLQIRUPDOFRPPHQWVIRFXVRQWKHWKUHHUHFUHDWLRQUHODWHGVWXG\SODQVUHOHDVHGE\$($RQ
-XO\WKLHWKH5HFUHDWLRQ5HVRXUFHV$HVWKHWLFV5HVRXUFHVDQG5HFUHDWLRQDO
%RDWLQJ5LYHU$FFHVVVWXG\SODQV
2YHUDOO&RPPHQWV
&RPPRQWRDOOWKUHH363¶V
-Gap Analyses/PAD&RQWUDU\WRWKHRSHQLQJODQJXDJHRIWKHWKUHH363¶VWKH*DS
$QDO\VHVIRU5HFUHDWLRQDQG$HVWKHWLFV5HVRXUFHVZHUHQRWLQFOXGHGLQWKH3$'DQGZHUH
PDGHDYDLODEOHRQO\DIWHUQXPHURXVFRPSODLQWVIURP136RWKHUDJHQFLHVDQGVWDNHKROGHUV
VKRUWO\EHIRUHRXURULJLQDOFRPPHQWVRQWKH3$'DQGVWXG\UHTXHVWVZHUHGXH
Disciplinary/Study Interdependencies136DQGRWKHUVKDYHUHSHDWHGO\UHTXHVWHG$($
WRGHYHORSDVFKHGXOHWKDWHQVXUHVFRRUGLQDWLRQEHWZHHQWKHQXPHURXVLQWHUGHSHQGHQW
UHVRXUFHVWXGLHVDVVRFLDWHGZLWKWKH:DWDQDSURMHFW2ISDUWLFXODULQWHUHVWWR136DUHWKH
UHFUHDWLRQDQGDHVWKHWLFVVWXGLHVZKLFKDUHGHSHQGHQWRQWKHUHVXOWVRIRWKHUELRSK\VLFDO
UHVRXUFHVWXGLHVVXFKDVWKHK\GURORJ\LQVWUHDPIORZIOXYLDOJHRPRUSKRORJ\LFHSURFHVVHV
ILVKHULHVDQGJDPHVWXGLHV'HVSLWHWKHVHUHTXHVWVWKH-XO\363VPDNHRQO\YDJXH
UHIHUHQFHVWRWKHLVVXH7KHUHUHPDLQVQRYLVLEOHVLJQWKDWWKLVFRRUGLQDWLRQLVEHLQJFRQGXFWHG
DWDSURMHFWZLGHGLVFLSOLQHZLGHOHYHO)RUH[DPSOHQRQHRIWKHWDEOHVGHSLFWLQJWKHYDULRXV
VWXG\VFKHGXOHVLQFOXGHVDQ\UHIHUHQFHWRZKHQWKHUHVXOWVRIWKH³LQSXW´VWXGLHVZLOOEH
DYDLODEOHRUKRZWKHGHSHQGHQWVWXGLHVPLJKWEHPRGLILHGLIWKHVHLQSXWVWXGLHVUHYHDODQG
QHHGWRFKDQJHWKHGHSHQGHQWVWXGLHV¶VXEVWDQWLYHWHPSRUDORUJHRJUDSKLFVFRSHV
&ULWLFDO3DWK0HWKRGRUVRPHFRPSDUDEOHSURMHFWPDQDJHPHQWPHFKDQLVPVKRXOGEHDNH\
HOHPHQWRIWKLVSURMHFWHVSHFLDOO\ZLWKVRPHVWXGLHVLQSOD\PDQ\RFFXUULQJFRQFXUUHQWO\
7KHUHVKRXOGEHDWUDQVSDUHQWSURFHVVIRUWUDFNLQJWKHFULWLFDOPLOHVWRQHVDQGSURJUHVVRIWKH
363¶VZLWKWKHLQWHUGHSHQGHQFLHVLGHQWLILHGLQHDFKVWXG\SODQ$VXPPDU\RIWKHRYHUDOOFULWLFDO
SDWKVFKHGXOHVKRXOGEHLQFOXGHGDVDVHSDUDWHSODQDQGPDGHDYDLODEOHRQWKHSURMHFW
ZHEVLWHIRUWKHVWDNHKROGHUVWRDFFHVV
Availability of 2012 Study results and schedule$FFRUGLQJWRWKHFXUUHQWSXEOLVKHG
VFKHGXOHFRPPHQWVRQWKH-XO\363¶VDUHGXHRQ$($ILOHVUHYLVHG363¶VRQ
FRPPHQWVRQWKHUHYLVHG363¶VDUHGXHRQDQG)(5&ZLOOPDNHILQDO
GHWHUPLQDWLRQRQVWXG\SODQVRQ7KLVVFKHGXOHPHDQVWKDWDJHQFLHVDQG
VWDNHKROGHUVZLOOQRWKDYHWKHUHVXOWVRIFULWLFDOUHFRQQDLVVDQFHDQGEDVHOLQLQJVWXGLHVWKDW
DUHNH\WRGHWHUPLQLQJWKHVFRSHDQGDGHTXDF\RIWKH,/3VWXGLHVEHIRUHRXUILQDO
RSSRUWXQLW\WRFRPPHQWRQWKH,/3VWXGLHV:HDUHEHLQJDVNHGWRWDNHWKH$SSOLFDQW¶VZRUG
WKDWLIWKHUHVXOWVRIVWXGLHVLQGLFDWHDQHHGWRPRGLI\WKH,/3VWXGLHVVXFKPRGLILFDWLRQV
ZLOOEHPDGHYROXQWDULO\
Socioeconomics±136PDLQWDLQVWKDWWKHPHWULFVDQGDQDO\VHVUHJDUGLQJWKH
VRFLRHFRQRPLFFRVWVDQGEHQHILWVRIWKHSURMHFWVKRXOGH[WHQGEH\RQGWKHHVWLPDWHGYDOXHRI
LQFUHDVHGUHFUHDWLRQDQGWRXULVP:HUHFRJQL]HWKDWLWLVOHVVVWUDLJKWIRUZDUGWRGHWHUPLQH
VRPHQRQPDUNHWYDOXHVHJHFRV\VWHPVHUYLFHVDQGH[LVWHQFHYDOXHVWKDQLWLVWRHVWLPDWH
WKHIXWXUHYDOXHRIFRPPHUFLDOWRXULVPLQWKHSURMHFWDUHD7KDWGRHVQRWPHDQWKDWWKHVHQRQ
PDUNHWYDOXHVDUH]HURKRZHYHU136FRQWLQXHVWRDVVHUWWKDWDIXOODFFRXQWLQJRIDOOSURMHFW
UHODWHGLPSDFWVRQWKHVRFLDOHQYLURQPHQWPXVWLQFOXGHDQHVWLPDWHRIWKHVHYDOXHV:KLOHLW
ZLOORIFRXUVHEHXSWR)(5&WRGHFLGHKRZUHOLDEOHWKHYDULRXVHFRQRPLFYDOXHHVWLPDWHVDUH
MXVWDVWKHXQFHUWDLQW\DVVRFLDWHGZLWKWKHIXWXUHYDOXHRIHQHUJ\SURGXFWLRQYSURMHFW
FRQVWUXFWLRQDQGRSHUDWLRQFRVWVPXVWEHDFFRXQWHGIRUDQGWKXVWRGHWHUPLQHPXFKZHLJKWWR
JLYHWKHYDULRXVW\SHVRIHVWLPDWHGVRFLRHFRQRPLFYDOXHVLQLWV³HTXDOFRQVLGHUDWLRQ´DQDO\VLV
QRZKHUHGRHVWKH)3$DVDPHQGHGE\(&3$LQVWUXFW)(5&RUOLFHQVHDSSOLFDQWVWRLJQRUH
VXFKYDOXHVRXWULJKWHVSHFLDOO\LQOLJKWRIHPHUJLQJYDOXDWLRQPHWKRGRORJ\
:LWKUHVSHFWWR%HQHILWV7UDQVIHUPHWKRGRORJ\WKLVPHWKRGLVPRVWUHOLDEOHZKHQWKHUHIHUHQFH
DQGVWXG\VLWHVDQGSURMHFWVDUHYHU\VLPLODUDQGZKHQWKHHFRQRPLFLPSDFWYDOXDWLRQVWXG\DW
WKHUHIHUHQFHVLWHZDVSHUIRUPHGDWWKHKLJKHVWVWDQGDUG*LYHQWKHGHDUWKRIODUJHRULJLQDO
K\GURSRZHUSURMHFWVOLFHQVHGRQIUHHIORZLQJULYHUVLQUHPRWHORFDWLRQVLQUHFHQWGHFDGHV136
EHOLHYHVLWZLOOEHFKDOOHQJLQJWRLGHQWLI\DQDSSURSULDWHUHIHUHQFHSURMHFWIRU:DWDQD-XVWDV
ZLWKHFRV\VWHPVHUYLFHVYDOXDWLRQPHWKRGVWKHUHZLOOEHQXPHURXVDVVXPSWLRQVDQG
DSSUR[LPDWLRQVDVVRFLDWHGZLWKDSSOLFDWLRQRIWKHEHQHILWVWUDQVIHUPHWKRGWRWKLVSURMHFW,Q
FRQWUDVWWRWKHODFNRIDSSURSULDWHUHIHUHQFHVLWHVIRUDEHQHILWVWUDQVIHUDQDO\VLVKRZHYHUWKH
YDOXHRIHFRV\VWHPVHUYLFHV±LQFOXGLQJVHUYLFHVDVVRFLDWHGZLWKWKH6XVLWQD5LYHULV
FXUUHQWO\EHLQJVWXGLHGZLWKVRPHULJRULQ0DW6X%RURXJK
)URPWKH³6RFLRHFRQRPLFDQG7UDQVSRUWDWLRQ6WXG\5HJLRQDO(FRQRPLF(YDOXDWLRQ6WXG\´S
RIWKH363GRFXPHQW
³7KHHFRQRPLFLPSDFWRIWKH3URMHFWRQORFDOWRXULVPHVWDEOLVKPHQWVHJULYHUVSRUW
ILVKLQJZKLWHZDWHUERDWLQJDQGWKHUHJLRQDOHFRQRP\ZLOOEHHVWLPDWHGXVLQJWKHUHVXOWV
RIWKH5HFUHDWLRQDQG$HVWKHWLFVVWXG\&DOFXODWLRQVZLOOEHEDVHGRQLQIRUPDWLRQ
REWDLQHGIURPWKHUHFUHDWLRQVXUYH\LQFOXGLQJWKHHVWLPDWHGUHFUHDWLRQUHODWHG
H[SHQGLWXUHVSHUUHFUHDWLRQDOGD\RUWULSDQGFKDQJHVLQWKHQXPEHURIGD\VRUWULSVSHU
\HDU7KHUHJLRQDOHFRQRPLFLPSDFWRIFKDQJHVLQVXEVLVWHQFHUHODWHGH[SHQGLWXUHVGXHWR
WKHSURSRVHG3URMHFWZLOOEHHVWLPDWHGXVLQJWKHUHVXOWVRIWKH6XEVLVWHQFHVWXG\
$SSUR[LPDWHFDVKH[SHQVHVWRJHQHUDWHHDFKSRXQGRIVXEVLVWHQFHKDUYHVWZLOOEHEDVHG
RQSXEOLVKHGLQIRUPDWLRQ*ROGVPLWK
,QDGGLWLRQWKHEHQHILWVWUDQVIHUDSSURDFKZLOOEHXVHGWRVXSSOHPHQWRUFRPSDUHXQLW
YDOXHVHJYDOXHSHUGD\RIVSRUWILVKLQJIRUUHFUHDWLRQDOJRRGVDQGVHUYLFHVREWDLQHG
IURPSULPDU\YDOXDWLRQPHWKRGV%HQHILWVWUDQVIHULQYROYHVWKHDSSOLFDWLRQRIXQLWYDOXH
HVWLPDWHVIXQFWLRQVGDWDDQGRUPRGHOVIURPRQHRUPRUHSUHYLRXVO\FRQGXFWHG
YDOXDWLRQVWXGLHVWRHVWLPDWHEHQHILWVDVVRFLDWHGZLWKWKHUHVRXUFHXQGHUFRQVLGHUDWLRQ
%ODFNHWDO7KHEDVLVRIWKHPHWKRGLVWKHDVVXPSWLRQWKDWWKHUHFUHDWLRQDO
H[SHULHQFHLVHQKDQFHGE\KLJKTXDOLW\VLWHVHJFOHDQZDWHUDEXQGDQWUHFUHDWLRQDO
ILVKHULHVKHQFHWKHQHWZLOOLQJQHVVWRSD\IRUDQGKHQFHWKHYDOXHRIUHFUHDWLRQDOWULSV
GHSHQGVRQVLWHTXDOLW\
'LIIHUHQWPRGHOVSHFLILFDWLRQVFDQEHXVHGWRYDOXHVSHFLILFTXDOLWLHVRIWKHUHVRXUFHDQG
DWWULEXWHVRIWKHUHFUHDWLRQDOH[SHULHQFH7RYDOXHWKHVHW\SHVRIDPHQLWLHVHFRQRPLVWV
W\SLFDOO\UHO\RQDYDULDQWRIWKHEDVLFWUDYHOFRVWPRGHOUHIHUUHGWRDVDGLVFUHWHFKRLFHRU
UDQGRPXWLOLW\PRGHO:KHUHDVEDVLFWUDYHOFRVWPRGHOVDUHPRVWDSSURSULDWHLQDQDO\]LQJ
WKHQXPEHURIWULSVSHRSOHPDNHWRDVLWHUDQGRPXWLOLW\PRGHOVFDQEHXVHGWRDVVHVV
KRZSHRSOHFKRRVHEHWZHHQPXOWLSOHVLWHVEDVHGRQWKHTXDOLWLHVRIWKHVLWHV7UDYHOFRVW
DSSURDFKHVUHTXLUHGDWDRQVLWHYLVLWDWLRQSODFHRIUHVLGHQFHVXEVWLWXWHVLWHVDQGXVHU
FKDUDFWHULVWLFVVXFKDVLQFRPH%ODFNHWDO7KHVHGDWDZLOOEHREWDLQHGIURPWKH
UHFUHDWLRQVXUYH\FRQGXFWHGIRUWKH5HFUHDWLRQDQG$HVWKHWLFV6WXG\´
7KH363IRU6RFLRHFRQRPLFVDSSHDUVWRUHO\ODUJHO\RQUHVXOWVJHQHUDWHGWKURXJKWKH
5HFUHDWLRQDQG$HVWKHWLFV5HVRXUFHVVWXGLHV+DYLQJQRWVHHQWKHVXUYH\LQVWUXPHQWVDQG
SURWRFROZHGRQ¶WNQRZKRZVRFLRHFRQRPLFGDWDZLOOEHJOHDQHGIURPWKRVHVXUYH\V:HZRXOG
OLNHWRSDUWLFLSDWHLQUHYLHZLQJWKHSURSRVHGVXUYH\PHWKRGRORJ\LGHDOO\EHIRUHRXUDELOLW\WR
FRPPHQWRQWKH,/3VWXG\SODQVH[SLUHV
6HFWLRQE\6HFWLRQ&RPPHQWV
10. RECREATION AND AESTHETIC RESOURCES
10.1. Introduction
7KH$ODVND(QHUJ\$XWKRULW\$($SURSRVHVD5HFUHDWLRQ5HVRXUFHV6WXG\D5HFUHDWLRQDO
5LYHU)ORZ6WXG\DQGDQ$HVWKHWLF5HVRXUFHV6WXG\LQRUGHUWRGRFXPHQWEDVHOLQHFRQGLWLRQV
DQGKHOSDVVHVVSRWHQWLDOLPSDFWVRQUHFUHDWLRQDQGDHVWKHWLFUHVRXUFHVIURPFRQVWUXFWLRQDQG
RSHUDWLRQRIWKHSURSRVHG6XVLWQD:DWDQD3URMHFW3URMHFW7KHSURSRVHG5HFUHDWLRQ5HVRXUFHV
6WXG\KDVEHHQSUHSDUHGLQFRQVXOWDWLRQZLWKDJHQFLHVDQGOLFHQVLQJSDUWLFLSDQWV
7KH5HFUHDWLRQ5HVRXUFHV6WXG\6HFWLRQZLOOUHVHDUFKGHVFULEHDQGTXDQWLI\UHFUHDWLRQ
GHPDQGDQGFDSDFLW\RIIDFLOLWLHVDQGDVVHVVUHDVRQDEO\IRUHVHHDEOHUHFUHDWLRQQHHGVDVVRFLDWHG
ZLWKGHYHORSPHQWRIWKHSURSRVHG6XVLWQD±:DWDQD+\GURHOHFWULF3URMHFW´
136±7KHVWXG\LVIRFXVLQJRQUHFUHDWLRQDOXVHVDQGGHPDQGUDWKHUWKDQUHFUHDWLRQDO
RSSRUWXQLWLHVDQGH[SHULHQFHV1HHGWREHTXDOLWDWLYHQRWMXVWTXDQWLWDWLYHEHFDXVH
H[SHULHQFHVDUHOLNHO\WRFKDQJHSRVWSURMHFW:HDUHUHO\LQJRQWKHUHFUHDWLRQVXUYH\VWRWHDVH
RXWTXDOLWDWLYHLQIRUPDWLRQTXDOLW\RIH[SHULHQFHSUHIHUHQFHVHWF:LWKRXWVHHLQJWKHVXUYH\
LQVWUXPHQWVDQGSURWRFROZHGRQ¶WKDYHDVVXUDQFHWKDWWKH\ZLOOEHDEOHWRFKDUDFWHUL]HWKHVH
10.5. Recreation Resources Study
10.5.1. General Description of the Proposed Study
7KH5HFUHDWLRQ5HVRXUFHV6WXG\LVGHVLJQHGWRLGHQWLI\UHFUHDWLRQUHVRXUFHVDQGDFWLYLWLHVWKDW
PD\EHDIIHFWHGE\WKHFRQVWUXFWLRQDQGRSHUDWLRQRIWKHSURSRVHG6XVLWQD:DWDQD3URMHFW
3URMHFWDQGWRKHOSDVVHVVWKHSRWHQWLDOLPSDFWVRI3URMHFWFRQVWUXFWLRQDQGRSHUDWLRQRQWKRVH
UHVRXUFHVDQGDFWLYLWLHV7KHVSHFLILFJRDOVRIWKHVWXG\DUHWR
,GHQWLI\DQGGRFXPHQWUHFUHDWLRQUHVRXUFHVDQGIDFLOLWLHVWKDWVXSSRUWERWKFRPPHUFLDO
DQGQRQFRPPHUFLDOUHFUHDWLRQLQWKH3URMHFWDUHD
,GHQWLI\WKHW\SHVDQGOHYHOVRIFXUUHQWUHFUHDWLRQDOXVHVDQGIXWXUHUHDVRQDEO\
IRUHVHHDEOHIXWXUHXVHVEDVHGRQVXUYH\VDQGLQWHUYLHZVFRQVXOWDWLRQZLWKOLFHQVLQJ
SDUWLFLSDQWVUHJLRQDODQGVWDWHZLGHSODQVDQGRWKHUGDWD
(YDOXDWHWKHSRWHQWLDOLPSDFWVRI3URMHFWFRQVWUXFWLRQDQGRSHUDWLRQRQUHFUHDWLRQ
UHVRXUFHVQHHGVDQGXVHVLQWKH3URMHFWDUHDDQG
8VHWKHUHVXOWVRIDQDO\VHVWRGHYHORSDQ503IRUWKH3URMHFW
136,QFRUSRUDWHWKHUHVXOWVRIWKHVWXGLHV
10.5.2. Existing Information and Need for Additional Information
([LVWLQJLQIRUPDWLRQZDVFRPSLOHGLQWKH5HFUHDWLRQ'DWD*DS$QDO\VLV$($DDQG
UHFUHDWLRQUHVRXUFHGHVFULSWLRQVDQGLQYHQWRU\SUHVHQWHGLQ$($
V3UHDSSOLFDWLRQ'RFXPHQW
3$'$($E
1367KLVFODLPWKDWH[LVWLQJLQIRZDVFRPSLOHGLQ5HF'DWD*DSDQDO\VLVDQGLQFOXGHG
LQ3$'LVLQFRUUHFW1RWHWKDWWKHFODLPZDVUHSHDWHGFXWDQGSDVWHLQWKHWZRRWKHU
UHFDHVWKHWLFVWXGLHV7KH3$'ZDVILOHGLQ'HFHPEHUEXWZHGLGQRWUHFHLYH
$($¶V³´JDSDQDO\VLVXQWLO0DUFKDIWHUPXFKSOHDGLQJ7RRXUNQRZOHGJH
WKHSXEOLFDWLRQGDWHIRUWKLVGRFXPHQWLVLQDFFXUDWHVLQFHLWZDVQRWPDGHSXEOLF
XQWLO7KHUHZDVQRSURMHFWVSHFLILFLQIRLQWKH3$'RQUHFDQGDHVWKHWLFV, MXVWD
UHJXUJLWDWLRQRIWKHVFDQW\PHWKRGRORJLFDOO\SULPLWLYHLQIRUPDWLRQGHYHORSHGIRUD
GLIIHUHQWK\GURSURMHFWWKLUW\\HDUVDJRDWDWLPHZKHQ)(5&GLGQRWKDYHWRJLYHHTXDO
FRQVLGHUDWLRQWRWKHVHUHVRXUFHYDOXHVLQGHFLGLQJZKHWKHUWROLFHQVHDSURMHFW
$UHFUHDWLRQVWXG\ZDVLQLWLDWHGLQWRJDWKHUGDWDWRLQIRUPWKH
VWXG\SODQLQFOXGLQJWKHIROORZLQJHOHPHQWV
²,QWHUYLHZVZLWKNH\UHSUHVHQWDWLYHVRIDJHQFLHVDQGRUJDQL]DWLRQVLQFOXGLQJ$ODVND
1DWLYHHQWLWLHVNQRZOHGJHDEOHDERXWUHJLRQDODQGVWDWHUHFUHDWLRQPDQDJHPHQWDQGLVVXHV
²$FRPSLODWLRQRIH[LVWLQJUHFUHDWLRQLQYHQWRU\DQGFDSDFLW\LQIRUPDWLRQ
²$QLQYHQWRU\RI3URMHFWDUHDDFFHVV
²,QFLGHQWDO2EVHUYDWLRQ6XUYH\'DWDFRPSOHWHGE\ILHOGFUHZV
²&RRUGLQDWLRQZLWKRWKHUVWXG\GLVFLSOLQHVDQGLQFRUSRUDWLRQRIGDWD
²*HRUHIHUHQFHGPDSSLQJ
²)LHOGUHFRQQDLVVDQFH
²,GHQWLILFDWLRQRIIXWXUHWUHQGVDQGLVVXHV
²$GHVFULSWLRQRIWKHPDQDJHPHQWIUDPHZRUN
$YDLODEOHLQIRUPDWLRQIURPWKHGDWDJDWKHULQJHIIRUWVZLOOEHXVHGWRGHYHORSWKH5HYLVHG
6WXG\3ODQ
136$JHQFLHVDQGVWDNHKROGHUVZLOOQRWKDYHWKHUHVXOWVIURPWKH³GDWDJDWKHULQJ
HIIRUWV´XQWLOWKH\DUHUHSRUWHGRXWLQ:HZLOOQRWEHDEOHWRLQFRUSRUDWHDQ\
FRPPHQWVRQWKHPE\WKHGXHGDWHIRURXU363FRPPHQWV,WLVDOVRXQFOHDUKRZ
PXFKRIWKLVLQIRUPDWLRQ$($DQGLWVFRQVXOWDQWVZLOOKDYHIDUHQRXJKLQDGYDQFHRIWKHLU
563GHDGOLQHWRKHOSLQIRUPWKHUHYLVHGSODQV
10.5.3. Study Area
7KH3URMHFWDUHDLVVKRZQLQ)LJXUH7KHVWXG\DUHDLQFOXGHVWKH6XVLWQD5LYHUZDWHUVKHG
IRFXVLQJRQUHFUHDWLRQRSSRUWXQLWLHVDQGXVHSDWWHUQVLQDQGDURXQGWKHLPPHGLDWH3URMHFWDUHD
10.5.4. Study Methods
%RWKZDWHUEDVHGDQGODQGEDVHGUHFUHDWLRQXVHVDQGDFFHVVZLOOEHDQDO\]HG6HDVRQDOXVHVWKDW
UHODWHWRLFHDQGVQRZFRQGLWLRQVZLOODOVREHDQDO\]HG6SHFLDOL]HGVWXG\RIULYHUIORZ
GHSHQGHQWDFWLYLWLHVZLOODOVREHFRQGXFWHGDVGHVFULEHGLQ6HFWLRQ7KH5HFUHDWLRQ
5HVRXUFHV6WXG\LVLQWHUGHSHQGHQWZLWKDQDO\VHVFRQGXFWHGLQRWKHUGLVFLSOLQHVERWKELRSK\VLFDO
HJDTXDWLFVDQGK\GURORJ\DQGVRFLDOHJWUDQVSRUWDWLRQDQGVRFLRHFRQRPLFVDQG
V\VWHPDWLFFRRUGLQDWLRQRIGDWDZLWKWKRVHVWXG\JURXSVZLOOEHUHTXLUHG
136±ZLWKUHVSHFWWRLQWHUGHSHQGHQWDQDO\VHVDQGWKHUHOLDQFHRIWKHUHFDQGDHVWKHWLFV
VWXGLHVRQUHVXOWVIURPRWKHUGLVFLSOLQHVWKHUHLVQRGHWDLOLQWKLV363H[SODLQLQJKRZWKH
WLPLQJZLOOZRUN7KHVFKHGXOHWDEOHDWHQGRIHDFK363ZLWKVWXG\VHDVRQVDQG
GHOLYHUDEOHVGRHVQRWPHQWLRQWKLVHLWKHU:HQHHGGHWDLOVRIKRZWKHVHTXHQFHZLOOZRUN
$($FDQ¶WMXVWVD\LWZLOOKDSSHQZKHQLWGRHVQRWDSSHDUWKDWWKHUHVXOWVRIRWKHUVWXGLHVZLOO
EHDYDLODEOHEHIRUHWKHGHOLYHU\GDWHIRUWKLVRQH
0HWKRGVIRUWKHFRPSRQHQWVRIWKHSURSRVHG5HFUHDWLRQ5HVRXUFHV6WXG\3ODQIRUDUH
GHVFULEHGEHORZ
5HJLRQDO5HFUHDWLRQ$QDO\VLV
136±7KLVVWXG\SODQVKRXOGQRWHHDUO\RQWKHGLVWLQFWLRQZLWKVXEVLVWHQFHKXQWLQJDQG
ILVKLQJYVSRUWDFWLYLWLHV0D\EHFRQIXVLQJWRVRPHVWDNHKROGHUVDQGUHDGHUVDVWKH
SURFHVVJRHVRQ
7KHUHJLRQDOUHFUHDWLRQUHVRXUFHVFRQWH[WZLOOEHGHILQHGLQFRRUGLQDWLRQZLWKDJHQFLHVWHFKQLFDO
ZRUNJURXSVDQGRWKHUSDUWLFLSDQWVLQFOXGLQJ$ODVND1DWLYHHQWLWLHV5HJLRQDODQGORFDOGDWD
UHODWHGWRUHFUHDWLRQXVHZLOOEHFROOHFWHGDQGDQDO\]HGLQFOXGLQJH[DPLQDWLRQRIYDULRXVODQG
PDQDJHPHQWUHJLPHVZLWKLQWKHDUHD([LVWLQJUHVRXUFHPDQDJHPHQWSODQVUHOHYDQWWRWKH
UHFUHDWLRQDOUHVRXUFHVRIWKHVWXG\DUHDZLOOEHUHYLHZHGDQGFRPSLOHG7KHDQDO\VLVZLOOEH
FRQGXFWHGLQDFFRUGDQFHZLWKH[LVWLQJDQGSURSRVHGFRPPXQLW\DQGUHJLRQDOSODQVDQGSULYDWH
VHFWRUSODQV3ODQVWKDWZLOOEHLQFRUSRUDWHGLQFOXGH
136³([LVWLQJUHVRXUFHPDQDJHPHQWSODQVZLOOEHUHYLHZHGDQGFRPSLOHG´,VQ¶WWKLV
EHLQJGRQHLQ"
$ODVND¶V2XWGRRU/HJDF\6WDWHZLGH&RPSUHKHQVLYH2XWGRRU5HFUHDWLRQ3ODQ6&253
±$ODVND'HSDUWPHQWRI1DWXUDO5HVRXUFHV>$'15@
$ODVND5HFUHDWLRQDO7UDLOV3ODQ$'15
&KDVH&RPSUHKHQVLYH3ODQ06%
&XOWXUDO5HVRXUFH0DQDJHPHQW3ODQIRUWKH'HQDOL+LJKZD\/DQGV9DQGHU+RHN
'HQDOL6WDWH3DUN0DQDJHPHQW3ODQ$ODVND'LYLVLRQRI3DUNVDQG2XWGRRU5HFUHDWLRQ
>'325@
'3257HQ<HDU6WUDWHJLF3ODQ±'325
(DVW$ODVND5HVRXUFH0DQDJHPHQW3ODQ%XUHDXRI/DQG0DQDJHPHQW>%/0@
06%&RPSUHKHQVLYH'HYHORSPHQW3ODQ06%
06%7UDLOV3ODQ06%
06%&RPSUHKHQVLYH(FRQRPLF'HYHORSPHQW6WUDWHJ\7,36WUDWHJLHV,QF
06%3DUNVDQG5HFUHDWLRQ2SHQ6SDFH3ODQ06%
6RXWK'HQDOL,PSOHPHQWDWLRQ3ODQDQG(QYLURQPHQWDO,PSDFW6WDWHPHQW1DWLRQDO3DUN
6HUYLFH>136@
6XVLWQD$UHD3ODQ$'15
6XVLWQD%DVLQ5HFUHDWLRQ5LYHUV0DQDJHPHQW3ODQ$'15
6XVLWQD0DWDQXVND$UHD3ODQ$'15
7DONHHWQD&RPSUHKHQVLYH3ODQ06%
136LQIRZLOOEHXVHGWRGHYHORS563:LOOZHVHHWKLVSULRUWRWKHGXHGDWH
IRURXU363FRPPHQWV",IQRWKRZZLOODJHQFLHVDQGWKHSXEOLFHQVXUHWKDWWKHGDWD
LVDSSOLHGFRUUHFWO\"7LPLQJSUREOHPSRLQWVWRODUJHUSUREOHPRIWU\LQJWRILQDOL]HVWXG\SODQV
IRUDSURMHFWEHIRUHUHFRQQDLVVDQFHOHYHOZRUNLVFRPSHWH7KLVDSSOLHVWRWZRRWKHU363V
$HVWKHWLFVDQG,QVWUHDP5HFUHDWLRQWRR.
7UDLOVOHDGLQJLQWRDQGZLWKLQWKH3URMHFWDUHDZLOOEHLGHQWLILHGXVLQJDHULDOLPDJHU\7KHVH
LQFOXGHPXOWLSOHIRUPDODQGLQIRUPDOWUDLOVDQGURXWHVVHYHUDOIRUPDOO\LGHQWLILHG5HYLVHG
6WDWXWH56WUDLOVDQG$ODVND1DWLYH&ODLPV6HWWOHPHQW$FW$1&6$EWUDLOV7KH
WUDLOVZLOOWKHQEHPDSSHGDQG³JURXQGWUXWKHG´7KLVZLOOLGHQWLI\WUDLOVWKDWKDYHKLVWRULFDOXVH
DQGDUHOHJDOXQGHU6WDWH³JHQHUDOO\DOORZHGXVHV´EXWKDYHQRWEHHQQDPHGRULGHQWLILHGE\
$'150DQDJHPHQWUHVSRQVLELOLWLHVIRUEHDVHPHQWWUDLOVZLOODOVREHFODULILHGZKHUHYHU
SRVVLEOH
5HFUHDWLRQ$FWLYLW\$UHDVSHU6&253SODQQLQJDQGWKH5HFUHDWLRQ2SSRUWXQLW\6SHFWUXP
86)6³SULPLWLYH´FODVVZLOODOVREHGHVFULEHGDVWKH\UHODWHWRWKHVWXG\DUHD6FHQLF
%\ZD\V:LOGDQG6FHQLF5LYHUV:65DQGRWKHUVSHFLDOUHVRXUFHXVHGHVLJQDWLRQVZLOOEH
LGHQWLILHGDQGGHVFULEHG7KHUHDUHWZRULYHUVHJPHQWVZLWKLQWKH3URMHFWDUHDWKDWKDYHEHHQ
LGHQWLILHGE\%/0DVHOLJLEOHIRULQFOXVLRQLQWRWKH:656\VWHP%UXVKNDQD&UHHNDQGWKH
SRUWLRQRIWKH6XVLWQD5LYHUIURPWKHKHDGZDWHUVWRWKHFRQIOXHQFHRI.RVLQD&UHHN%/0KDV
VWDWHGWKDWWKH\ZLOOFRQGXFWDVXLWDELOLW\GHWHUPLQDWLRQIRUWKHVHHOLJLEOHULYHUVHJPHQWV6RFLDO
6FLHQFHV7HFKQLFDO:RUNJURXS0HHWLQJ$SULO7KH*HRUJH3DUNV+LJKZD\EHWZHHQ
03DQGLVGHVLJQDWHGDVDQ$ODVND6WDWH6FHQLF%\ZD\$'27 3)
5HFUHDWLRQ8VHDQG'HPDQG
&XUUHQWO\WKHUHFUHDWLRQXVHVRIWKH3URMHFWDUHDDUHZLGHO\GLVSHUVHG9LVLWRUVWRWKHDUHD
SDUWLFLSDWHLQDZLGHYDULHW\RIDFWLYLWLHVLQFOXGLQJVSRUWKXQWLQJVSRUWILVKLQJUHFUHDWLRQDO
ERDWLQJVNLLQJVQRZVKRHLQJDQGVQRZPDFKLQLQJ7KHDPRXQWH[WHQWDQGSRWHQWLDOLPSDFWRI
3URMHFWUHODWHGGLVSHUVHGUHFUHDWLRQXVHRQWKHSURSRVHG3URMHFWDUHD¶VODQGDQGZDWHUUHVRXUFHV
LVFXUUHQWO\XQTXDQWLILHG
$EDVHOLQHRIGHYHORSHGDQGGLVSHUVHGUHFUHDWLRQXVHVLQFOXGLQJW\SHVOHYHOVDQGDFFHVVZLOOEH
GHWHUPLQHGDQGGHVFULEHG+LJKXVHORFDWLRQVZLOOEHLGHQWLILHGE\DFWLYLW\DORQJZLWKGD\WLPH
DQGRYHUQLJKWYLVLWVDQGVHDVRQDOSDWWHUQV8VHUSUHIHUHQFHVDQGRSLQLRQVDERXWWKHTXDOLW\RI
UHFUHDWLRQUHVRXUFHVZLOODOVREHGHVFULEHG'DWDZLOOEHFROOHFWHGWKURXJKDOLWHUDWXUHUHYLHZDQG
DFRPSUHKHQVLYHVXUYH\DQGLQWHUYLHZSURJUDP6DOLHQWH[LVWLQJGDWDZLOODOVREHLQFRUSRUDWHG
)XWXUHUHFUHDWLRQGHPDQGZLOOEHHVWLPDWHGEDVHGRQVRFLRHFRQRPLFLQGLFDWRUVIRUHVHHDEOHQRQ
3URMHFWUHFUHDWLRQGHYHORSPHQWVDQGLGHQWLILHGLVVXHVDQGWUHQGV(IIHFWVRIWKH3URMHFWIHDWXUHV
HJUHVHUYRLUDQGDFFHVVURDGVRQKXQWLQJDQGWUDSSLQJRSSRUWXQLWLHVDQGRQQRQFRQVXPSWLYH
XVHVELUGZDWFKLQJKLNLQJFDPSLQJERDWLQJHWFLQWKHYLFLQLW\DQGGRZQVWUHDPRIWKH
SURSRVHG3URMHFWUHVHUYRLUZLOOEHDVVHVVHG$GGLWLRQDOO\WKHUHFUHDWLRQHIIHFWVRIDQ\3URMHFW
LQGXFHGFKDQJHVLQLFHIRUPDWLRQWKH6XVLWQD5LYHUZLOOEHHYDOXDWHG7KHUHDUHDOVRSRWHQWLDO
HIIHFWVRILQGXFHGUHFUHDWLRQDORQJWKH'HQDOL+LJKZD\DQGGRZQVWUHDPIURPWKH6XVLWQD5LYHU
EULGJHRQWKH'HQDOL+LJKZD\WRWKHSURSRVHG:DWDQD5HVHUYRLU7KHHIIHFWVRI3URMHFW
FRQVWUXFWLRQDQGRSHUDWLRQDODFWLYLWLHVHJQRLVHGXVWOLPLWDWLRQVRQDFFHVVDQGUHFUHDWLRQ
DFWLYLWLHVRIFRQVWUXFWLRQZRUNHUVRQUHFUHDWLRQZLOODOVREHDQDO\]HG5HFUHDWLRQGHPDQGZLWKLQ
WKHVWXG\ZLOOEHHVWLPDWHGZLWKLQWKHVWXG\DUHDLQWKHUHDVRQDEO\IRUHVHHDEOHIXWXUH
136±$($QHHGVWRDQDO\]HHIIHFWVRISURMHFWRSHUDWLRQVQRWMXVW³IHDWXUHV´1RZKHUHLQ
WKH363LVLWH[SOLFLWO\DFNQRZOHGJHGWKDWWKHSURMHFWPD\KDYHHIIHFWVRQWKLQJVOLNHILVK
DEXQGDQFHDIIHFWLQJVSRUWILVKLQJRSSRUWXQLWLHVPRRVHFDULERXZDWHUIRZODQGXSODQG
JDPHELUGSRSXODWLRQVGXHWRPLJUDWLRQEDUULHUVDQGDOWHUDWLRQRIKDELWDWGXHWRDOWHUHG
IOXYLDOPRUSKRORJ\DQGULSDULDQYHJHWDWLRQ
6XUYH\UHVXOWVDQGDQLQYHQWRU\RIFXUUHQWDQGSURMHFWHGUHFUHDWLRQRSSRUWXQLWLHVFRPPHUFLDO
VHUYLFHVDQGIDFLOLWLHVZLOOLQIRUPWKH6RFLRHFRQRPLF5HVRXUFH6WXG\LQUHJDUGWRWKHHFRQRPLF
FRQWULEXWLRQRIUHFUHDWLRQLQWKHVWXG\DUHD
1366RFLRHFRQRPLFVWXG\QHHGVWRGHWHUPLQHYDOXHRIUHFQRWMXVWFRQWULEXWLRQWRORFDO
HFRQRP\7KLVYDOXHLQFOXGHV³FRQVXPHUV´RXWVLGHWKHORFDOPDUNHW$($QHHGVWRH[SDQG
WKHLULQTXLU\LQWRDOWHUQDWLYHVRFLRHFRQRPLFPHWKRGVDQGPRGHOVEH\RQG³%HQHILWV7UDQVIHU´
$OVRVHHRXUFRPPHQWXQGHU³2YHUDOO&RPPHQWV´
5HFUHDWLRQ&DUU\LQJ&DSDFLW\
7KHUHDUHQRH[LVWLQJGHYHORSHGUHFUHDWLRQIDFLOLWLHVRQWKH6XVLWQD5LYHUDWWKH:DWDQD'DPVLWH
,QWKHEURDGHU3URMHFWDUHDERWKSXEOLFDQGSULYDWHUHFUHDWLRQIDFLOLWLHVH[LVW7KHVHDUHSULPDULO\
ORFDWHGDORQJWKHURDGV\VWHP
7KHH[LVWLQJSK\VLFDOFDUU\LQJFDSDFLW\RIUHFUHDWLRQUHVRXUFHVLQWKH3URMHFWDUHDZLOOEH
HVWLPDWHG3XEOLFIDFLOLWLHVZLOOEHLQYHQWRULHGDQGGHVFULEHGDVWRFRQGLWLRQFDSDFLW\DGHTXDF\
DQGRSHUDWLRQDOFRVW3ULYDWHIDFLOLWLHVZLOODOVREHLQYHQWRULHGWRWKHH[WHQWSUDFWLFDEOH3XEOLF
DFFHVVWRUHFUHDWLRQVLWHVZLOODOVREHGHVFULEHGLQFOXGLQJ$PHULFDQVZLWK'LVDELOLWLHV$FW
$'$FRPSOLDQFHLIDSSURSULDWH
136±3K\VLFDOFDUU\LQJFDSDFLW\LVMXVWRQHRIWKHIRXUHOHPHQWVRI³FDUU\LQJFDSDFLW\´
SK\VLFDOHFRORJLFDOVRFLDODQGVSDWLDO7KHDUHD¶VSK\VLFDOFDSDFLW\PD\RUPD\QRWEH
WKHPRVWOLPLWLQJHVSHFLDOO\LIWKHSURMHFWUHVXOWVLQJUHDWHUDFFHVVZKLFKFRXOGFDXVHXVHWR
H[FHHGWKHDUHD¶VVRFLDOFDUU\LQJFDSDFLW\7KLVLVRQHUHDVRQZK\LW¶VVRLPSRUWDQWWRVWXG\
WKHH[SHULHQWLDODVSHFWRISUHDQGSRVWSURMHFWUHFUHDWLRQDOXVH2QULYHUVLQSDUWLFXODU
VRFLDOFDSDFLW\LVDOPRVWDOZD\VPRUHVHQVLWLYHWKDQRWKHUDVSHFWVRIFDSDFLW\ZLWK
FRQFHUQVDERXWJURXSVL]HDQGHQFRXQWHUUDWHVFRPSHWLWLRQIRUVSDFHDWSXWLQVWDNHRXWV
DQGFDPSVLWHVDQGFURZGLQJDWILVKLQJKROHVSOD\ERDWLQJIHDWXUHVHWF
7KHQHHGIRUDQGFDSDFLW\RIDGGLWLRQDOUHDVRQDEO\IRUHVHHDEOHUHFUHDWLRQDOIDFLOLWLHVZLOOEH
IRUHFDVW&DUU\LQJFDSDFLW\JXLGHOLQHVDQGVWDQGDUGVZLOOEHDSSOLHGLQRUGHUWRGHYHORS
UHFRPPHQGDWLRQVIRUIXWXUHUHFUHDWLRQIDFLOLWLHVDQGVLWHV
'DWD&ROOHFWLRQ
7KHFROOHFWLRQRIUHFUHDWLRQXVHUGDWDZLOOEHDFFRPSOLVKHGWKURXJKPXOWLSOHVXUYH\SURFHVVHV
7KHVWXG\GHVLJQZLOOGHVFULEHWDUJHWUHVSRQGHQWVJHRJUDSKLFORFDWLRQVWDUJHWGD\VDQGPRQWKV
DQGTXHVWLRQQDLUHFRQWHQWVXUYH\PHWKRGVLQWKHFRQWH[WRIFRQVXOWDWLRQZLWKDJHQFLHV
ZRUNJURXSV$ODVND1DWLYHVDQGRWKHUV6XUYH\LQVWUXPHQWVZLOOEHGHVLJQHGWRFROOHFW
LQIRUPDWLRQW\SLFDORIDQGFRPSDWLEOHZLWKRWKHU)(5&HIIRUWV7KLVLQFOXGHVWKHVXUYH\
FRQGXFWHGIRUWKHVWXGLHV(+DU]D(EDVFREDQGRWKHUVXUYH\VVXFKDVWKH6&253
'15DQGWKH$ODVND9LVLWRU6WDWLVWLF3URJUDP$9630F'RZHOO
Identification and Analysis of Salient Data from Existing Survey Research
5HFUHDWLRQVXSSO\DQGGHPDQGGDWDIURPRWKHUUHFUHDWLRQSODQQLQJVRXUFHVDSSOLFDEOHWRWKH
UHJLRQZLOOEHV\QWKHVL]HG([LVWLQJGDWDFDQLQIRUPHVWLPDWHVRIOHYHOVHJ³UHFUHDWLRQGD\V´
DQGW\SHVRISDUWLFLSDWLRQLQUHFUHDWLRQXVHV7KHHVWLPDWHVZLOOLQFOXGHDGLVFXVVLRQDQG
FRPSDULVRQRISDUWLFLSDWLRQUDWHVLQDFWLYLWLHVUHJLRQDOO\VWDWHZLGHDQGQDWLRQDOO\5HFUHDWLRQ
WUHQGVDVIRUHFDVWLQRWKHUVWXGLHVZLOODOVREHGHVFULEHG
136±7KHH[LVWLQJVXUYH\UHVHDUFKDSSHDUVWREHELDVHGWRZDUGV³LQGXVWULDOWRXULVP´7KLV
LVQRWWKHRQO\SRSXODWLRQWKDWXVHVWKHSURMHFWDUHD7KLVDQDO\VLVQHHGVWRFDSWXUHXVHE\
LQGHSHQGHQWWRXULVWVHJSHRSOHGULYLQJXSWKH$.+LJKZD\DQGRQWR'HQDOL+Z\DQG
ORFDOXQJXLGHG$.UHVLGHQWXVHUVPDQ\RIZKRPDUHDEOHWRDFFHVVWKHDUHDZLWKRXW
UHO\LQJRQDLUWD[LVRUKHWERDWFKDUWHUV
7KH$9636XUYH\0F'RZHOOLVDVWDWHZLGHUHVHDUFKSURJUDPFRPPLVVLRQHGE\WKH
$ODVND'HSDUWPHQWRI&RPPHUFH&RPPXQLW\DQG(FRQRPLF'HYHORSPHQWWKDWLQFOXGHG
YLVLWRUVWR$ODVNDLQWKHVXPPHURIDQGYLVLWRUVLQWKH)DOO:LQWHU7KH
6&253$'15VXUYH\GDWDEDVHZLOODOVREHXVHGTXDQWLI\UHFUHDWLRQXVHVDQGGHPDQG,Q
DGGLWLRQ$ODVND7UDYHO,QGXVWU\$VVRFLDWLRQUHVHDUFK*0$DERXWQRQUHVLGHQWWUDYHOWR
$ODVNDZLOOEHUHYLHZHGDQGVXPPDUL]HGDVLWSHUWDLQVWRUHFUHDWLRQDQGDHVWKHWLFDSSHDORI
$ODVND¶VYLVLWRUPDUNHW136±([FOXGHVWKH6SULQJVHDVRQ
7KHVHGDWDZLOOEHXWLOL]HGWRGHVFULEH\HDUURXQGQRQUHVLGHQWQRQ$ODVNDQH[SHULHQFHVE\
YLVLWRUVLQWKUHHPDMRUFRPPXQLWLHVLQWKH06%3DOPHU:DVLOODDQG7DONHHWQDSDVVHQJHUVRQ
WKH$ODVND5DLOURDGDQGFUXLVHSDVVHQJHUVYLVLWLQJ0F.LQOH\3ULQFHVV/RGJH
7KHH[LVWLQJGDWDLQFOXGH
/RGJLQJW\SHV
$FWLYLWLHV
/HQJWKRIVWD\
3XUSRVHRIWULS
3UHYLRXVWUDYHOWR$ODVND
0RGHVRIWUDQVSRUWDWLRQXVHGZLWKLQWKH6WDWH
7ULSVSHQGLQJ
&RPPXQLWLHVYLVLWHGRYHUDOODQGRYHUQLJKW
'HPRJUDSKLFVRULJLQDJHLQFRPHSDUW\VL]H
7KLVQRQUHVLGHQWGDWDZLOOEHHYDOXDWHGDORQJZLWKH[LVWLQJGDWDUHODWLQJWRUHFUHDWLRQXVHE\
$ODVND5HVLGHQWLQWKHFRQWH[WRIWKHRYHUDOOVWXG\SODQ
Incidental Observation Survey
7KHSXUSRVHRIWKHLQFLGHQWDOREVHUYDWLRQVXUYH\LVWRFDSWXUHLQIRUPDWLRQIURPILHOGUHVHDUFKHUV
DERXWGLVSHUVHGUHFUHDWLRQDOXVH7KHVXUYH\ZLOOJDWKHULQIRUPDWLRQRQWKHGDWHDQGWLPHRIGD\
WKHDFWLYLW\ZDVREVHUYHGWKHW\SHRIDFWLYLW\REVHUYHGQXPEHURISHRSOHUHFUHDWLQJDQGWKH
ORFDWLRQRIREVHUYHGDFWLYLW\7KLVVXUYH\ZLOOQRWKDYHVWDWLVWLFDOYDOXHEXWZLOOKHOSLGHQWLI\
W\SHVRIUHFUHDWLRQDOXVHLQWKHVWXG\DUHD$SURWRFROZLOODFFRPSDQ\WKHVXUYH\WRLQIRUPILHOG
FUHZVKRZWRFRPSOHWHDQGVXEPLWWKHVXUYH\7KHVXUYH\ZLOOEHXVHGWKURXJKRXWWKHVWXG\
Telephone Surveys of Railbelt Residents
7KHSXUSRVHRIWKLVVXUYH\LVWRLQWHUYLHZDVDPSOHRIUHVLGHQWVDERXWWKHLUUHFUHDWLRQXVHLQWKH
DUHDDQGWRFROOHFWSHUVSHFWLYHVDERXWUHFUHDWLRQDORSSRUWXQLWLHV7KHVXUYH\ZLOOEHDGPLQLVWHUHG
WRDVWDWLVWLFDOVDPSOHRIUDQGRPO\VHOHFWHG5DLOEHOWUHVLGHQWVZLWKLQDIRXUKRXUGULYH
RIWKHVWXG\DUHD)DLUEDQNV'HQDOL%RURXJK0DW6X%RURXJKDQG$QFKRUDJH7KLVVXUYH\
ZLOOEHFHQWUDOWRWKHHVWLPDWLRQRIUHVLGHQWUHFUHDWLRQGHPDQG7KH6&253VXUYH\LQVWUXPHQW
ZLOOEHUHYLHZHGIRUDQ\EHQFKPDUNTXHVWLRQVWREHFRQVLGHUHGLQWKHVXUYH\GHVLJQ7KHRYHUDOO
VDPSOHVL]HZLOOEHUHILQHGDIWHUFRQVLGHULQJGHVLUHGVXEJURXSVDPSOHV
136±:HEHOLHYHWKDWWKH3KRQHVXUYH\KDVYHU\OLWWOHYDOXH*LYHQWKHVDPSOHVL]HYHU\
IHZVXEMHFWVDUHOLNHO\WREHIDPLOLDUZLWKWKHSURMHFWDUHDDQGWKH6&253TXHVWLRQVDUHWRR
JHQHUDOWR\LHOGXVHIXOLQIRUPDWLRQDERXWWKHVSHFLILFNLQGVRIUHFUHDWLRQDORSSRUWXQLWLHVLQ
WKHDUHD6&253VIRUVWDWHVDVODUJHDQGJHRJUDSKLFDOO\GLYHUVHDV$.DUHDSUREOHPLQ
DQGRIWKHPVHOYHV,QVWHDGZHVXJJHVWWKHUHVRXUFHVEHIRFXVHGRQ³H[HFXWLYHLQWHUYLHZV´
XVHVQRZEDOOVDPSOLQJPHWKRGWRILQGDFWXDOXVHUVRIWKLVDUHDDQGRWKHUVOLNHLW
([SHFWLQJJUHDWFRRSHUDWLRQIURPYHQGRUVDQGRXWILWWHUVZKRDUHEHLQJDVNHGWRWDNHWKH
WLPHDQGHIIRUWWRKDQGRYHUSULYDWHLQIRRQ³DFWXDOXVHUV´PD\DOVREHGLIILFXOW7KLV
XQGHUVFRUHVRXUQHHGWRUHYLHZWKHVXUYH\LQVWUXPHQWVDQGSURWRFROV$6$3(YHQWKRXJK
WKHSURMHFWLVXQLTXHVXFKVXUYH\WHPSODWHVDUHIDLUO\VWDQGDUGDQGVKRXOGDOUHDG\KDYH
EHHQGHYHORSHGDQGGLVVHPLQDWHGWRDJHQFLHVDQGVWDNHKROGHUV
7KHVXUYH\LQVWUXPHQWGHVLJQZLOOFDSWXUH
3DVWDQGFXUUHQWUHFUHDWLRQXVHZLWKLQWKHVWXG\DUHD
<HDUURXQGVHDVRQDODQGGD\QLJKWUHFUHDWLRQXVHLQWKHVWXG\DUHD
1DWXUHRIXVHRUUHFUHDWLRQDOLQWHUHVWLQFOXGLQJEXWQRWOLPLWHGWRILVKLQJERDWLQJ
FDPSLQJSLFQLFNLQJKLNLQJRIIURDGLQJVQRZPDFKLQLQJVQRZVKRHLQJVNLLQJKRUVHEDFN
ULGLQJELNLQJURFNLFHFOLPELQJGRJVOHGGLQJSKRWRJUDSK\PXVKURRPEHUU\SLFNLQJVFHQLF
WRXULQJZLOGOLIHYLHZLQJDQGKXQWLQJ
*XLGHGRUXQJXLGHGXVHV
5HFUHDWLRQSUHIHUHQFHVVXFKDVSULVWLQHSULPLWLYHVHPLSULPLWLYHRUGHYHORSHG
([SHFWHGIXWXUHUHFUHDWLRQXVHZLWKLQWKHVWXG\DUHDLQFOXGLQJKRZXVHPD\FKDQJHZLWK
3URMHFWGHYHORSPHQWDQGRSHUDWLRQDODOWHUQDWLYHV
0HDQVRIDFFHVVWRWKHVWXG\DUHD
4XDOLW\RIWKHUHFUHDWLRQDORSSRUWXQLW\
,PSRUWDQFHRIDQGVDWLVIDFWLRQZLWKFXUUHQWUHFUHDWLRQIDFLOLWLHVVXFKDVERDWODXQFKHV
DQGWUDLOV
$WWUDFWLYHQHVVRIWKHVWXG\DUHDIRUUHFUHDWLRQDODFWLYLWLHV
$FFHVVLELOLW\DQGFRQGLWLRQVDYDLODELOLW\
9LVXDOTXDOLW\RIWKHVFHQHU\LQWKHVWXG\DUHD
'LVWDQFHWKDWXVHUVDUHZLOOLQJWRWUDYHOIRUZHHNHQGUHFUHDWLRQDORSSRUWXQLWLHV
'HPRJUDSKLFVRIKRXVHKROGDQGUHVSRQGHQWV
4XHVWLRQVWKDWHOLFLWLQIRUPDWLRQFHQWUDOWRUHODWHGGLVFLSOLQHVVXFKDVWKH5HJLRQDO(FRQRPLF
(YDOXDWLRQ6WXG\PD\DOVREHLQFOXGHG
Intercept Surveys and Structured Observation Visitor Counts
7KHSXUSRVHRIWKHVHVXUYH\VZRXOGEHWRFDSWXUHVSHFLILFUHFUHDWLRQXVHGDWDIURPXVHUV
DFFHVVLQJWKHDUHDE\ERDWUDLODLUVQRZPDFKLQHRURWKHUPRGHV7KHVXUYH\ZRXOGEH
FRQGXFWHGLQSHUVRQEDVHGRQDVDPSOLQJSODQWKDWFDSWXUHVSHDNVHDVRQDOXVHV
$FFHVVSRLQWVPD\LQFOXGHEXWDUHQRWOLPLWHGWRERDWODXQFKHVHJ6XVLWQD/DQGLQJ:LOORZ
&UHHN7DONHHWQD'HVKND/DQGLQJUDLOURDGZKLVWOHVWRSVWUDLOKHDGVHJ(DVW:HVW
VQRZPDFKLQHWUDLOKHDGRQWKH3DUNV+LJKZD\DORQJWKH'HQDOL+LJKZD\DLUVWULSVDQG
FDPSJURXQGVHJ%UXVKNDQD&UHHN
136:KHUHLVWKHGHWDLORQWKLVDQGRWKHUPHWKRGV"$JDLQZHQHHGWREHGHYHORSLQJ
LQVWUXPHQWVQRZRUDWOHDVWGHFLGLQJZKHQWKH\ZLOOEHGHYHORSHGSULRUWRRXUODVWFKDQFH
WRFRPPHQWLQPLG2FW
7KHVXUYH\LQVWUXPHQWGHVLJQZRXOGFDSWXUHEXWZRXOGQRWEHOLPLWHGWR
1XPEHULQSDUW\DQGGHPRJUDSKLFV
&RPPXQLW\RIUHVLGHQFH
3DUWLFLSDWLRQLQW\SHDQGORFDWLRQRIUHFUHDWLRQDFWLYLW\
5DWLQJRITXDOLW\RIUHFUHDWLRQH[SHULHQFH
/HYHORIVDWLVIDFWLRQZLWKIDFLOLWLHVUHFUHDWLRQDFWLYLWLHVLQFOXGLQJDHVWKHWLFV
*XLGHGRUXQJXLGHGXVH
3DVWXVHDQGLQWHQWLRQIRUIXWXUHXVH
7ULSH[SHQVHV
0HDQVRIDFFHVVWRWKHUHFUHDWLRQDUHD
$FFHVVLELOLW\FRQGLWLRQVDQGDYDLODELOLW\
2WKHURSSRUWXQLWLHVZLWKLQVDPHGLVWDQFHWKDWRIIHUVVLPLODUH[SHULHQFHV
3UHIHUHQFHV
,QWHUHVWLQSRWHQWLDOQHZUHFUHDWLRQIDFLOLWLHVDQGRSSRUWXQLWLHV
2QVDPSOHGD\VWKHVXUYH\FUHZVZLOOREVHUYHNH\FKDUDFWHULVWLFVRIUHFUHDWLRQXVHHJWKH
QXPEHURISHRSOHSUHVHQWWKHQXPEHURIYHKLFOHVHQWHULQJH[LWLQJWKHDFFHVVVLWHW\SHVRI
UHFUHDWLRQDFWLYLWLHVHYLGHQWDQGUHFRUGWKLVLQIRUPDWLRQRQSUHSULQWHGIRUPV8VHUVWREH
VXUYH\HGLQSHUVRQZLOOEHVHOHFWHGE\DYDLODELOLW\DQGZLOOLQJQHVVWRSDUWLFLSDWH
Executive Interviews
7KHSXUSRVHRIWKHH[HFXWLYHLQWHUYLHZVLVWRJDWKHUVSHFLILFLQIRUPDWLRQDERXWFRPPHUFLDOHJ
JXLGHVWRXUVHWFDQGSULYDWHUHFUHDWLRQXVHWKHVWXG\DUHD,WLVDQWLFLSDWHGWKDWEHWZHHQDQG
SULYDWHVHFWRUUHFUHDWLRQEXVLQHVVHVDVVRFLDWLRQVDQGRWKHUHQWLWLHVZLOOEHLQWHUYLHZHG
7KHVHLQWHUYLHZVZLOOEHFRQGXFWHGE\WHOHSKRQH7KHH[HFXWLYHLQWHUYLHZSURFHVVZLOOEH
QHFHVVDU\WRGHYHORSWUXVWZLWKEXVLQHVVHVDQGRUJDQL]DWLRQVZLWKUHFUHDWLRQUHODWHGLQWHUHVWVLQ
WKHVWXG\DUHDLQRUGHUWRFROOHFWSURSULHWDU\HFRQRPLFGDWDIRUXVHLQWKH5HJLRQDO(FRQRPLF
(YDOXDWLRQ6WXG\7KHSURFHVVRIGHYHORSLQJDOLVWRISRWHQWLDOUHVSRQGHQWVLQFOXGHVWKH
LGHQWLILFDWLRQRIRUJDQL]DWLRQVDVVRFLDWLRQVJRYHUQPHQWDJHQFLHVDQGEXVLQHVVHVZLWK
UHFUHDWLRQUHODWHGLQWHUHVWVLQVWXG\DUHD7KLVOLVWZLOOEHGHYHORSHGWKURXJKH[LVWLQJDQGUHIHUUHG
FRQWDFWVLQWHUQHWVHDUFKHVDQGLQWHUYLHZV&RQWDFWVPD\LQFOXGHEXWZLOOQRWEHOLPLWHGWR
0DW6X%RURXJK&RQYHQWLRQDQG9LVLWRUV%XUHDX
)HGHUDO$JHQFLHVVXFKDV%/0136HWF
6WDWH$JHQFLHVVXFKDV'15$ODVND'HSDUWPHQWRI)LVKDQG*DPH$') *HWF
$ODVND5DLOURDG
5HJLRQDOJRYHUQPHQWV
$1&6$FRUSRUDWLRQVDQGWULEDORUJDQL]DWLRQV
&RPPXQLW\FRXQFLOV
$ODVND2XWGRRU&RXQFLODQGRWKHUUHFUHDWLRQRUJDQL]DWLRQV
$ODVND2XWGRRUV%XOOHWLQ%RDUG
&LWL]HQJURXSV
(QYLURQPHQWDORUJDQL]DWLRQV
%XVLQHVVUHSUHVHQWDWLYHVWREHLQWHUYLHZHGPD\LQFOXGHWKRVHDVVRFLDWHGZLWK
5HPRWHORGJHVFDELQUHQWDOVDFFRPPRGDWLRQVFDPSJURXQGV
5HVWDXUDQWV
$LUVWULSVDQGIO\LQJVHUYLFHVIOLJKWVHHLQJ
*XLGHVHUYLFHV
:KLWHZDWHUUDIWLQJERDWWULSV
7RXURSHUDWRUVDOOPRGHV
5HFUHDWLRQDOPLQLQJRSHUDWLRQV
7UDQVSRUWDWLRQVHUYLFHVLQFOXGLQJEXVHVDQG$ODVND5DLOURDG
7KHLQWHUYLHZSURWRFROJXLGHPD\LQFOXGHEXWLVQRWOLPLWHGWRWKHIROORZLQJWRSLFV
1DWXUHRIEXVLQHVVVHUYLFHHJJXLGHWRXURSHUDWRUDFFRPPRGDWLRQVHWF
(PSOR\PHQW
6HDVRQRIRSHUDWLRQHJ\HDUURXQGVXPPHUZLQWHUKXQWLQJHWF
0HDQVRIDFFHVVWRGHVWLQDWLRQHJIO\LQERDWURDGHWF
6SHFLILFDUHDVRIRSHUDWLRQZLWKLQWKHVWXG\DUHD
<HDUVRIRSHUDWLRQ
(VWLPDWHGQXPEHURIFOLHQWVSHU\HDU
&OLHQWPHPEHUVKLSLQIRUPDWLRQLQFOXGLQJRULJLQSDUW\VL]HJHQHUDOSHUFHSWLRQVRIDJH
RURWKHUGHPRJUDSKLFIHDWXUHV
)HHVFKDUJHG
:D\VWKDWXVHPLJKWFKDQJHXQGHUWKHYDULRXVRSHUDWLRQDODOWHUQDWLYHVLGHQWLILHGDQG
SRWHQWLDOLPSDFWVRQDUHDLPDJHILVKLQJKXQWLQJDQGRWKHUUHFUHDWLRQDFWLYLWLHV
3DVWDQGFXUUHQWSODQVSURJUDPVEXVLQHVVRSHUDWLRQVPHPEHUVKLSDFWLYLW\HWF
*HRJUDSKLFDUHDVRIKLJKHVWUHFUHDWLRQDOLQWHUHVWDQGUHDVRQVZK\
5HFUHDWLRQLQIUDVWUXFWXUHXVHGRUQHHGHG
,GHQWLILFDWLRQRIDQ\WUHQGVDQHFGRWDODQGGDWDVRXUFHVLQUHFUHDWLRQDOXVHOHYHOVRU
SDWWHUQV
,QIRUPDWLRQDERXWRWKHUSURMHFWVSURSRVHGLQWKHVWXG\DUHDWKDWFRXOGGLUHFWO\RU
LQGLUHFWO\DIIHFWUHFUHDWLRQWRXULVPRUDFFHVVWRWKHSUHYLRXVO\LQDFFHVVLEOHDUHDV
6XJJHVWLRQVIRUSULRULWL]LQJWKHKLJKHVWSRWHQWLDOUHFUHDWLRQGHPDQGLQWKHDUHD
2WKHUGDWDQHHGHGIRUVRFLRHFRQRPLFEDVHOLQHRURWKHUVRFLDOVFLHQFHUHVHDUFK
*,60DSVDQG)LJXUHV
5HFUHDWLRQDOVLWHVIDFLOLWLHVDQGDFFHVVURXWHV56ULJKWVRIZD\EHDVHPHQWVDQG
RWKHUUHFUHDWLRQXVHWUDLOVZLOOEHLGHQWLILHGDQGGLJLWL]HGLQD*,6XVLQJH[LVWLQJDJHQF\DQG
OLFHQVLQJSDUWLFLSDQWGDWDVHWVDQGDHULDOSKRWRJUDSK\7KHVHUHFUHDWLRQIHDWXUHVZLOOEH
³JURXQGWUXWKHG´YLDJURXQGDQGDLUEDVHGREVHUYDWLRQVDQGJHRUHIHUHQFHGZKHUHSRVVLEOH
)RFXVJURXSLQWHUYLHZVGLVFXVVLRQVZLWKOLFHQVLQJSDUWLFLSDQWVFRRUGLQDWLRQZLWKRWKHUUHVRXUFH
VWXG\GLVFLSOLQHVDQGXVHULQWHUFHSWVXUYH\VZLOODXJPHQWUHFUHDWLRQIDFLOLWLHVDQGWUDLOVPDSSLQJ
6LJQLILFDQWUHFUHDWLRQIDFLOLWLHVDQGDFFHVVSRLQWVZLOOEHSKRWRJUDSKHGIRULQFOXVLRQLQWKH
5HFUHDWLRQ5HVRXUFHV5HSRUW
10.5.5. Consistency with Generally Accepted Scientific Practice
7KHPHWKRGVDQGZRUNHIIRUWVRXWOLQHGLQWKLV6WXG\3ODQDUHWKHVDPHRUFRQVLVWHQWZLWK
DQDO\VHVXVHGE\DSSOLFDQWVDQGOLFHQVHHVDQGUHOLHGXSRQE\WKH&RPPLVVLRQLQRWKHU
K\GURHOHFWULFOLFHQVLQJSURFHHGLQJV7KHSURSRVHGPHWKRGRORJ\IRUDQDO\VLVIRUGHPDQGDQG
FDSDFLW\HVWLPDWHVDQGVXUYH\VDPSOLQJDUHFRPPRQO\HPSOR\HGLQWKHGHYHORSPHQWRI
K\GURHOHFWULFSURMHFWOLFHQVHDSSOLFDWLRQV
10.5.6. Schedule
8SRQDSSURYDOIRULPSOHPHQWDWLRQLWLVHVWLPDWHGWKDWWKHWHUPRIWKHVWXG\ZRXOGEH
DSSUR[LPDWHO\WZR\HDUV
Table 10.5-1. Recreation Resources Study Schedule. Description Start Date Completion Date
'DWD&ROOHFWLRQLQFOXGLQJVHDVRQDOILHOGYLVLWVDQGVXUYH\V -DQXDU\ 1RYHPEHU
,QYHQWRU\ -DQXDU\ 2FWREHU
$QDO\VLV 1RYHPEHU 1RYHPEHU
,QLWLDO6WXG\5HSRUW 'HFHPEHU
8SGDWHG6WXG\5HSRUW 'HFHPEHU
1362QO\RQH'HFHPEHUZLOOEHVDPSOHG7KHUHLVQR³ZLJJOHURRP´VKRXOG
ZHDWKHURURWKHUFRQGLWLRQVUHQGHUWKHOLPLWHGVDPSOHVHDVRQVLQDGHTXDWHWRUHSUHVHQW
DFWXDOSURMHFWDUHDFRQGLWLRQV7KHUHLVQRPHQWLRQRIZKHQUHVXOWVRIRWKHUVWXGLHV±LFH
PRUSKRORJ\ILVKDQGJDPHSRSXODWLRQVHWF±ZLOOEHLQKDQGDQGKRZWKHVHUHVXOWVZLOOEH
LQFRUSRUDWHGLQWKHUHFVWXG\UHSRUW6HHRXUFRPPHQWXQGHU2YHUDOO&RPPHQWVUHJDUGLQJ
LQWHUGHSHQGHQWVWXGLHV
10.5.7. Level of Effort and Cost
7KHHVWLPDWHRIWKHWZR\HDUUHFUHDWLRQVWXG\LV
10.5.8. Literature Cited
$ODVND(QHUJ\$XWKRULW\$($D6XVLWQD:DWDQD+\GURHOHFWULF3URMHFW6RFLRHFRQRPLF
5HFUHDWLRQ$LU4XDOLW\DQG7UDQVSRUWDWLRQ'DWD*DS$QDO\VLV3UHSDUHGE\+'5,QF
$QFKRUDJH
²E3UHDSSOLFDWLRQ'RFXPHQW6XVLWQD:DWDQD+\GURHOHFWULF3URMHFW)(5&3URMHFW
1R3UHSDUHGIRUWKH)HGHUDO(QHUJ\5HJXODWRU\&RPPLVVLRQ:DVKLQJWRQ'&
$ODVND'HSDUWPHQWRI1DWXUDO5HVRXUFHV$'150DWDQXVND6XVLWQD%RURXJK6XVLWQD
$UHD3ODQ$ODVND'HSDUWPHQWRI1DWXUDO5HVRXUFHV$ODVND'HSDUWPHQWRI)LVKDQG
*DPHDQG0DWDQXVND6XVLWQD%RURXJK$QFKRUDJH
²6XVLWQD%DVLQ5HFUHDWLRQ5LYHUV0DQDJHPHQW3ODQ$ODVND'HSDUWPHQWRI1DWXUDO
5HVRXUFHVDQG$ODVND'HSDUWPHQWRI)LVKDQG*DPH-XQHDX
²$ODVND5HFUHDWLRQDO7UDLOV3ODQ$ODVND'HSDUWPHQWRI1DWXUDO5HVRXUFHV'LYLVLRQ
RI3DUNVDQG2XWGRRU5HFUHDWLRQ-XQHDX$ODVND
²$ODVND¶V2XWGRRU/HJDF\6WDWHZLGH&RPSUHKHQVLYH2XWGRRU5HFUHDWLRQ3ODQ
6&253$ODVND'HSDUWPHQWRI1DWXUDO5HVRXUFHV-XQHDX
²6XVLWQD0DWDQXVND$UHD3ODQ$ODVND'HSDUWPHQWRI1DWXUDO5HVRXUFHV-XQHDX
$ODVND'HSDUWPHQWRI7UDQVSRUWDWLRQDQG3XEOLF)DFLOLWLHV$'27 3)*HRUJH3DUNV
+LJKZD\6FHQLF%\ZD\&RUULGRU3DUWQHUVKLS3ODQ3XEOLVKHGRQOLQHDW
KWWSGQUDODVNDJRYSDUNVSODQVJHRUJHSDUNVKZ\VFHQLFE\ZD\SGI
²*HRUJH3DUNV+LJKZD\6FHQLF%\ZD\0DVWHU,QWHUSUHWLYH3ODQLQGUDIW
3XEOLVKHGRQOLQHDW
KWWSGRWDODVNDJRYVWZGSOQJVFHQLFDVVHWV'5$)7B3DUNVB+Z\B0,3SGI
$ODVND'LYLVLRQRI3DUNVDQG2XWGRRU5HFUHDWLRQ'325'HQDOL6WDWH3DUN
0DQDJHPHQW3ODQ$ODVND'HSDUWPHQWRI1DWXUDO5HVRXUFHV-XQHDX
²$ODVND¶V'LYLVLRQRI3DUNVDQG2XWGRRU5HFUHDWLRQ7HQ<HDU6WUDWHJLF3ODQ
$ODVND'HSDUWPHQWRI1DWXUDO5HVRXUFHV-XQHDX
%XUHDXRI/DQG0DQDJHPHQW%/0(DVW$ODVND5HVRXUFH0DQDJHPHQW3ODQ86
'HSDUWPHQWRIWKH,QWHULRU%XUHDXRI/DQG0DQDJHPHQW*OHQQDOOHQ)LHOG2IILFH
*0$5HVHDUFK&RUSRUDWLRQ,PDJHVRI$ODVND$ODVND7UDYHO,QGXVWU\$VVRFLDWLRQ
+DU]D(EDVFR6XVLWQD-RLQW9HQWXUH+DU]D(EDVFR3UH$SSOLFDWLRQ'RFXPHQW$SSHQGL[
$HVWKHWLF9DOXHDQG9LVXDO$EVRUSWLRQ&DSDELOLW\5DWLQJV
0DWDQXVND6XVLWQD%RURXJK06%&KDVH&RPSUHKHQVLYH3ODQ0DWDQXVND6XVLWQD
%RURXJK3ODQQLQJDQG/DQG8VH'HSDUWPHQW3DOPHU
²7DONHHWQD&RPSUHKHQVLYH3ODQ06%3ODQQLQJDQG/DQG8VH'HSDUWPHQW3DOPHU
²06%3DUNVDQG5HFUHDWLRQ2SHQ6SDFH3ODQ0DWDQXVND6XVLWQD%RURXJK3ODQQLQJ
DQG/DQG8VH'HSDUWPHQW3DOPHU
²0DWDQXVND6XVLWQD%RURXJK&RPSUHKHQVLYH'HYHORSPHQW3ODQ0DWDQXVND6XVLWQD
%RURXJK3ODQQLQJDQG/DQG8VH'HSDUWPHQW3DOPHU
²0DWDQXVND6XVLWQD%RURXJK5HFUHDWLRQDO7UDLOV3ODQ$GRSWHG0DUFK
8SGDWHG$XJXVW0DWDQXVND6XVLWQD%RURXJK3ODQQLQJDQG/DQG8VH'HSDUWPHQW
3DOPHU
0F'RZHOO*URXS$ODVND9LVLWRU6WDWLVWLFV3URJUDP$ODVND'HSDUWPHQWRI&RPPHUFH
&RPPXQLW\DQG(FRQRPLF'HYHORSPHQW
1DWLRQDO3DUN6HUYLFH136)LQDO6RXWK'HQDOL,PSOHPHQWDWLRQ3ODQDQG
(QYLURQPHQWDO,PSDFW6WDWHPHQW86'HSDUWPHQWRIWKH,QWHULRU'HQDOL1DWLRQDO3DUN
DQG3UHVHUYH'HQDOL3DUN$ODVND
7,36WUDWHJLHV,QF0DWDQXVND6XVLWQD%RURXJK$ODVND&RPSUHKHQVLYH(FRQRPLF
'HYHORSPHQW6WUDWHJ\3UHSDUHGIRUWKH0DWDQXVND6XVLWQD%RURXJK3DOPHU
86'$)RUHVW6HUYLFH86)67KH5HFUHDWLRQ2SSRUWXQLW\6SHFWUXP$)UDPHZRUNIRU
3ODQQLQJ0DQDJHPHQWDQG5HVHDUFK86'HSDUWPHQWRI$JULFXOWXUH)RUHVW6HUYLFH
9DQGHU+RHN5&XOWXUDO5HVRXUFH0DQDJHPHQW3ODQIRUWKH'HQDOL+LJKZD\/DQGV
&HQWUDO$ODVND2IILFHRI+LVWRU\DQG$UFKDHRORJ\'LYLVLRQRI3DUNVDQG2XWGRRU
5HFUHDWLRQ$ODVND'HSDUWPHQWRI1DWXUDO5HVRXUFHV$QFKRUDJH
10.6. Aesthetics Resources Study
10.6.1. General Description of the Proposed Study
7KHJRDOVDQGREMHFWLYHVIRUWKH$HVWKHWLF5HVRXUFHV6WXG\DUHWRLQYHQWRU\DQGGRFXPHQW
EDVHOLQHDHVWKHWLFHJYLVXDODXGLWRU\FRQGLWLRQVLQWKH3URMHFWDUHDDQGHYDOXDWHWKHSRWHQWLDO
HIIHFWVRQDHVWKHWLFUHVRXUFHVEHQHILFLDORUDGYHUVHWKDWPD\UHVXOWIURPFRQVWUXFWLRQDQG
RSHUDWLRQRIWKHSURSRVHG3URMHFW
10.6.2. Existing Information and Need for Additional Information
([LVWLQJLQIRUPDWLRQZDVFRPSLOHGLQWKH5HFUHDWLRQ'DWD*DS$QDO\VLV$($DDQG
UHFUHDWLRQUHVRXUFHGHVFULSWLRQVDQGLQYHQWRU\SUHVHQWHGLQ$($
V3UHDSSOLFDWLRQ'RFXPHQW
3$'$($E$UHFUHDWLRQVWXG\ZDVLQLWLDWHGLQWRJDWKHUGDWDWRLQIRUPWKH
VWXG\SODQLQFOXGLQJWKHIROORZLQJHOHPHQWV
1367KHUHZDVQRDHVWKHWLFVLQYHQWRU\DVZRXOGEHXQGHUVWRRGE\WKDWWHUPLQ
DVRSSRVHGWRLQWKH3$'±QRUDJDSDQDO\VLV
,QWHUYLHZVZLWKNH\UHSUHVHQWDWLYHVRIDJHQFLHVDQGRUJDQL]DWLRQVLQFOXGLQJ$ODVND
1DWLYHHQWLWLHVNQRZOHGJHDEOHDERXWUHJLRQDODQGVWDWHUHFUHDWLRQPDQDJHPHQWDQG
LVVXHV
$FRPSLODWLRQRIH[LVWLQJUHFUHDWLRQLQYHQWRU\DQGFDSDFLW\LQIRUPDWLRQ
$QLQYHQWRU\RI3URMHFWDUHDDFFHVV
,QFLGHQWDO2EVHUYDWLRQ6XUYH\'DWDFRPSOHWHGE\ILHOGFUHZV
&RRUGLQDWLRQZLWKRWKHUVWXG\GLVFLSOLQHVDQGLQFRUSRUDWLRQRIGDWD
*HRUHIHUHQFHGPDSSLQJ
)LHOGUHFRQQDLVVDQFH
,GHQWLILFDWLRQRIIXWXUHWUHQGVDQGLVVXHV
$GHVFULSWLRQRIWKHPDQDJHPHQWIUDPHZRUN
,QWHUYLHZVZLWKNH\UHSUHVHQWDWLYHVRIDJHQFLHVDQGRUJDQL]DWLRQV
$VVHVVPHQWRIPDQDJHPHQWIUDPHZRUNVIRUSHUWLQHQWDJHQFLHV
,GHQWLILFDWLRQRIEURDG3URMHFWDUHDYLHZVKHGVDQGSUHOLPLQDU\.23VXVLQJWKRVH
LGHQWLILHGLQWKHOLFHQVHDSSOLFDWLRQ
3KRWRJUDSK\
)LHOGUHFRQQDLVVDQFH
'HVFULSWLRQRI3URMHFWDUHDVRXQGVFDSH
7KURXJKWKHSULRUSURFHVVHVWKH)(5&VFRSLQJSURFHVVDQGLQFRUSRUDWLRQRIZRUNJURXSDQG
RWKHUOLFHQVLQJSDUWLFLSDQWUHFRPPHQGDWLRQVVWXG\PHWKRGVIRUZHUHGHYHORSHG
,VVXHVWUHQGVRULJLQDOGDWDFROOHFWLRQVWUDWHJLHVDQGLWHPVIRUGHWDLOHGDQDO\VLVDUHLQFRUSRUDWHG
LQWRWKH6WXG\3ODQ
136³7KURXJKWKHSULRUSURFHVVHVWKH)(5&VFRSLQJSURFHVVVWXG\PHWKRGVIRU
were developed>HPSKDVLVDGGHG@´7KLVLVLQFRUUHFWWKH\DUHstill being
GHYHORSHG:HILQGWKLVYHU\VWUDQJHODQJXDJHWRLQFOXGHLQDproposedVWXG\SODQ136
KDVLQIDFWKDGOLWWOHWLPHDQGRSSRUWXQLW\WRVHHSURGXFWVDQGHQJDJHFRQVXOWDQWVVRIDUVR
LWLVH[WUHPHO\SUHPDWXUHWRFODLPWKLVDVfait accompli.
10.6.3. Study Area
7KHRYHUDOO3URMHFWDUHDLVVKRZQLQ)LJXUH7KHVSHFLILFVWXG\DUHDIRU$HVWKHWLF
5HVRXUFHVZLOOEHGHYHORSHGDVSDUWRIWKHDQDO\VLVDQGLQFRRUGLQDWLRQZLWKLQIRUPDWLRQIURP
RWKHUGLVFLSOLQHVVXFKDVK\GURORJ\,WZLOOEHEDVHGRQDYLHZVKHGPRGHORISURSRVHG3URMHFW
IHDWXUHVLQFOXGLQJWKHGDPVWUXFWXUHWUDQVPLVVLRQDQGURDGFRUULGRUVDQGWKHUHVXOWLQJ:DWDQD
UHVHUYRLU7KHVWXG\DUHDZLOODOVRLQFOXGHSRUWLRQVRIWKH6XVLWQD5LYHUORFDWHGGRZQVWUHDPRI
WKH:DWDQD'DPVLWHGRZQWR7DONHHWQD
136±$V136DQGRWKHUDJHQFLHVKDYHQRWHGGHFLGLQJWROLPLWWKHGRZQVWUHDPVFRSHRI
WKLVDQGRWKHUVWXGLHVWR7DONHHWQDLVWRWDOO\XQIRXQGHG8QWLOZHJHWWKHUHVXOWVRIWKH
LQVWUHDPIORZLFHIOXYLDOJHRPRUSKRORJ\ILVKDQGRWKHUVWXGLHVQRRQHFDQVD\KRZIDU
GRZQVWUHDPWKHSURMHFW¶VPHDVXUDEOHHIIHFWVRQYLVXDODQGDXGLWRU\UHVRXUFHVZLOOJR)RU
H[DPSOHDVSUHYLRXVO\QRWHGE\QXPHURXVFRPPHQWHUVQXPHURXVWLPHVWKHSURMHFW¶V
SURSRVHGDUWLILFLDOO\KLJKDQGYDULDEOHZLQWHUORDGIROORZLQJIORZVDUHKLJKO\OLNHO\WRDOWHUWKH
IRUPDWLRQRIVWDEOHLFHRQWKH6XVLWQDIDUGRZQVWUHDPRIWKHSURMHFW6SULQJIOXVKLQJIORZV
DQGVHGLPHQWWUDQVSRUWPD\EHODUJHO\HOLPLQDWHGDQGVXPPHUIORZVZLOOEHYHU\ORZLQDOO
SUREDELOLW\OHDGLQJWRPDMRUFKDQJHVLQWKHIRUPDWLRQDQGPDLQWHQDQFHRILVODQGVVORXJKV
VLGHFKDQQHOVEHDFKHVDQGULSDULDQYHJHWDWLRQ$JDLQQRRQH\HWNQRZVKRZIDU
GRZQVWUHDPRIWKH7DONHHWQDDQG&KXOLWQDFRQIOXHQFHWKHVHPDMRUFKDQJHVZLOOEHHYLGHQW
$OORIWKHVHDOWHUHGIHDWXUHVZLOOEHYLVLEOH136YHKHPHQWO\GLVDJUHHVDERXWWKLVSUHPDWXUH
GHFLVLRQZKLFKFRQWUDGLFWVVWDWHPHQWVHOVHZKHUHLQWKLVDQGRWKHU363VDFNQRZOHGJLQJWKH
QHHGWRUHO\RQWKHUHVXOWVRIRWKHUVWXGLHV:HZLOOQRWKDYHWKHVHUHVXOWVSULRUWR
ZKHQ136FRPPHQWVPXVWEHILQDOL]HGRUZKHQ)(5&¶VGHWHUPLQDWLRQRQ63VZLOO
EHPDGH
10.6.4. Study Methods
7KHYLVXDOUHVRXUFHLPSDFWDQDO\VLVZLOOIROORZPHWKRGVGHYHORSHGE\WKH%/0%/0
6SHFLILFPHWKRGRORJ\ZLOOEHDXJPHQWHGZLWKUHOHYDQWSRUWLRQVRIWKH86)69LVXDO0DQDJHPHQW
6\VWHP9066FHQHU\0DQDJHPHQW6\VWHP60686)6PHWKRGVDVFRQVLGHUDWLRQRI
WKLVDSSURDFKZLOOEHDQLPSRUWDQWDVSHFWRIEULGJLQJGDWDFROOHFWHGGXULQJWKH3$'
+DU]D(EDVFRDQGWKDWFROOHFWHGGXULQJWKHFXUUHQWVWXG\HIIRUW,WLVDOVRH[SHFWHGWKDW
WKH9LVXDO6HQVLWLYLW\$QDO\VLVZLOOEHH[SDQGHGEH\RQGZKDWLVXVHGE\WKH%/0DWWKH
SODQQLQJOHYHOWRLQFRUSRUDWHVXUYH\VIRFXVJURXSVDQGLQIRUPDWLRQFROOHFWHGWKURXJKWKH
VFRSLQJSURFHVV'DWDFROOHFWLRQDQGDQDO\VLVZLOOEHFRPSOHWHGDFURVVDOOIRXUVHDVRQV7KH
$HVWKHWLF5HVRXUFHV6WXG\LVLQWHUGHSHQGHQWZLWKDQDO\VHVFRQGXFWHGLQRWKHUGLVFLSOLQHVERWK
ELRSK\VLFDOHJK\GURORJ\DQGVRFLDOHJWUDQVSRUWDWLRQDQGFRRUGLQDWLRQRIGDWDZLWKRWKHU
VWXG\JURXSVZLOOEHVLJQLILFDQW
136±$JDLQWKLVDFNQRZOHGJHVLQWHUGHSHQGHQF\RIWKLVVWXG\RQUHVXOWVRIRWKHUVWXGLHV
EXWSURYLGHVQRGHWDLORQWLPLQJRIWKRVHGHOLYHUDEOHVDQGSURSRVHGVFKHGXOHIRUILQDOL]LQJ
GHWDLOVRIWKLV6HHDOVRRXUFRPPHQWVXQGHU³2YHUDOO&RPPHQWV´
'HILQH6WXG\$UHD
7KHSUHOLPLQDU\VWXG\DUHDLGHQWLILHGDVSDUWRIWKHZRUNZLOOEHUHILQHGEDVHGRQXSGDWHG
3URMHFWGHVLJQDQGVLWLQJ7KHYLHZVKHGZLOOEHJHQHUDWHGIRUDOO3URMHFWIHDWXUHVLQFOXGLQJURDGV
DQGWUDQVPLVVLRQOLQHVDQGUHILQHGLQFRRUGLQDWLRQZLWKIHGHUDOVWDWHDQGORFDODJHQFLHV7KH
VWXG\DUHDZLOOEHVXIILFLHQWLQVL]HWRDGGUHVVDOOHVWDEOLVKHGLQGLFDWRUVRIFKDQJHLQFOXGLQJ
SRWHQWLDOLQGLUHFWHIIHFWVWRUHFUHDWLRQFXOWXUDOUHVRXUFHVVXEVLVWHQFHDQGVRFLRHFRQRPLFV,WLV
H[SHFWHGWKDWWKLVDUHDZLOOLQFOXGHWKH6XVLWQD5LYHUGUDLQDJHDQGXSODQGDUHDVZKHUHYLHZVRI
WKHEDVLQDUHH[SHFWHGWRFKDQJHEDVHGRQFRQVWUXFWLRQDQGRURSHUDWLRQRIWKHSURSRVHG3URMHFW
9LHZVKHGPRGHOVZLOOEHGHYHORSHGIRUSUHDQGSRVW3URMHFWFRQGLWLRQVWRGHSLFWH[SHFWHG
FKDQJHVLQYLHZVKHGDUHDVLHFUHDWLRQRIQHZYLHZVORVVRIRWKHUV7KHVWXG\DUHDZLOODOVR
LQFOXGHFRPPRQDLUWUDQVSRUWDWLRQURXWHVXVHGIRUWUDQVSRUWDWLRQDQGUHFUHDWLRQDODLUWRXUV0DSV
GLVSOD\LQJWKHYLHZVKHGVDQGJHRJUDSKLFERXQGDU\RIWKHDQDO\VLVDUHDZLOOEHFUHDWHG
,PSRUWDQWYLHZVDQGYLVWDVLGHQWLILHGWKURXJKRWKHUUHVRXUFHUHYLHZVZLOOEHLGHQWLILHGDQG
SODFHGRQWKHYLHZVKHGPDS
(VWDEOLVK.H\2EVHUYDWLRQ3RLQWV
$ILQDOOLVWRI.23VZLOOEHGHYHORSHGXVLQJLQIRUPDWLRQIURPWKHOLFHQVHDSSOLFDWLRQ
+DU]D(EDVFRILHOGREVHUYDWLRQVLQRQJRLQJLQWHUGLVFLSOLQDU\LQWHUDJHQF\
FRRUGLQDWLRQDQG3URMHFWVFRSLQJ,WLVH[SHFWHGWKDW.23VZLOOGLIIHUE\ODQGVFDSHDQDO\VLV
IDFWRUVVXFKDVWKHLUGLVWDQFHIURPWKH3URMHFWSUHGRPLQDQWDQJOHRIREVHUYDWLRQGRPLQDQWXVH
LHUHFUHDWLRQRUWUDYHODQGDYHUDJHWUDYHOVSHHGDWZKLFKWKH3URMHFWFRXOGEHYLHZHG.23V
PD\UHSUHVHQWYLHZVH[SHULHQFHGDFURVVDOOVHDVRQVRUPD\EHVSHFLILFWRDSDUWLFXODUVHDVRQ
136.23V±'R136RWKHUUHVRXUFHDJHQFLHVDQGVWDNHKROGHUVJHWDVD\RQWKHVH"
:KHQ"7KLVLVVXSSRVHGWREH7KH3ODQQRWDSODQWRSODQ
%DVHOLQH'DWD&ROOHFWLRQ
)LHOGGDWDFROOHFWLRQZLOOLQFOXGHDFRPELQDWLRQRIVLWHYLVLWVE\KHOLFRSWHUDQGWUDYHORIXSVWUHDP
VHJPHQWVRIWKH6XVLWQD5LYHUE\ERDW$GGLWLRQDOLQIRUPDWLRQGHVFULELQJDFFHVVH[LVWLQJ
OLJKWLQJDQGPRYHPHQWZLOOEHUHFRUGHG%DVHOLQHSKRWRJUDSK\ZLOOEHFROOHFWHGDWDUHVROXWLRQ
VXIILFLHQWIRUXVHLQFRPSXWHUJHQHUDWHGYLVXDOVLPXODWLRQV
'DWDRQH[LVWLQJDHVWKHWLFUHVRXUFHYDOXHVZLOOEHFROOHFWHGXVLQJWKH%/0¶V9LVXDO5HVRXUFH
,QYHQWRU\95,PHWKRGRORJ\%/0'DWDFROOHFWLRQHIIRUWVZLOOLQFOXGHDQLQYHQWRU\RI
VFHQLFTXDOLW\YLVXDOVHQVLWLYLW\DQGGLVWDQFH]RQHVZLWKLQWKH6WXG\$UHD$OODUHDVZLOOEH
HYDOXDWHGZLWKLQWKHFRQWH[WRIYLHZHUH[SHULHQFHV)RUH[DPSOHYLHZVIURPURDGZD\VRUIURP
WKHSHUVSHFWLYHRIDERDWHUWUDYHOLQJGRZQULYHUZLOOEHHVWDEOLVKHGDV³OLQHDU´RU³URYLQJ´.23V
'DWDFROOHFWLRQPHWKRGVDUHGHVFULEHGEHORZ
Scenic Quality
6FHQLFTXDOLW\RIWKH3URMHFWDUHDZLOOEHGHWHUPLQHGWKURXJKWKH95,SURFHVV%/07KLV
SURFHVVHQWDLOVGLYLGLQJWKHODQGVFDSHLQWR6FHQLF4XDOLW\5DWLQJ8QLWV6458VEDVHGRQ
FRQVSLFXRXVFKDQJHVLQSK\VLRJUDSK\RUODQGXVHDQGUDQNLQJVFHQLFTXDOLW\ZLWKLQHDFK6458
EDVHGRQWKHDVVHVVPHQWRIVHYHQNH\IDFWRUVODQGIRUPYHJHWDWLRQZDWHUFRORUDGMDFHQW
VFHQHU\VFDUFLW\DQGFXOWXUDOPRGLILFDWLRQ(DFKNH\IDFWRULVVFRUHGDQGWKHYDOXHRIHDFKLV
DGGHGWRGHULYHDQRYHUDOOVFRUHIRUWKHXQLW%DVHGRQWKHVHUHVXOWVHDFK6458LVDVVLJQHGD
VFHQLFTXDOLW\UDWLQJRI$%RU&ZLWK$UHSUHVHQWLQJWKHKLJKHVWVFHQLFTXDOLW\DQG&
UHSUHVHQWLQJWKHORZHVWVFHQLFTXDOLW\
Visual Sensitivity
9LHZHUVHQVLWLYLW\ZLOOEHFODVVLILHGXVLQJWKH%/09LVXDO6HQVLWLYLW\/HYHO$QDO\VLV6/$
%/07KH6/$ZLOOEHFRPSOHWHGLQWZRVWHSVGHOLQHDWLRQRI6HQVLWLYLW\/HYHO
5DWLQJ8QLWV6/58VDQGUDWLQJYLVXDOVHQVLWLYLW\ZLWKLQHDFK6/58%\GHILQLWLRQ6/58V
UHSUHVHQWDJHRJUDSKLFDUHDZKHUHSXEOLFVHQVLWLYLW\WRFKDQJHRIWKHYLVXDOUHVRXUFHVLVVKDUHG
DPRQJVWFRQVWLWXHQWV7KHXQLWERXQGDULHVPD\EHGHILQHGE\DVLQJOHIDFWRUGULYLQJWKH
VHQVLWLYLW\FRQVLGHUDWLRQRUIDFWRUVGULYLQJVHQVLWLYLW\PD\H[WHQGDFURVVQXPHURXV6/58V
8QLWVDUHWKXVGHULYHGLQSDUWE\WKHFRQVLGHUDWLRQRIIDFWRUVDQDO\]HGLQWKH6/$9LVXDO
VHQVLWLYLW\ZLWKLQHDFK6/58LVHVWLPDWHGDVKLJKPHGLXPRUORZEDVHGRQWKHW\SHVRIXVHUV
DPRXQWRIXVHSXEOLFLQWHUHVWDGMDFHQWODQGXVHDQGODQGXVHGHVLJQDWLRQV,QIRUPDWLRQUHTXLUHG
IRUWKLVDQDO\VLVZLOOEHREWDLQHGWKURXJKODQGXVHSODQUHYLHZGDWDFROOHFWHGE\RWKHUUHVRXUFH
GLVFLSOLQHVDQGVXUYH\VDQGRUIRFXVJURXSV7KHGDWDFROOHFWHGWKURXJKVXUYH\VDQGIRFXV
JURXSVZLOOEHFRRUGLQDWHGZLWKWKHVHWFRQGXFWHGIRUWKH5HFUHDWLRQ5HVRXUFHV6WXG\
5HVSRQGHQWVZLOOEHDVNHGDERXWWKHLUSODFHEDVHGYLVXDOSUHIHUHQFHV
Visual Distance Zones
'LVWDQFH]RQHVUHSUHVHQWWKHGLVWDQFHIURPZKLFKWKHODQGVFDSHLVPRVWFRPPRQO\YLHZHG
7KHVH]RQHVZLOOEHHVWDEOLVKHGE\EXIIHULQJFRPPRQWUDYHOURXWHVDQGYLHZHUORFDWLRQVDW
GLVWDQFHVRIPLOHVPLOHVDQGPLOHVXVLQJ*,6%/0
1367KHUHLVQRPHQWLRQRIDVVHVVLQJWKHDHVWKHWLFVRIYDU\LQJIORZV7KLVLVDKLJK
YROXPHJODFLDOULYHUIORZLQJDWXSWRPSK±WKHVLJKWDQGVRXQGRILWVIORZVFRORURILWV
ZDWHUPL[LQJDWFOHDUZDWHUWULEXWDULHVDUHPDMRUFRPSRQHQWVRIULYHUUHODWHGUHFUHDWLRQ
1HHGWRGRWKLVDW.23VDORQJWKHULYHULQDOOVHDVRQVXVLQJYLGHRJUDSK\VRXQG1HHGWR
DGGWR6RXQGDQDO\VLVWRR
3KRWR6LPXODWLRQV
7RVXSSRUWWKHYLVXDOUHVRXUFHLPSDFWDQDO\VLVDQGWRGLVFORVHH[SHFWHGYLVLELOLW\RI3URMHFW
FRPSRQHQWVIURPYDULRXVYDQWDJHSRLQWVSKRWRVLPXODWLRQVZLOOEHSUHSDUHG6LPXODWLRQVZLOOEH
SURGXFHGE\UHQGHULQJ3URMHFWFRPSRQHQWVWXUELQHVVXEVWDWLRQVDFFHVVURDGVHWFZLWK
GLPHQVLRQDO'FRPSXWHUPRGHOVDQGVXSHULPSRVLQJWKHVHLPDJHVRQWRSKRWRJUDSKVWDNHQ
IURP.23V0RGHOSDUDPHWHUVZLOODFFRXQWIRUHQYLURQPHQWDOIDFWRUVVXFKDVVHDVRQVYLHZLQJ
DQJOHDQGOLJKWFRQGLWLRQVUHVXOWLQJLQDQDFFXUDWHYLUWXDOUHSUHVHQWDWLRQRIWKHDSSHDUDQFHRI
WKHSURSRVHG3URMHFW6LPXODWLRQVZLOOEHSURGXFHGWRLOOXVWUDWHWKHVWUXFWXUHGRZQULYHU
ODQGVFDSHFKDUDFWHULVWLFVUHVHUYRLUODQGVFDSHFKDUDFWHULVWLFVDFFHVVURDGVDQG
WUDQVPLVVLRQOLQHVYLHZVRIUHVHUYRLUIURPXSODQGDUHDVDQGYLHZVRISRWHQWLDO
FRQVWUXFWLRQUHODWHGLPSDFWV$GGLWLRQDOVLPXODWLRQVDQGRUYLGHRJUDSK\ZLOOEHSURGXFHGDV
QHHGHGLQNH\DUHDV6LPXODWLRQVZLOOEHFRPSOHWHGE\VHDVRQVDQGXQGHUGD\OLJKWDQGQLJKWWLPH
FRQGLWLRQV
9LVXDO5HVRXUFHV$QDO\VLV
%/0FRQWUDVWUDWLQJSURFHGXUHVZLOOEHXVHG%/07KHYLVXDOUHVRXUFHLPSDFWDQDO\VLV
IRFXVHVRQHVWDEOLVKHGLQGLFDWRUVRIFKDQJH,QGLFDWRUVZLOOLQFOXGHEXWZLOOQRWEHOLPLWHGWRWKH
IROORZLQJ
,PSDFWVWRYLVXDOUHVRXUFHVPHDVXUHGE\WKHGHJUHHRIYLVXDOFRQWUDVWFUHDWHGE\WKH
3URMHFW
&KDQJHLQH[LVWLQJ95,YDOXHVRIVFHQLFTXDOLW\YLVXDOVHQVLWLYLW\DQGGLVWDQFH]RQHV
,QWURGXFWLRQRIQHZVRXUFHVRIOLJKWDQGJODUH
&KDQJHLQWKHYLHZVKHGDUHDLQFOXGLQJERWKWKHHOLPLQDWLRQDQGFUHDWLRQRIYLHZVDQG
YLVWDV
&KDQJHLQWKHPHFKDQLVPRIYLHZHJWUDQVLWLRQIURPPRELOHYLHZWUDYHOLQJGRZQULYHU
WRDVWDWLFYLHZZKHQVLWXDWHGRQWKHUHVHUYRLU
&KDQJHLQYLVLELOLW\WKDWPD\UHVXOWIURP3URMHFWUHODWHGGXVW
0HWKRGRORJ\XVHGWRDGGUHVVHDFKLQGLFDWRULVGHVFULEHGEHORZ
Contrast Rating Analysis
7KH%/0&RQWUDVW5DWLQJSURFHGXUHZLOOEHXVHGWRGHWHUPLQHYLVXDOFRQWUDVWWKDWPD\UHVXOW
IURPWKHFRQVWUXFWLRQDQGRSHUDWLRQRIWKH3URMHFWEDVHGRQSKRWRVLPXODWLRQVGHSLFWLQJ3URMHFW
IHDWXUHV7KLVPHWKRGDVVXPHVWKDWWKHH[WHQWWRZKLFKWKH3URMHFWUHVXOWVLQDGYHUVHHIIHFWVWR
YLVXDOUHVRXUFHVLVDIXQFWLRQRIWKHYLVXDOFRQWUDVWEHWZHHQWKH3URMHFWDQGWKHH[LVWLQJ
ODQGVFDSHFKDUDFWHU,PSDFWGHWHUPLQDWLRQVZLOOEHEDVHGRQWKHLGHQWLILHGOHYHORIFRQWUDVWDQG
DUHQRWDPHDVXUHRIWKHRYHUDOODWWUDFWLYHQHVVRIWKH3URMHFW%/0
$WHDFK.233URMHFWIHDWXUHVZLOOEHHYDOXDWHGXVLQJSKRWRVLPXODWLRQVDQGGHVFULEHGXVLQJWKH
VDPHEDVLFHOHPHQWVRIIRUPOLQHFRORUDQGWH[WXUHXVHGGXULQJWKHEDVHOLQHHYDOXDWLRQ7KH
OHYHORISHUFHLYHGFRQWUDVWEHWZHHQWKHSURSRVHG3URMHFWDQGWKHH[LVWLQJODQGVFDSHZLOOEH
FODVVLILHGXVLQJWKHIROORZLQJGHILQLWLRQV
1RQH7KHHOHPHQWFRQWUDVWLVQRWYLVLEOHRUSHUFHLYHG
:HDN7KHHOHPHQWFRQWUDVWFDQEHVHHQEXWGRHVQRWDWWUDFWDWWHQWLRQ
0RGHUDWH7KHHOHPHQWFRQWUDVWEHJLQVWRDWWUDFWDWWHQWLRQDQGEHJLQVWRGRPLQDWHWKH
FKDUDFWHULVWLFODQGVFDSH
6WURQJ7KHHOHPHQWFRQWUDVWGHPDQGVDWWHQWLRQZRXOGQRWEHRYHUORRNHGDQGLV
GRPLQDQWLQWKHODQGVFDSH
7KHOHYHORIFRQWUDVWZLOOEHDVVHVVHGIRUDOO3URMHFWFRPSRQHQWVXVHGGXULQJFRQVWUXFWLRQ
RSHUDWLRQVDQGPDLQWHQDQFHDQGGHFRPPLVVLRQLQJRIWKHSURSRVHG3URMHFW
Visual Resource Inventory Analysis
7KH95,DQDO\VLVZLOOEHXVHGWRLGHQWLI\H[SHFWHGFKDQJHWR95,FODVVHVEDVHGRQFKDQJHVWR
WKHYLVXDOUHVRXUFHYDOXHVRIVFHQLFTXDOLW\YLVXDOVHQVLWLYLW\DQGRUGLVWDQFH]RQHVWKDWPD\
UHVXOWIURPRSHUDWLRQRIWKHSURSRVHG3URMHFW7KLVDQDO\VLVZLOOEHFRPSOHWHGZLWKLQWKH
IUDPHZRUNVWXG\DUHDZLWKWKHJRDORIXQGHUVWDQGLQJKRZYLVXDOUHVRXUFHYDOXHVDQGUHVXOWLQJ
95,FODVVPD\VKLIWEDVHGRQRSHUDWLRQRIWKHSURSRVHG3URMHFWLQFOXGLQJWKHGDPDFFHVVURDGV
DQGWUDQVPLVVLRQOLQHV,PSDFWVWR95,FRPSRQHQWVZLOOEHHYDOXDWHGE\UDQNLQJHDFKNH\IDFWRU
XVHGWRFODVVLI\VFHQLFTXDOLW\YLVXDOVHQVLWLYLW\DQGGLVWDQFH]RQHVXQGHURSHUDWLRQDO
FRQGLWLRQVDQGFRPSDULQJWKRVHYDOXHVWRWKDWGHWHUPLQHGWKURXJKWKHHVWDEOLVKHGSUH3URMHFW
95,
Light and Glare
7KHLPSDFWDQDO\VLVIRUOLJKWDQGJODUHZLOOIRFXVRQSRWHQWLDOLPSDFWVWKDWPD\UHVXOWIURP
QLJKWWLPHDUWLILFLDOOLJKWLQJDQGRUGD\WLPHJODUH7KHDQDO\VLVRIDUWLILFLDOOLJKWLQJZLOOLGHQWLI\
SRWHQWLDOLPSDFWVWRKXPDQDFWLYLW\DWQHDUE\RIIVLWHORFDWLRQVWKDWPD\UHVXOWIURPWKHSURSRVHG
3URMHFW3KRWRVLPXODWLRQVZLOOEHSURGXFHGWRGHPRQVWUDWHYLHZVRIWKHSURSRVHG3URMHFWDW
QLJKWIURPVHOHFWHG.23V
Change in Viewshed Area and Mechanism of View
9LHZVKHGDQDO\VLVSHUIRUPHGIRUERWKSUHDQGSRVW3URMHFWFRQGLWLRQVZLOOEHFRPSDUHGWR
LGHQWLI\WKHFKDQJHVLQYLHZVKHGDQGPHFKDQLVPRIYLHZ7KHVHGDWDZLOOTXDQWLI\WKHH[WHQWRI
FKDQJHVLQYLHZVDQGWKHGHJUHHWRZKLFKDFFHVVWRYLHZVFKDQJHVZLWKWKHGHYHORSPHQWRI
URDGVDQGWKHHOHYDWLRQRIWKHYLHZHUZLWKLQWKHLQXQGDWHGSRUWLRQVRIWKHUHVHUYRLU
Change in Visibility
'DWDJHQHUDWHGE\WKH$LU4XDOLW\5HVRXUFHGLVFLSOLQHZLOOEHXVHGWRGHWHUPLQHWKHSRWHQWLDOIRU
FKDQJHVLQYLVLELOLW\WKDWPD\UHVXOWIURPFRQVWUXFWLRQDQGRURSHUDWLRQRIWKHSURSRVHG3URMHFW
DQGUHODWHGUHFUHDWLRQUHVRXUFHYDOXHV5HVXOWVIURPWKHDLUTXDOLW\GXVWDQDO\VLVZLOOEH
LQFRUSRUDWHGLQWKLVVWXG\
6RXQG$QDO\VLV
$V\VWHPDWLFVRXQGVWXG\ZLOOEHFRQGXFWHGWRFKDUDFWHUL]HWKHH[LVWLQJDPELHQWVRXQG
HQYLURQPHQWLQWKHYLFLQLW\RIWKHSURSRVHG3URMHFWDQGHVWLPDWHWKHSRWHQWLDOLPSDFWDVVRFLDWHG
ZLWKFRQVWUXFWLRQDQGRSHUDWLRQDODFWLYLWLHV
7KHVWHSVLQWKHVRXQGDQDO\VLVDUHGHVFULEHGEHORZ
Review Documentation and Develop Data Needs
5HOHYDQW3URMHFWGDWDZLOOEHUHYLHZHGLQFOXGLQJWKHPRVWFXUUHQW3URMHFWGHVFULSWLRQRSHUDWLQJ
DQGFRQVWUXFWLRQHTXLSPHQWURVWHUVFRQVWUXFWLRQVFKHGXOHV$PELHQWVRXQGGDWDUHFRUGHGLQWKH
DUHDRULQDVLPLODUDUHDZLOOEHREWDLQHG%DVHGXSRQWKLVUHYLHZLWHPL]HGGDWDUHTXLUHPHQWV
ZLOOEHGHYHORSHGWKDWZRXOGEHQHHGHGWRSHUIRUPSUHGLFWLYHVRXQGHPLVVLRQPRGHOLQJ%DVHG
RQWKLVUHYLHZDVHWRIRXWGRRUDPELHQWVRXQGOHYHOVXUYH\VLQWKHYLFLQLW\RIWKH3URMHFWDUHDZLOO
EHREWDLQHG7KHGDWDUHTXLUHPHQWVZLOOLQFOXGHDQWLFLSDWHGFDWHJRULHVRIVWDWLRQDU\DQGPRELOH
FRQVWUXFWLRQHTXLSPHQWDQGWKHLUIUHTXHQF\RIRSHUDWLRQORFDWLRQVRIQHDUHVWUHSUHVHQWDWLYH
QRLVHVHQVLWLYHUHFHLYHUV165UHFUHDWLRQVLWHV56DQGVRXQGGDWDRUVSHFLILFDWLRQV
DVVRFLDWHGZLWKLQWHQGHGRSHUDWLQJGDPV\VWHPVDQGSURFHVVHV/DZVRUGLQDQFHVUHJXODWLRQV
DQGVWDQGDUGVWKDWPD\LQIOXHQFHWKHVRXQGLPSDFWDVVHVVPHQWIRUWKLVVWXG\ZLOODOVREH
LQYHQWRULHG
Seasonal Surveys of Ambient Sound Levels
$PELHQWVRXQGOHYHOPHDVXUHPHQWVZLOOEHFROOHFWHGLQWKH3URMHFWYLFLQLW\7KHVHZLOOLQFOXGH
XQDWWHQGHGORQJWHUP>/7@´DPLQLPXPRIFRQWLQXRXVKRXUVXSWRDVLQJOHZHHNVRXQG
OHYHOPRQLWRULQJDWXSWRDWRWDORIIRXUUHSUHVHQWDWLYH165RU56ORFDWLRQVDQGXSWRDWRWDORI
DWWHQGHGVKRUWWHUP>67@HJPLQXWHVGXUDWLRQHDFKGD\WLPHDQGQLJKWWLPHVRXQG
PHDVXUHPHQWVWRKHOSFKDUDFWHUL]HWKHDIIHFWHGHQYLURQPHQW2EVHUYDWLRQVRISHUFHLYHGDQG
LGHQWLILDEOHVRXUFHVRIVRXQGFRQWULEXWLQJWRWKHDPELHQWVRXQGHQYLURQPHQWDQGWKHFRQGLWLRQV
GXULQJZKLFKWKH\RFFXUZLOOEHGRFXPHQWHGDVSDUWRIWKHILHOGVXUYH\7KLVVXUYH\ZLOOEH
FRQGXFWHGXSWRIRXUWLPHVDVVRFLDWHGZLWKXSWRIRXUGLVWLQFWVHDVRQVHJVXPPHUIDOOZLQWHU
VSULQJEXWIRUDPLQLPXPRIWZRVHDVRQVFRQVLVWHQWZLWK1361DWXUDO6RXQGV3URJUDP163
SXEOLVKHGJXLGHOLQHV1367RWKHH[WHQWSUDFWLFDEOHWKHVXUYH\ORFDWLRQVZLOOEHWKH
VDPHIRUHDFKVXUYH\HGVHDVRQ
136:KHQGRZHGHFLGHZKHUHWKHIRXU/7DQG67ORFDWLRQVZLOOEH":KDWLIZHWKLQN
WKHUHVKRXOGEHPRUH"$JDLQQHHGWRDJUHHDERXWWKLVSULRUWR136ZRXOGOLNHWR
KDYHHQRXJKDGYDQFHGHWDLOWRLQYROYHRXU6RXQGVFDSHVVWDIILQUHYLHZLQJWKLV
PHWKRGRORJ\
Modeling of Project Sound Levels.
8SWRWKUHHVFHQDULRVRUDOWHUQDWLYHVRIIXWXUH3URMHFWRSHUDWLRQDOVRXQGOHYHOVZLOOEHHVWLPDWHG
ZLWK6\VWHPIRUWKH3UHGLFWLRQRI$FRXVWLF'HWHFWDELOLW\63UH$'&RPSXWHU$LGHG1RLVH
$EDWHPHQW&$'1$$DQLQGXVWU\DFFHSWHGRXWGRRUVRXQGSURSDJDWLRQPRGHOLQJSURJUDP
FRXOGDOVREHXVHG6RXQG$GYLFH$FRXVWLFV/WG3UHGLFWHGVRXQGOHYHOLVRSOHWKVRU
³VRXQGFRQWRXUV´ZLOOEHVXSHULPSRVHGRQVXLWDEOHDHULDOSKRWRJUDSKVRUPDSVRIWKH3URMHFW
YLFLQLW\DQGZLOOLQFOXGHVSHFLILFVRXQGOHYHOSUHGLFWLRQDWVHOHFWHGPHDVXUHPHQWDQGRU
DVVHVVPHQWORFDWLRQVIURPWKHDPELHQWVRXQGILHOGVXUYH\VRI7DVN3UHGLFWHGVRXQGHPLVVLRQV
DVVRFLDWHGZLWKERWK3URMHFWFRQVWUXFWLRQDQGRSHUDWLRQXVLQJGLIIHUHQWWUDQVSRUWDWLRQURXWH
RSWLRQVZLOODOVREHDVVHVVHG
*,60DSVDQG)LJXUHV
9LHZVKHGV.23VDQGVRXQGVFDSHVZLOOEHPDSSHGDV*,6OD\HUVDFFRUGLQJWR3URMHFW
VWDQGDUGV0DSSLQJZLOODOVRLGHQWLI\UHOHYDQWPDQDJHPHQWVWDQGDUGVZLWKLQWKHVWXG\DUHD
6LJQLILFDQWYLVXDOIHDWXUHVZLOOEHSKRWRJUDSKHGIRULQFOXVLRQLQWKH$HVWKHWLF5HVRXUFHV5HSRUW
9LVXDOVLPXODWLRQVGHSLFWLQJWKHDSSHDUDQFHRIWKHSURSRVHG3URMHFWZLOOEHSURGXFHGIRUD
VXEVHWRI.23VDQGXVHGWRLQIRUPWKHLPSDFWDQDO\VLV
10.6.5. Consistency with Generally Accepted Scientific Practice
7KHPHWKRGVDQGZRUNHIIRUWVRXWOLQHGLQWKLV6WXG\3ODQDUHWKHVDPHRUFRQVLVWHQWZLWK
DQDO\VHVXVHGE\DSSOLFDQWVDQGOLFHQVHHVDQGUHOLHGXSRQE\WKH&RPPLVVLRQLQRWKHU
K\GURHOHFWULFOLFHQVLQJSURFHHGLQJV7KH$HVWKHWLFVVWXGLHVDUHEDVHGRQWKH%/0¶VYLVXDO
UHVRXUFHVPHWKRGRORJ\7KHVRXQGDQDO\VLVLVFRQVLVWHQWZLWK1DWLRQDO3DUN6HUYLFH*XLGHOLQHV
10.6.6. Schedule
8SRQLPSOHPHQWDWLRQLWLVHVWLPDWHGWKDWWKHWHUPRIWKHVWXGLHVZLOOEHDSSUR[LPDWHO\WZR
\HDUV
Table 10.6-1. Aesthetic Resources Study Schedule. Description Start Date Completion Date Duration
(months)
'DWD&ROOHFWLRQLQFOXGLQJVHDVRQDOILHOGYLVLWVDQGVRXQGPRQLWRULQJ -DQXDU\ 1RYHPEHU
,QYHQWRU\ -DQXDU\ 2FWREHU
,QLWLDO6WXG\5HSRUW 2FWREHU 'HFHPEHU
$QDO\VLV 1RYHPEHU 0DUFK
8SGDWHG6WXG\5HSRUW $SULO 'HFHPEHU
136YHU\VKRUWDQGQRZRUNLQDQ\'HFHPEHU,QLWLDOVWXG\UHSRUWLVVFKHGXOHGIRU±
ZLOOWKLVDOORZLQWHJUDWLRQRIUHVXOWVRIRWKHUELRSK\VLFDOVWXGLHV"
10.6.7. Level of Effort and Cost
7KHHVWLPDWHRILQFOXGHVWKHIROORZLQJFRPSRQHQWVRYHUWZRIXOO\HDUVRIVWXG\
10.6.8. Literature Cited
$($$ODVND(QHUJ\$XWKRULW\D6XVLWQD:DWDQD+\GURHOHFWULF3URMHFW6RFLRHFRQRPLF
5HFUHDWLRQ$LU4XDOLW\DQG7UDQVSRUWDWLRQ'DWD*DS$QDO\VLV3UHSDUHGE\+'5,QF
$QFKRUDJH
²E3UHDSSOLFDWLRQ'RFXPHQW6XVLWQD:DWDQD+\GURHOHFWULF3URMHFW)(5&3URMHFW
1R'HFHPEHU3UHSDUHGIRUWKH)HGHUDO(QHUJ\5HJXODWRU\&RPPLVVLRQ
:DVKLQJWRQ'&
$LU5HVRXUFH6SHFLDOLVWV$56:LQ+D]H0RGHOLQJ6RIWZDUH3XEOLVKHGRQOLQHDW
KWWSYLVWDFLUDFRORVWDWHHGXLPSURYH7RROVWRROVKWP$FFHVVHG
%XUHDXRI/DQG0DQDJHPHQW%/09LVXDO5HVRXUFH,QYHQWRU\%/0+DQGERRN
:DVKLQJWRQ'&
+DU]D(EDVFR6XVLWQD-RLQW9HQWXUH+DU]D(EDVFR3UH$SSOLFDWLRQ'RFXPHQW$SSHQGL[
$HVWKHWLF9DOXHDQG9LVXDO$EVRUSWLRQ&DSDELOLW\5DWLQJV3UHSDUHGIRUWKH$ODVND
3RZHU$XWKRULW\$QFKRUDJH$ODVND
1DWLRQDO3DUN6HUYLFH136³,QWKH)LHOG´3XEOLVKHGRQOLQHDW
KWWSQDWXUHQSVJRYVRXQGILHOGFIP$FFHVVHG
5HHG6(-/%RJJVDQG-30DQQ63UH$'*,6DQ$UF*,6WRROER[IRUPRGHOLQJWKH
SURSDJDWLRQRIHQJLQHQRLVHLQDZLOGODQGVHWWLQJ9HUVLRQ7KH:LOGHUQHVV6RFLHW\
6DQ)UDQFLVFR&$86'HSDUWPHQWRIWKH,QWHULRU1DWLRQDO3DUN6HUYLFH$ODVND
5HJLRQDO2IILFH0DUFK
6RXQG$GYLFH$FRXVWLFV/WG³&$'1$3UHGLFWLRQ6RIWZDUH´3XEOLVKHGRQOLQHDW
KWWSZZZVRXQGDGYLFHDFRXVWLFVFRXNSUHGLFWLRQBVRIWZDUHSKS$FFHVVHG
7,36WUDWHJLHV,QF0DWDQXVND6XVLWQD%RURXJK$ODVND&RPSUHKHQVLYH(FRQRPLF
'HYHORSPHQW6WUDWHJ\3UHSDUHGIRUWKH0DWDQXVND6XVLWQD%RURXJK3DOPHU
86'$)RUHVW6HUYLFH86)67KH9LVXDO0DQDJHPHQW6\VWHP$JULFXOWXUH+DQGERRN
1XPEHU
²/DQGVFDSH$HVWKHWLFV$+DQGERRNIRU6FHQHU\0DQDJHPHQW
10.7. Recreational Boating / River Access Study
136±&RQVLGHUFKDQJLQJWKHWLWOHRIWKLVVWXG\WR³)ORZ'HSHQGHQW5HFUHDWLRQ´UHIOHFWLQJ
WKHEURDGHUDIIHFWHGDFWLYLWLHVEH\RQGERDWLQJDQGILVKLQJ7KH6WXG\¶VWLWOHDQGVRPHLQLWLDO
VWDWHPHQWVDERXWVFRSHDUHFRQWUDGLFWRU\6WXG\JRDOLVQRWPHUHO\WRFRQWULEXWHGDWD
FRQFHUQLQJUHFUHDWLRQDOERDWLQJDQGDFFHVV±LWLVWRORRNDWDOOIRUPVRIIORZGHSHQGHQWUHF
7KDWZRXOGLQFOXGHDFWLYLWLHVOLNHILVKLQJWKDWDUHDIIHFWHGE\IORZVHJLIVDOPRQGLVDSSHDU
EHFDXVHQRPRUHVSDZQLQJKDELWDWRULI\RXFDQ¶WVNLPXVKRUVQRZPDFKLQHWKHULYHU
DQ\PRUHGXHWRXQVWDEOHLFHUHJDUGOHVVRIZKHWKHU\RX¶UHGRLQJLWLQDERDWRUIURPVKRUH
136$HVWKHWLFVFDQEHIORZGHSHQGHQWVWLOOZDWHULQUHVYIUHHIORZLQJVWUHDPORVWVLJKW
DQGVRXQGRIZKLWHZDWHUDWKLJKIORZVLQ'&PRUSKRORJLFDODQGYHJHWDWLRQFKDQJHV
GRZQVWUHDPGXHWRFKDQJHGIORZUHJLPH7KHUHLVQRPHQWLRQRIWKLVLQWKLVRUWKH
$HVWKHWLFV363
136±7KHUHLVDOVRQRPHQWLRQRIZKHWKHULPSDFWVRQUHFDFFHVVDQGH[SHULHQFHVGXHWR
FKDQJHGLFHDQGVQRZFRYHUUHVXOWLQJIURPFKDQJHGIORZUHJLPHZLOOEHDVVHVVHGXQGHUWKLV
363,WVKRXOGEHLQFOXGHG
10.7.1. General Description of the Proposed Study
7KLVVWXG\LQFRUSRUDWHVDQGFRQWULEXWHVWRGDWDDQGDQDO\VLVFRQGXFWHGDVSDUWRIWKH5HFUHDWLRQ
5HVRXUFHV6WXG\6HFWLRQ,QWKHRYHUDOOUHFUHDWLRQVWXG\UHFUHDWLRQDOERDWLQJXVHVDQG
ULYHUDFFHVVSRLQWVZLOOEHLGHQWLILHG&XUUHQWDQGIXWXUHXVHRIWKHULYHUE\ERWKPRWRUL]HGDQG
QRQPRWRUL]HGERDWXVHUVZLOODOVREHHVWLPDWHGWKHUHLQ%HFDXVHWKH3URMHFWZLOODIIHFWULYHU
IORZUHJLPHVLQFOXGLQJWKHLQXQGDWLRQRIDERXWPLOHVRIWKHULYHUDQGEHFDXVHFKDQJHVLQ
ULYHUIORZUHJLPHVPD\GLUHFWO\LPSDFWERDWLQJDQGRWKHUIORZGHSHQGHQWUHFUHDWLRQDFWLYLWLHVD
VSHFLILFPHWKRGRORJ\RIUHFUHDWLRQDOIORZDQDO\VLVLVDOVRSURSRVHG
6WXG\*RDOVDQG2EMHFWLYHV
7KHJRDORIWKH5HFUHDWLRQDO%RDWLQJ5LYHU$FFHVV6WXG\LVWRFRQWULEXWHGDWDWRWKH
5HFUHDWLRQ5HVRXUFH6WXG\FRQFHUQLQJUHFUHDWLRQDOERDWLQJDQGDFFHVV
7KHJRDODQGREMHFWLYHRIWKHVWXG\LVWRFRQWULEXWHWRWKH5HFUHDWLRQ5HVRXUFH6WXG\FRQFHUQLQJ
WKHUHODWLRQVKLSEHWZHHQULYHUIORZVDQGUHFUHDWLRQRSSRUWXQLWLHVDQGXVHVE\
GHYHORSLQJIORZSUHIHUHQFHFXUYHVIRUHDFKPDMRUULYHUUHDFKE\W\SHRIXVHDQG
HTXLSPHQW136'RXEW\RXFDQGHYHORSDSUHIHUHQFHFXUYHIRUZLQWHUDFWLYLWLHVWKDWUHTXLUH
VWDEOHULYHULFH,WZLOOHLWKHUEHSUHVHQWRUDEVHQW:KDWPHWKRGZLOOEHXVHGWRDVVHVVWKLV
HIIHFW"
GHVFULELQJWKHSRWHQWLDOHIIHFWVRIDOWHUHGULYHUIORZVRQH[LVWLQJDQGSRWHQWLDOERDWLQJ
DFWLYLW\DQGRWKHUUHFUHDWLRQDOXVHVRIWKH6XVLWQD5LYHUDQG
GHVFULELQJDQ\QHZERDWLQJRURWKHUIORZGHSHQGHQWUHFUHDWLRQDORSSRUWXQLWLHVWKDWPD\
EHFUHDWHGE\3URMHFWFRQVWUXFWLRQDQGRSHUDWLRQ
10.7.2. Existing Information and Need for Additional Information
([LVWLQJLQIRUPDWLRQZDVFRPSLOHGLQWKH5HFUHDWLRQ'DWD*DS$QDO\VLV$($DDQG
UHFUHDWLRQUHVRXUFHGHVFULSWLRQVDQGLQYHQWRU\SUHVHQWHGLQ$($
V3UHDSSOLFDWLRQ'RFXPHQW
3$'$($E$UHFUHDWLRQVWXG\ZDVLQLWLDWHGLQWRJDWKHUGDWDWRLQIRUPWKH
VWXG\SODQLQFOXGLQJWKHIROORZLQJHOHPHQWV
²,QWHUYLHZVZLWKNH\UHSUHVHQWDWLYHVRIDJHQFLHVDQGRUJDQL]DWLRQVLQFOXGLQJ$ODVND
1DWLYHHQWLWLHVNQRZOHGJHDEOHDERXWUHJLRQDODQGVWDWHUHFUHDWLRQPDQDJHPHQWDQG
LVVXHV
²$FRPSLODWLRQRIH[LVWLQJUHFUHDWLRQLQYHQWRU\DQGFDSDFLW\LQIRUPDWLRQ
²$QLQYHQWRU\RI3URMHFWDUHDDFFHVV
²,QFLGHQWDO2EVHUYDWLRQ6XUYH\'DWDFRPSOHWHGE\ILHOGFUHZV
²&RRUGLQDWLRQZLWKRWKHUVWXG\GLVFLSOLQHVDQGLQFRUSRUDWLRQRIGDWD
²*HRUHIHUHQFHGPDSSLQJ
²)LHOGUHFRQQDLVVDQFH
²,GHQWLILFDWLRQRIIXWXUHWUHQGVDQGLVVXHV
²$GHVFULSWLRQRIWKHPDQDJHPHQWIUDPHZRUN
²FRPSLODWLRQRIH[LVWLQJEDVHOLQHERDWLQJUHFUHDWLRQLQIRUPDWLRQDQGDFFHVV
²K\GURORJ\GDWDUHYLHZ
²ILHOGUHFRQQDLVVDQFHDQGSKRWRJUDSK\
²LGHQWLILFDWLRQRIIXWXUHWUHQGVDQGLVVXHVDQG
²GHVFULSWLRQRIWKHPDQDJHPHQWIUDPHZRUNDQGVSHFLDOULYHUGHVLJQDWLRQV
²FRPSLODWLRQRIH[LVWLQJEDVHOLQHERDWLQJUHFUHDWLRQLQIRUPDWLRQDQGDFFHVV
²K\GURORJ\GDWDUHYLHZ
²ILHOGUHFRQQDLVVDQFHDQGSKRWRJUDSK\
²LGHQWLILFDWLRQRIIXWXUHWUHQGVDQGLVVXHVDQG
²GHVFULSWLRQRIWKHPDQDJHPHQWIUDPHZRUNDQGVSHFLDOULYHUGHVLJQDWLRQV
$YDLODEOHLQIRUPDWLRQIURPWKHGDWDJDWKHULQJHIIRUWVZLOOEHXVHGWRGHYHORSWKH5HYLVHG
6WXG\3ODQ
7KURXJKWKHFRQVXOWDWLRQHYHQWVLQFOXGLQJWKH)(5&VFRSLQJSURFHVVDQGZRUNJURXSPHHWLQJV
RWKHUOLFHQVLQJSDUWLFLSDQWUHFRPPHQGDWLRQVLQFOXGLQJLQSXWRQVWXG\PHWKRGVZHUHXVHGIRU
GHYHORSPHQWRIWKHVWXG\SODQV
10.7.3. Study Area
7KHUHDFKHVRIWKH6XVLWQD5LYHUVKRZQLQ)LJXUHZLOOEHVXEGLYLGHGLQWRVPDOOHUXQLWV
DVDUHVXOWRISK\VLFDOVWXGLHVLQRWKHUGLVFLSOLQHVDQGILHOGREVHUYDWLRQVFRQGXFWHGLQWKH
5HFUHDWLRQDO5LYHU)ORZ6WXG\$UHDVRIFRQFHQWUDWLRQZLOOLQFOXGHDUHDVZKHUHWKHSURSRVHG
UHVHUYRLUZRXOGFUHDWHWKHPRVWIORZFKDQJHV
136±:HGRQRWXQGHUVWDQGWKHVWDWHPHQW³DUHDVZKHUHWKHSURSRVHGUHVHUYRLUZRXOG
FUHDWHWKHPRVWIORZFKDQJHV´:KDWLVWKHWKUHVKROGIRU³PRVW´":KRGHFLGHV":KHQ"
(YHQDVVXPLQJFRQVHQVXVRQWKHVWDQGDUGWREHXVHGKRZFDQWKLVGHFLVLRQEHPDGH
EHIRUHWKHUHVXOWVRIWKHLQVWUHDPIORZIORZURXWLQJLFHSURFHVVHVHWFVWXGLHVDUHLQKDQG"
:KDWLIZHDQGRWKHUVGLVDJUHHZLWK$($¶VJHRJUDSKLFVFRSHGHFLVLRQ"7KLVQHHGVWREH
QDLOHGGRZQE\
7KH5HFUHDWLRQ5LYHU)ORZ6WXG\ZLOOIRFXVRQWKRVHUHDFKHVRIWKH6XVLWQD5LYHUGLUHFWO\
DIIHFWHGE\WKH3URMHFW7KHVHLQFOXGHWKHVHFWLRQRIULYHUWKDWZRXOGEHLQXQGDWHGE\WKH
SURSRVHGUHVHUYRLU'HYLOV&DQ\RQDQGWKHUHDFKGRZQVWUHDPRI'HYLOV&DQ\RQWRWKH
FRQIOXHQFHZLWKWKH7DONHHWQD5LYHU
136$JDLQLWLVWRWDOO\XQIRXQGHGIRU$($WRDUELWUDULO\VWRSDW7DONHHWQD5LYHU7KLV
FRQWUDGLFWVSULRUFRPPLWPHQWVWRUHO\RQWKHresultsRIRWKHUVWXGLHVWRLQIRUPLPSDFWVRQ
UHFUHDWLRQ7KRVHVWXGLHVZLOOQRWEHFRPSOHWHGIRUVHYHUDO\HDUV
10.7.4. Study Methods
7KH5HFUHDWLRQ5LYHU)ORZ6WXG\LVLQWHUGHSHQGHQWZLWKDQDO\VHVFRQGXFWHGLQRWKHUGLVFLSOLQHV
HVSHFLDOO\SK\VLFDOHJK\GURORJ\DQGVRFLDOHJWUDQVSRUWDWLRQDQGLQSXWRIGDWDIURP
WKRVHVWXG\JURXSVZLOOEHVLJQLILFDQW
7KLV6WXG\LVGHVLJQHGWRLGHQWLI\WKHPLQLPXPDQGRSWLPXPLQVWUHDPIORZQHHGHGIRU
PRWRUL]HGQRQPRWRUL]HGDQGZKLWHZDWHUERDWLQJDVZHOODVRWKHUIORZGHSHQGHQWUHFUHDWLRQDO
DFWLYLWLHVRQWKH6XVLWQD5LYHU
8VLQJDFFHSWHGSUDFWLFHVIRUUHFUHDWLRQDOIORZVWXG\GHVLJQDVGHVFULEHGLQ:KLWWDNHUHWDO
DSURJUHVVLYHVHTXHQFHRIOHYHOVRIVWXG\ZLOOEHXQGHUWDNHQ7KHVHLQFOXGH/HYHO
GHVNWRSDQDO\VLV/HYHOOLPLWHGUHFRQQDLVVDQFHDQG/HYHOLQWHQVLYHILHOGVWXGLHV7KLV
SURFHVVPD[LPL]HVVWXG\HIILFLHQF\E\FKDUDFWHUL]LQJUHFUHDWLRQDFWLYLWLHVIRUUHVSHFWLYHULYHU
VHJPHQWVLQWKHGHVNWRSSKDVHFRQILUPLQJDVVHVVPHQWVLQWKHUHFRQQDLVVDQFHSKDVHDQGWKHQ
IRFXVLQJLQWHQVLYHILHOGVWXGLHVWRWKRVHDFWLYLWLHVDQGULYHUVHJPHQWVZDUUDQWLQJGHWDLOHGVWXG\
DQGDQDO\VLV7KLVSURFHVVDOVRFRQWULEXWHVWRHDUO\LGHQWLILFDWLRQRISRWHQWLDO3URMHFWHIIHFWVDQG
XVHUFRQIOLFWVDQGLQIRUPDWLRQQHHGHGWRHYDOXDWHSRWHQWLDO3URMHFWHIIHFWVRQULYHUEDVHG
UHFUHDWLRQ
/HYHO'HVNWRSDQDO\VHVLQWHJUDWHH[LVWLQJLQIRUPDWLRQDERXWFKDQQHOFKDUDFWHULVWLFV
K\GURORJ\ULYHUUHFUHDWLRQDORSSRUWXQLWLHVDFFHVVSRLQWVDQGIORZVLQRUGHUWRGHWHUPLQHZKDW
UHFUHDWLRQDOERDWLQJUHVRXUFHVDUHSUHVHQWWKDWFRXOGEHDIIHFWHGE\WKHSRWHQWLDO3URMHFW
/HYHO5HFRQQDLVVDQFHHIIRUWVJDWKHUILUVWKDQGLQIRUPDWLRQRQWKHULYHUUHVRXUFHW\SHVRI
UHFUHDWLRQRSSRUWXQLWLHVDQGDVVRFLDWHGDWWULEXWHVDVZHOODVWKHUHFUHDWLRQDOXVHUJURXSV
DFFHVVLQJWKHULYHU7KHUHFRQQDLVVDQFHDOVRSURYLGHVYDOXDEOHLQIRUPDWLRQRQDFFHVVVLWHV
ORJLVWLFVWUDYHOWRDQGIURPWKHVLWHORFDOUHVRXUFHVDQGSHRSOHDQGODVWO\SRWHQWLDOVDIHW\
FRQFHUQV0RWRUL]HGDQGQRQPRWRUL]HGZDWHUFUDIWPD\EHXVHGGXULQJWKHUHFRQQDLVVDQFHWR
EHWWHUXQGHUVWDQGUHFUHDWLRQRSSRUWXQLWLHVRQWKHULYHU
/HYHO,QWHQVLYHILHOGVWXGLHVZLOOGRFXPHQWWKHH[LVWLQJIORZGHSHQGHQWUHFUHDWLRQ
RSSRUWXQLWLHVPRWRUL]HGDQGQRQPRWRUL]HGZDWHUFUDIWDQGWKHDVVRFLDWHGDWWULEXWHVIRUWKH
UHVSHFWLYHRSSRUWXQLWLHVDQGZLOOTXDQWLI\WKHIORZSUHIHUHQFHVPLQLPXPDFFHSWDEOHDQG
RSWLPXPIRUHDFKRSSRUWXQLW\7KLVLVGRQHWKURXJKDFRPELQDWLRQRIILHOGREVHUYDWLRQV
LQWHUYLHZVZLWKOLFHQVLQJSDUWLFLSDQWJURXSVIRFXVJURXSVHVVLRQVDQGDQLQVWUHDPIORZ
UHFUHDWLRQVXUYH\WDUJHWLQJUHFUHDWLRQRSSRUWXQLWLHVIRUDJLYHQULYHUVHJPHQW7KHVXUYH\ZRUN
ZLOOEHFRQGXFWHGLQFRRUGLQDWLRQZLWKVXUYH\VDVVRFLDWHGZLWKWKHRYHUDOO5HFUHDWLRQ6WXG\
136±$JDLQWKLVXQGHUVFRUHVZK\ZHQHHGWRVHHWKHSURSRVHGVXUYH\LQVWUXPHQWV
SURWRFROHWFWRGHWHUPLQHLIWKH5HF6XUYH\DGHTXDWHO\DGGUHVVHVWKHVHLVVXHV
(OHPHQWVRIUHFUHDWLRQDOERDWLQJIORZUHVHDUFKLQFOXGH
Data collection :DWHUUHFUHDWLRQDWWULEXWHVIRUGLVFUHWHVHFWLRQVRQWKH6XVLWQD5LYHU
ZLOOEHGHVFULEHGLQFOXGLQJW\SHVRIULYHUUHFUHDWLRQUHDFKOHQJWKJUDGLHQWFKDUDFWHU
ZKLWHZDWHUGLIILFXOW\FODVVLILFDWLRQDQGUHFRPPHQGHGUDQJHRIIORZVIRUUHVSHFWLYH
UHFUHDWLRQDFWLYLWLHV$FWLYLWLHVZLOOEHLGHQWLILHGE\W\SHRIPRWRUL]HGDQGQRQPRWRUL]HG
ZDWHUFUDIWLQFOXGLQJZKLWHZDWHUND\DNVDQGSDFNUDIWVFRPPHUFLDODQGQRQFRPPHUFLDO
XVHVDQGWULSSXUSRVHVWULSOHQJWKIUHTXHQF\RIXVHDQGVHDVRQDOFRQVLGHUDWLRQV
Reconnaissance ±5LYHUUHFUHDWLRQRSSRUWXQLWLHVDQGDVVRFLDWHGLQVWUHDPIORZDWWULEXWHV
ZLOOEHREVHUYHGDQGGHVFULEHG([LVWLQJDQGSRWHQWLDOVLWHVIRUUHFUHDWLRQDOERDWLQJ
DFFHVVDORQJWKHULYHUFRUULGRUDQGWKHDUHDLQXQGDWHGE\WKHSURSRVHGUHVHUYRLUZLOODOVR
EHGHVFULEHG
Consultations - %RDWHUVODQGDQGUHVRXUFHPDQDJHUVJXLGHVXVHUJURXSVDQGRWKHUVZLOO
EHLQWHUYLHZHGWRGHWHUPLQHWKHW\SHVDQGORFDWLRQVRIERDWLQJDFWLYLW\RFFXUULQJRQWKH
6XVLWQD5LYHU,QWHUYLHZVZLOOEHFRQGXFWHGZLWKERDWHUVDQGRWKHUH[SHUWVZLWK
H[SHULHQFHRQWKH6XVLWQD5LYHUWRGHWHUPLQHDUDQJHRIFRQGLWLRQVJHQHUDOO\DFFHSWDEOH
WRYDULRXVW\SHVRIZDWHUFUDIWDQGVNLOOOHYHOV
&RQVXOWDWLRQPHWKRGVLQFOXGHWKHIROORZLQJ
,QWHUYLHZVZLOOEHFRQGXFWHGZLWKULYHUUHFUHDWLRQXVHUVZLWKSUHYLRXVH[SHULHQFHRQWKH
6XVLWQDLQFOXGLQJPRWRUL]HGQRQPRWRUL]HGDQGZKLWHZDWHUERDWHUV
)RFXVJURXSVHVVLRQVZLOOFRQWULEXWHDGGLWLRQDOLQIRUPDWLRQDERXWIORZSUHIHUHQFHV
UHFUHDWLRQXVHSDWWHUQVIRUUHVSHFWLYHUHDFKHVDQGJURXSVZKLWHZDWHUGLIILFXOW\VDIHW\
FDPSVLWHVVLJQLILFDQWUDSLGVDQGUHFUHDWLRQDODFFHVV7KHIRFXVJURXSVHVVLRQVZLOOEH
FRRUGLQDWHGZLWKQDWLRQDOUHJLRQDORUORFDOZDWHUUHFUHDWLRQFOXEV
2XWFRPHVRIWKHSURFHVVLQFOXGHWKHIROORZLQJ
0RWRUL]HGDQGQRQPRWRUL]HGERDWLQJRSSRUWXQLWLHVDQGDVVRFLDWHGDWWULEXWHVIRUWKH
UDQJHRIIORZVZLOOEHH[DPLQHG7KLVLQFOXGHVZKHUHDSSOLFDEOHWKHOHYHORIZKLWHZDWHU
GLIILFXOW\SRUWDJHUHTXLUHPHQWVOHQJWKRIWULSDQGFKDUDFWHUL]DWLRQRIH[SHULHQFHV
,QFOXGHVWRXULVPERDWLQJXSWR'HYLOV&DQ\RQ
)ORZSUHIHUHQFHFXUYHVIRUHDFKUHDFKZLOOEHGHYHORSHGIRUUHVSHFWLYHULYHUUHFUHDWLRQ
RSSRUWXQLWLHV
7KHIUHTXHQF\IRUWKHUDQJHRISUHIHUUHGIORZVIRUUHVSHFWLYHRSSRUWXQLWLHVZLOOEH
TXDQWLILHGIRUH[LVWLQJFRQGLWLRQVDQGOLNHO\SURSRVHG3URMHFWRSHUDWLRQV
3XWLQDQGWDNHRXWVLWHVDQGUHODWHGQHHGVHJVFRXWLQJDQGUHPRWHFDPSLQJWKDWPD\
EHDVVRFLDWHGZLWKUHVSHFWLYHUHFUHDWLRQRSSRUWXQLWLHVLQDSDUWLFXODUULYHUVHJPHQWZLOOEH
LGHQWLILHG
10.7.5. Consistency with Generally Accepted Scientific Practice
7KHPHWKRGVDQGZRUNHIIRUWVRXWOLQHGLQWKLV6WXG\3ODQDUHWKHVDPHRUFRQVLVWHQWZLWK
DQDO\VHVXVHGE\DSSOLFDQWVDQGOLFHQVHHVDQGUHOLHGXSRQE\WKH&RPPLVVLRQLQRWKHU
K\GURHOHFWULFOLFHQVLQJSURFHHGLQJV7KHSURSRVHGPHWKRGRORJ\LVRIWHQXVHGLQDQDO\VLVIRU
GHYHORSPHQWRIK\GURHOHFWULFOLFHQVHDSSOLFDWLRQVWRIXOILOOWKH)(5&¶V([KLELW(UHTXLUHPHQWV
IRUGRFXPHQWDWLRQDQGGHYHORSPHQWRIPLWLJDWLRQPHDVXUHVIRUIORZGHSHQGHQWUHFUHDWLRQ
10.7.6. Schedule
8SRQLPSOHPHQWDWLRQLWLVHVWLPDWHGWKDWWKHWHUPRIWKHVWXGLHVZLOOEHDSSUR[LPDWHO\WZR
\HDUV
Table 10.7-1. Recreational Boating / River Access Study Schedule. Description Start Date Completion Date Duration
(months)
'DWD&ROOHFWLRQLQFOXGLQJVHDVRQDOILHOGYLVLWVDQGFRQVXOWDWLRQV -DQXDU\ 1RYHPEHU
,QYHQWRU\ -DQXDU\ 2FWREHU
,QLWLDO6WXG\5HSRUW 'HFHPEHU
$QDO\VLV 1RYHPEHU 0DUFK
8SGDWHG6WXG\5HSRUW $SULO 'HFHPEHU
1361RLQIRUPDWLRQDERXWZKHQKRZWKH/HYHODQDO\VHVILWLQZLWKWKLVVFKHGXOH
0XFKRIWKLVVWXG\SODQDSSHDUVWRKDYHEHHQFXWDQGSDVWHIURPWKH136268JXLGH
ZLWKRXWDQH[SODQDWLRQRIKRZWKHPHWKRGVZLOOEHDSSOLHGWRWKLVSDUWLFXODUSURMHFW:H
QHHGVSHFLILFVDQGDQDJUHHPHQWRQZKRPDNHVPLGSRLQWGHFLVLRQVWRSURFHHGHJIURP
/HYHOWRRUWREDVHGRQZKDWFULWHULD
1367KHUHLVRQO\RQHZLQWHUDQGRQHVXPPHURIVWXG\DQGQR1RYHPEHUVRU
'HFHPEHUV7KLVGRHVQRWLQGLFDWHDVLQFHUHFRQFHUQIRULPSDFWVRQZLQWHUUHFUHDWLRQ
$UJXDEO\$.¶VZLQWHUUHFVHDVRQLVORQJHUWKDQLWVVXPPHUVHDVRQ,WLVFHUWDLQO\LPSRUWDQW
WRXVHUVDVZHOODVSXUYH\RUVRIHTXLSPHQWHJVQRZPDFKLQHVDQGWKHORFDOHFRQRP\
2QH\HDURIVWXG\LVDOVRQRWDQDGHTXDWHVDPSOHVL]HWRVXSSRUWFRQFOXVLRQVDERXW
LPSRUWDQWIORZGHSHQGHQWDFWLYLWLHVOLNHVSRUWILVKLQJDQGIORDWKXQWLQJ1RWHWKHHPHUJHQF\
&KLQRRNFORVXUHWKLV\HDU±KRZFDQ\RXVWXG\WKHPRVWVRXJKWDIWHUILVKVSHFLHVLQ6&$.
LIKDUYHVWLVSURKLELWHGGXULQJWKHRQO\\HDURIVWXG\"/LNHZLVHWKHXSODQGJDPHKXQWLQJ
VHDVRQLVGHSHQGHQWRQYDULDEOHZHDWKHUHWF±RQHVHDVRQLVMXVWQRWHQRXJKWRGRFXPHQW
EDVHOLQHRSSRUWXQLWLHVDQGH[SHULHQFHVZKHQWKH\DUHGHSHQGHQWRQKLJKO\YDULDEOH
LQWHUDQQXDOFRQGLWLRQV
10.7.7. Level of Effort and Cost
7KHHVWLPDWHGFRVWRIWKHWZR\HDUVWXG\LV
10.7.8. Literature Cited
$($$ODVND(QHUJ\$XWKRULW\D6XVLWQD:DWDQD+\GURHOHFWULF3URMHFW6RFLRHFRQRPLF
5HFUHDWLRQ$LU4XDOLW\DQG7UDQVSRUWDWLRQ'DWD*DS$QDO\VLV3UHSDUHGE\+'5,QF
$QFKRUDJH
²E3UHDSSOLFDWLRQ'RFXPHQW6XVLWQD:DWDQD+\GURHOHFWULF3URMHFW)(5&3URMHFW
1R'HFHPEHU3UHSDUHGIRUWKH)HGHUDO(QHUJ\5HJXODWRU\&RPPLVVLRQ
:DVKLQJWRQ'&
+DU]D(EDVFR6XVLWQD-RLQW9HQWXUH+DU]D(EDVFR6XVLWQD+\GURHOHFWULF3URMHFW
5HFUHDWLRQ6XUYH\5HSRUW3UHSDUHGIRUWKH$ODVND3RZHU$XWKRULW\$QFKRUDJH$ODVND
5HHG6(-/%RJJVDQG-30DQQ63UH$'*,6DQ$UF*,6WRROER[IRUPRGHOLQJWKH
SURSDJDWLRQRIHQJLQHQRLVHLQDZLOGODQGVHWWLQJ9HUVLRQ7KH:LOGHUQHVV6RFLHW\
6DQ)UDQFLVFR&$86'HSDUWPHQWRIWKH,QWHULRU1DWLRQDO3DUN6HUYLFH$ODVND
5HJLRQDO2IILFH0DUFK
:KLWWDNHU'%6KHOE\:-DFNVRQ,QVWUHDPIORZVIRUUHFUHDWLRQDKDQGERRNRQ
FRQFHSWVDQGUHVHDUFKPHWKRGV86'HSDUWPHQWRI,QWHULRU1DWLRQDO3DUN6HUYLFH
5LYHUVDQG7UDLOV&RQVHUYDWLRQ3URJUDP2UHJRQ6WDWH8QLYHUVLW\DQG1DWLRQDO3DUN
6HUYLFH:DWHU5HVRXUFHV'LYLVLRQ
:KLWWDNHU'%6KHOE\DQG-*DQJHPL)ORZVDQGUHFUHDWLRQDJXLGHWRVWXGLHVIRU
ULYHUSURIHVVLRQDOV5HSRUWIRU+\GURSRZHU5HIRUP&RDOLWLRQDQG1DWLRQDO3DUN6HUYLFH
±+\GURSRZHU5HFUHDWLRQ$VVLVWDQFH
MEETING RECORD
Record of Meeting Page 1 of 1
AEA Team Member Other Party
Name:Maryellen Tuttell and Patrick Burden Name:Comm. Susan Bell, Wanetta Ayers
Organization: DOWL HKM and Northern Economics Organization:DCCED
Study Area:Socioeconomics Phone
Number:
Date:September 17, 2012 Time:2:00 p.m. to 2:30 p.m.
Meeting held by: AEA Team X Other Party
Others at meeting: NA
Subject: Potential Role of DCCED in socioeconomic studies for Susitna-Watana Hydroelectric Project
Discussion:
x Potential role of DCCED in socioeconomic studies for Watana Project–
o The Department and particularly the Economic Development Division has limited
resources that they can provide for the project.
o The best role for the Department may be to review and vet the reasonably foreseeable
future actions (RFFAs) and other major assumptions used in the modeling effort.
o DCCED staff can also provide input to the RFFAs, particularly for mining and tourism,
as well as other projects that organizations under DCCED’s umbrella, such as the
Alaska Industrial Development and Export Authority, are aware of.
o The Department can also provide a list of organizations and individuals that NEI might
consider for interviews.
o DCCED can also assist NEI in considering the industry response to the availability of
relatively low cost electric power when the Watana Project comes online (e.g., server
farms, minerals processing, seafood processing).
x Wanetta Ayers will be the primary contact for DCCED and she will coordinate with other
organizations within DCCED.
Action Item:
Patrick Burden to email copy of public Project Study Plan to Wanetta Ayers.
1
Tuttell, Maryellen
Subject:FW: comments from DCCED
Attachments:Mineral_Resources_of_AK_interactive_Map_SW_Dam_railbelt.pdf; SW_10_12_12
_Adleman.pdf; SWHP - Proposed Study Plan - NRG Comment.docx; Susitna
Watana.docx
From: Ayers, Wanetta Jo (CED) [mailto:wanetta.ayers@alaska.gov]
Sent: Monday, November 05, 2012 5:50 PM
To: Patrick Burden
Subject:
HiPat:
TheDivisionofEconomicDevelopment(DED)staffhasreviewedtheProposedStudyPlanfortheSusitnaͲWatanaDam
Project.AttachedareNicoleGrewe’sreviewofthestudyplan–perhapsmorethanyouwerelookingfor,butshe,Jenn
Adleman’swriteuponmineralsactivity,andasummaryIdidondatacenterpotentialbasedonarecentreviewof
similarprojectsatIEDC.
Iamnotsureifwehavehitthemarkhere,butbelowaresome“freeassociation”topicsthatwerepartofthe
discussion:
Agriculture
x WouldincreaseddemandforhousingintheMSBfurtherreducefarmacreage?Increasedpricepressureto
convert?
x Duringconstruction,wouldincreaseddemandforlocallyͲsourcedfoodsbenefitlocalfarmersintheMSBorin
othergrowingregions(Nenana,DeltaJunction)
Aviation
x Restrictedairspaceinandaroundthedam?
x PossibleimpactonAirForceandothermilitarytrainingrange?
Logging/ForestProducts–CassiePinkel
x Use/Capacitytousewoodybiomassclearedinandaroundconstructionsite–feederstockforFAIareapellet
plants?
x Anyongoingneedtoremovewoodybiomass?(Somehydroprojectsdothisafterthefact–alsoany
opportunitiesforcontrolledburns?)
Minerals/Mining–JenniferAdlemanandLisaHarbo
x SWHP–ParksHighway/DenaliHighwayAreaMineralProspects(seelinksformineralactivityintheareaof
thedamproject).
AlaskaResourceDataFileQuadMaplink
http://ardf.wr.usgs.gov/quadmap.html
ValdezCreekMiningDistricthttp://www.mindat.org/locͲ202758.html
ARDFHealyQuadMineralProspects
2
http://ardf.wr.usgs.gov/ardf_data/Healy.pdf
GoldenZonehttp://www.mindat.org/locͲ197744.html
http://www.alixresources.com/index.php?page=projects&project=1
“TheGoldenZonegoldͲsilverͲcopperdepositislocatedonthesouthflankoftheAlaskaRangeinthe
ValdezCreekMiningDistrict,about12mileswestoftheParksHighwayonStateofAlaskaownedlands.”
ARDFTalkeetnaMountainsQuadMineralProspects
http://ardf.wr.usgs.gov/ardf_data/TalkeetnaMountains.pdf
ARDFMountHayesQuadMineralProspects
http://ardf.wr.usgs.gov/ardf_data/MountHayes.pdf
Tourism
x Congestioninandaroundthesiteduringtheconstructionphase
x Access/egresstootherlocations/pointsofinterest
x Diminishmentoftheviewshedinandarounddamsite–doesnotappeartobethecase
x Lossof“naturalquiet”andothernaturalvalues
x Increasedrecreationalopportunitiesinandaroundthereservoir–campgrounds,boatlaunches,etc.
x Increasedhabitatforwetlandbirds,increasedbirdviewingopportunities
x Increasedtourisminandaroundthedamsiteafteroperationsbegin–tours,overlooks–dependingonthe
superlativesoftheproject
x Capacityathatcheriestostockthereservoir?
x Increasedrailroadpassengertrafficduetoroadcongestion?
x PowercostreductionforDenaliPrincessLodge,SouthDenaliVisitorCenter,otherremoteoperators
WorkforceTrainingPrograms
x Crosswalktransferrableskillsbetweenjobclassifications
x Sufficiencyoftrainingfacilities
x SufficiencyofMiddle–HighSchoolPrograms
x SufficiencyofCareerandTechnicalEducationPrograms
x NeedforaSTEMInitiativetoalignwithprojectneeds
x NeedforMiddleSkillprogramstoalignwithprojectneeds
OtherConsiderations
x PossiblesharedresourcesorcomplimentarycoordinationwithothermajorprojectssuchasAGDCorothergas
lineprojects–EnergyCorridor
x Possiblesharedinfrastructureandconstructionresources
Astheprojectprogressesandmorebaselinedataisavailable,IthinkDEDcanreflectfurtheronopportunitiesand
impactsfromthedam.
Thanks,
Wanetta
WanettaAyers,DirectorͲDivisionofEconomicDevelopment
StateofAlaska_DepartmentofCommerce,Community&EconomicDevelopment
3
AnchorageOffice:
550West7thAvenue,Suite1770_Anchorage,Alaska99501
Voice:(907)269Ͳ4048Fax:(907)269Ͳ5666Cell:(907)230Ͳ2284
JuneauOffice:
3032VintageParkBoulevard,Suite100_Anchorage,Alaska99801
Voice:(907)465Ͳ2625Fax:(907)269Ͳ5666Cell:(907)230Ͳ2284
Jennifer N. Adleman
10/12/12
Comments on the
Proposed Study Plan
Susitna-Watana Hydroelectric Project
FERC No. 14241
Having recently sat down with other SOA agencies to review and respond to the EPA on their Bristol Bay
Watershed Assessment and the Pebble Limited Partnership Environmental Baseline Data Keystone panel
review process, I found that there were a few things in this document that seemed particularly
interesting. But in the interest of time, I stuck to the initial charge question of identifying follow-on
economic benefits related to expanded hydro capacity.
I highlighted the rail corridor and proposed dam location on the interactive Mineral Resources of Alaska
map (attached) and also asked DNR folk if any of the relatively nearby project proponents have stated
they perceive the dam and associated hydro power as their power source. No one has explicitly͘dhat may
have to do with the progress of the projects more than anything. Chuitina Coal, in the
permitting process (EIS) just ahead of Donlin, has projected utilizing Belgua Power Plant as their energy
source thus far. DNR staff speculated they may need an additional source of power. Kiska, Terra, Golden
Zone, those projects without immediate ties to the existing power infrastructure may benefit from an
increased capacity / generation along the rail belt. I think it’s worth noting that although there’s
consistent mention of Green’s Creek using hydro power, from what I can recall of our staff tour there,
they are 3, maybe even 5th in line to receive the generate hydro power and rely on diesel the far
majority of the year (9, maybe even 11͕ months out of the year).
The associated transportation systems put in place during exploration and construction may lead to
additional claims staking and exploration in the area and may increase the rate of exploratory projects in
the area. This is due to access as well as a potential decrease in the cost and increase in the availability
of goods, services͕ and equipment in the immediate vicinity.
Additional discussion, even among those in the mining industry lead to the story of McMinnville, OR,
their server banks and the city’s targeted approach to server banks industry. “It's small enough to make
connections and access information quickly and easily, yet large enough to handle infrastructure needs,
like reliable water, high-speed Internet access and reasonably priced power.” from the city website. I’ve
heard leaders from farther north communities also discuss this as it relates to their cold climate, but lack
of connectivity and power have been pointed to as obstacles.
Susitna-Watana Hydroelectric Project
Northern Economics Proposed Study Plan
NRG Comment
Due: October 5, 2012
BACKGROUND
The Alaska Legislature’s House Bill 306 established a goal of using 50 percent
renewable energy sources by 2025. One effort towards achieving this goal
includes a large-scale renewable energy resource for Alaska’s Railbelt region,
a transportation corridor spanning Fairbanks to Seward. During 2010, the
state legislature provided funding to AEA to pursue a large hydroelectric
project for the Alaska Railbelt, coined the Susitna-Watana Hydroelectric
Project (SWHP). As currently conceptualized, the SWHP would start
operations in 2023, with a 50-year lifespan.
To date, the AEA has proposed 58 individual areas of study related to the
Susitna-Watana Hydroelectric Project to meet federal licensing requirements
to build the project. The studies were part of a detailed plan submitted to
the federal Energy Regulatory Commission, the agency tasked with regulating
hyrdoprojects. The damn is located approximately 184 miles up the Susitna
River, above Devil’s Canyon. Proposed areas of study generally include the
following:
1. Geology and Soils
2. Water
3. In-Stream Flow
4. Fish and Aquatic
5. Wildlife
6. Botanical
7. Recreation and Aesthetic
8. Cultural and Paleontological
9. Subsistence
10. Socioeconomic and Transportation [DED Proposed Study Plan Review]
11. Project Safety
PROJECT WEBSITE
http://www.susitna-watanahydro.org/
DOCUMENT REVIEWED
Proposed Study Plan (PSP): Susitna Hydroelectric Project
Note, this is Northern Economics’ Proposed Study Plan (PSP) to satisfy requirements related to the complete
evaluation of the socioeconomic and transportation impacts of a large scale hydroelectric project. While it could also
be considered a draft scope of work, it is likely incomplete because Northern Economics is proposing a general
approach to study socioeconomic and transportation impacts at this time. It is unclear whether a full scope of work
will follow at a later date.
GENERAL COMMENT [Note – These comments do not apply to any specific section, but rather the general approach to the study plan.]
Research Review
There are many large hydroelectric projects across the nation – and, all would likely have undergone similar impact
studies per federal regulation. If there were more time, or if it is a DCCED priority, it would be good to conduct a
quick review of other projects – especially if there were any shortcomings in the analyses of hydroelectric projects in
rural western states. The Proposed Study Plan (PSP) cites Alaska-specific documents regarding the project, but it
does not mention review of any other hydroelectric project socioeconomic impact research from other states. At a
minimum, I recommend a review of other impact studies, conducted in a similar remote/rural region, that met
federal requirements and provided a conceptual framework that is applicable to Alaska.
Impact Timeframe/Planning Alternatives
The PSP discusses various impacts in long narrative format and with broad generalizations. There is also narrative
regarding the models and data sources to be used. While the methods are likely solid and there are many noted
potential impacts, there is very little consideration or attention given to the types of impact. Specifically, the PSP
applies a very broad “with project” and “without project” impact analysis framework. In contrast, to accurately
assess the impacts for Alaska, it is more useful to apply the following planning scenarios:
1. No Change – Status quo for the region and communities without the project. What are the overall trends in
the Railbelt regarding unemployment, income, population, and employment opportunities?
2. Short-Term Change – Construction period and shortly thereafter.
3. Long-Term Change – After the project is built and construction workers have departed the state, what are
the long-term positive and negative impacts that will be realized in the Railbelt?
Additional Considerations
NRG Note – These are my opinions, unrelated to federal or state permitting requirements. Too often we treat Alaska
as one state and population group, without significant difference in opportunity and general wealth.
1. Rural versus Urban Impacts – Which locales of the Railbelt will experience the greatest impacts?
2. Native versus Non-Native Impacts – Which population of the Railbelt will experience the greatest impacts?
3. Planning Alternatives – The PSP is a planning project and should include the proposal of multiple alternatives
and comparison of direct and indirect impacts of each alternative. This comment is related to the above
“Impact Timeframe/Planning Alternatives”. Currently, the PSP calls for “with project” and “without project”;
however, there are other approaches to studying the project – with/without project, impact timeframes, and
diverse project options. Apparently the scale of project is not under consideration – this will be a large
hydroelectric project; however, impacts could be considered per relative timeframe.
SECTION COMMENT
[Note – This section contains specific blue-font comment, organized by PSP section. Many of these comments are related to the
aforementioned general comments – and they may/may not be applicable to Northern Economics current work depending on federal
requirements for current study. For example, perhaps the issues noted below will be resolved upon development of a full-scale scope of work.
Finally, I have inter-mixed a general summary of the PSP section, along with my blue-font comment, to provide context for the comment.]
13. SOCIOECONOMIC AND TRANSPORTATION RESOURCES
13.1 Introduction
Scope of Work Summary:
1. Socioeconomic – social conditions, local and regional economy, public goods and services as provided by
local, state, and federal governments.
2. Transportation – roads, airports, rail, and river transport.
3. Health Impacts – community health and safety
4. Air Quality
Comment:
Is this a federally-required scope of work or Northern Economics original creation? If it is federally-required and
mandated, then there is not significant room for suggestion regarding substantive areas of inquiry.
13.2 Nexus between Project Construction/Existence/Operations and Effects on Resources to be Studied
The type, intensity, and extent of impacts on social resources needs to be understood… so appropriate measures to
address and mitigate impacts can be considered and incorporated into the project license.
Comment:
This section is a long laundry list of potential impacts and the relationship between impacts. As it is still introductory
in nature, that’s probably okay; however, I found it to be a random list of potential impacts. Furthermore, it does not
accommodate for different types of impact – short term, long term, and permanent. This is the difference between
short-term construction and long-term operations impacts. While a long discussion of a variety of impacts is
sufficient, the section would benefit from further development, organization, and conceptualization.
13.3 Resource Management Goals and Objectives
This section details the multiple public and private entities involved with the management of the lands surrounding
the SWHP – and the stated goals and objectives for the land the project is located on and/or impacts.
Comment:
Are there any other land holder entities or stakeholders that were NOT mentioned?
x Surrounding communities – even without planning and zoning powers, they may have stated priorities and or
values for the land in this particular area
x Mat-Su ARDOR – May or may not have a contribution
x Interest Groups – subsistence users, recreational groups, and other groups that access this general area.
Also, Northern Economics needs to thoroughly define and delineate the land area under consideration – perhaps this
is already accomplished in other projects and/or studies related to the SWHP.
13.4 Summary of Consultation with Agencies, Alaska Native Entities, and Other Licensing Participants
No comment.
13.5 Regional Economic Evaluation Study [Topic 1 – Economy – Power Related]
13.5.1 General Description of Proposed Study
Goal is to assess potential economic impacts of: 1) operation of project; and 2) power generated from
project. In short, these are direct (i.e., operation) and indirect (i.e., power) impacts. Non-power related
impacts are discussed in the social conditions and public goods and services section.
1. Economic impacts as a result of improved electrical power grid.
2. Impact to Electric Prices
3. Economic impacts over time
Comment:
The impacts of the project generally include SWHP operations and energy-related impacts – this seems
sufficient; however, the bullets may be incomplete and/or are very grandiose endeavors. This area of inquiry
requires further consideration:
1. Project – Short-Term, construction
2. Project – Long-Term, operations
3. Operation – Power Rate Impacts
4. Direct Local/Regional Economy Impacts
5. Indirect Local/Regional Economy Impacts
Again, this comment is related differentiating type of impacts. While the PSP previously noted “with project”
and “without project”, they are now further considering economic impacts, which are likely to be more far
reaching and diverse that what has been proposed. More consideration should be given to defining and
organizing types of economic impact prior to quantifying the impacts.
13.5.2 Existing Information and the Need for Additional Information
Comment:
No comment as the sections discusses already-documented data gaps. I’m not well-informed on already-
existing information regarding this project; however, there is no mention of consultation of similar research
for hydroelectric projects in the Lower 48. If this study is required by federal mandate, I imagine very similar
studies exist for similar projects elsewhere. A generally recommendation is to consult already existing
research and ensure there are no gaps in the proposed data and study methods.
13.5.3 Study Area
Railbelt Region – Fairbanks, Denali Borough, Mat-Su Borough, Anchorage, and Kenai Peninsula Borough.
No comment
13.5.4 Study Methods
Data Collection and Analysis
General approach includes “with” and “without project” scenarios. Analysis conducted via REMI
software, which incorporates four models: 1) input/output, 2) general equilibrium, econometrics,
and economic geography. Input variables include supply, demand, and price. Output variables
include population, employment, labor income, output (sales), and housing.
Comment:
Lengthy discussion is dedicated to the use of sophisticated software, but little discussion is given to
the output variables – these are socioeconomic impacts of the SWHP. Is population, employment,
labor income, sales, and housing enough?
At a minimum, I recommend “with” and “without project” scenarios be expanded to include the
reality of large-project construction in Alaska: 1) without; 2) with/short-term; 3) with/long-term; and
4) with/permanent. Further study of beneficiaries – rural/urban, railbelt/non-railbelt, Native/non-
Native, community, and small business is also advisable. In other words, an assessment of impacts,
as aggregated by common Alaska beneficiary group. Later sections of the PSP discuss the
“calibration” of methods for Alaska conditions; this calibration needs to be extended beyond
software, but also include the conceptualization of the project.
Documentation of Regional Economic Analysis
No comment
13.5.5 Consistency with Generally-Accepted Scientific Practice
Methods to be “calibrated for Alaska”.
No comment
13.5.6 Schedule
Initial and Updated Study Report available 2013.
No comment
13.5.7 Level of Effort and cost
$250,000 to $400,000
13.5.8 Literature Cited
Comment:
Incorporate literature for similar projects in the Lower 48.
13.6 Social Conditions and Public Goods and Services Study [Topic 2 – Social – Non-Power Related]
13.6.1 General Description of the Proposed Study
Study Goals and Objectives
Study plan goal for this section include evaluation:
1. Social Conditions
2. Public Goods and Services
Comment:
Separate social conditions from public goods and services. Perhaps separate both public goods and public
services. As the study is currently drafted, it studies: 1) regional economy (direct power-related impacts);
and 2) social conditions and public goods and public services (indirect power-related impacts). Per the
original introductory material, it might be easiest to consider impacts via discrete impacts. Clearly there are
cross-over variables, but better conceptualization will lead to more effective communication and
consideration of potential impacts. In addition to improved conceptualization of type of impact, it is
advisable to adopt a more in-depth approach to quantifying impacts – without project, with project/short
term, with project/long term, and with project/permanent.
Study Variables
1. Population
2. Housing
3. Public Goods
4. Public Services
5. Quality of Life
Objectives:
1. Current Socioeconomic Conditions
2. Already Existing Workforce
3. Total Worker Payroll
4. Total Material Purchases
5. Population In-migration
6. Population Increase Impacts – Public Goods and Services
7. Existing Housing Stock
8. Displaced Businesses
9. Non-Power Impacts on local and/or regional economy.
10. Impact of biophysical change on subsistence, recreation, community use patterns, and quality of life.
Comment:
The above list is not an exhaustive list of potential socioeconomic impacts, and it does not differentiate
between short- and long-term impacts.
13.6.2 Existing Information and Need for Additional Information
Comment:
This section has a good list of publicly available information via various government agencies. It also has a long-list of
unmet information needs – or, information that will need to be compiled. As in many impacts studies, it focuses on
impacts gained and not impacts lost. For instance, significant attention is dedicated to workforce, construction
materials, and wages. There is less attention given to lost opportunity – dislocated businesses, removed agriculture
lands, etc. Perhaps further attention should be given to lost opportunity – and, this will likely occur as a variety of
land managers are consulted regarding current use of the area. For instance, what is the economic value of the
tourism currently occurring in this area (if any). What about environmental impact – displaced critters and
consequences for subsistence activities?
13.6.3 Study Area
Primary Mat-Su Borough including Trapper Creek, Chase, and Talkeetna; Denali Borough and Cantwell.
13.6.4 Study Methods
Finally note on remaining consistent with licensing proceedings for other hydroelectric projects.
Comment:
Differentiate social conditions from public goods and public services – organize all study of variables accordingly.
Data Collection and Analysis
REMI Model/Output Variables – population, employment, labor income, output (sales), and housing.
Noted Areas of Impact Inquiry:
x Construction
x Immigration and impacts to public services – fire, medical, education, safety, etc.
x Quality Life – via survey with residents and area users
x Fiscal Impact – public goods and services
x Transportation
x Tourism impacts
x Property uses and values
x New jobs and labor income
x Harvest Yields – agriculture, grazing, logging, mining, and fishing
x Recreational use
x Wildlife importance
Comment:
This is likely the most complex part of the project - estimating impacts to: 1) social conditions; 2) public
goods, and 3) public services. Currently the narrative is long laundry list of areas of inquiry that will cover the
range of impacts to the socioeconomic impacts – noted above. This section would benefit from further
conceptualization and organization. Socioeconomic impacts generally include the following:
1. Economic – wages, taxes, property values, government expenditures for goods/services
2. Physical – Physical infrastructure
3. Environmental – changes to watershed and all the impacts to critters
4. Social – Community perception regarding change to quality of life.
5. Cultural – impacts to subsistence and ways of life
6. Human – workforce development potential
And, again, I recommend differentiating between without project, with project/short term, and with
project/long term for full disclosure of socioeconomic impacts.
Work Products
Initial and Updated Study Reports available 2013 and 2014.
13.6.5 Consistency with Generally-Accepted Scientific Practice
Methods calibrated for Alaska conditions and experience.
13.6.6 Schedule
Initial Study Report available 2013; Updated Study Report available due 2014.
13.6.7 Level of Effort and Cost
$400,000 to $500,000, including seven boroughs and census areas, associated communities, and surveys/personal
interviews with stakeholders.
13.6.8 Literature Cited
Note, a document is listed that provides guidance for hydro project relicensing, as drafted by US Fish and Wildlife.
WRANGELLKETCHIKANSaxmanHalibutCoveAnchorPointSoldotnaShungnakKobukSkwentnaFlatSleetmuteNondaltonCircle Hot SpringsUngaUNALASKAAdakTin CityWalesTakotnaChuloonawickKlukwanThorne BayKENSINGTONFidalgo-Alaska\SchosserRamsay-RutherfordCliff MineMidasEllamarKnight Island\PandoraLatouche\BeatsonCopper BullionCrown-Point\Kenai-Alaska263ChickaloonNomeOffshore262ValdezCreekPorcupine CreekWillowCreekChistochinaFairbanksAniakMcGrathLikSunTerraChuitnaPyramidNiblackPalmer MHCRockCreekArctic\RubyDonlin GoldGoldenZonePebbleCopperWishbone HillBokan MountainLWM - FortymileBornite\Ruby CreekKiska-Whistler-EstelleMoney Knob/Old Smokey/LivengoodAmokMidasPurdyCalderJualinOmalikKhayyamEllamarGraniteStampedeDemocratTreadwellBinocularRed DevilSalt ChuckReed InletGoldstreamLost RiverCliff MineEskay-IskutJumbo BasinClaim PointIndependenceApex El NidoValdezCreekPerseveranceIndependenceLucky StrikeRed MountainApollo-SitkaJade MountainAlaska-JuneauBremner MinesMonarch\JewelCreviceCreekIllinois CreekCopper BullionWhite MountainSilback\PremierHirst ChichagofNabesna RamblerChicken MountainLatouche\BeatsonNuka Bay DistrictSawtoothMountainDeCourseyMountainChandalarDistrictMaid of Mexico HelenSnip\Johnny MountainFidalgo-Alaska\SchosserPolaris\Tulsequah ChiefCrown-Point\Kenai-AlaskaAlaska Oracle\GilpatrickBlue Lead\TibbsCreek\Gray LeadScraffordMineral KingGreen MonsterCastle IslandRamsay-RutherfordKennecott DistrictKnight Island\PandoraPyramid Peak\Ruby MineGolden Horn\Malemute\GraniteLMSMANAnnRexGilKisaNyacKadyMikeAvanToftyKugrukKhotolJarvisMcLeodMedfraCandleSumdumBelugaZacklyTaurusDenaliKlukwanNunatakSleitatHogatzaSmuckerKamishakAnarraaqGagaryahStuyahokJoker 88MosquitoKawisgagMakushinKougarokChip-LoyFog LakeGold HillThreeCubWattamuseUnion BayCanoe BayDry CreekNimiuktukBig WindyTin CreekBee CreekDawson/CJJumboDomeLevi CreekACH ClaimsPurkeypileOhio CreekFrost\OmarCosna DomeCentennialCoal CreekReef RidgeBig HurrahMoore CreekGanes CreekBoat HarborBogus CreekArnold KakoGeroe CreekStory CreekEagleCreekKatagi LakeClear CreekDuke IslandSlate CreekDrenchwaterFlume CreekRapid RiverHalibut BayKasna CreekQuartz HillPebble SouthChisna/SlanaRed MountainQuartz CreekSweeper CoveEgnaty CreekBeaver CreekKaiyuh HillsShorty CreekWindy CraggyBering RiverCape KigunakEar MountainOutwashCreekWhoopeeCreekMount EielsonSithylemenkatBrady GlacierCape MountainHayes GlacierBottom DollarJohnson RiverBear MountainStep MountainBonanza HillsWestern ArcticMichiganCreekPorcupine LakeEsotuk GlacierCinnabarCreekZarembo IslandSedanka\BiorkaKemuk MountainDelta DistrictMount SchwatkaTableMountainCirque TolstoiNim and NimbusChilligan RiverChristianRiverChalet MountainRoosevelt CreekGroundhog BasinMagnetic IslandNabesnaGlacierIndian MountainPotato MountainKasaan/Poor ManChicken MountainPurcell MountainFortyseven CreekMargerie GlacierIyikrok MountainElephantMountainVinasale MountainMishegukMountainAnderson MountainShotgun Hills\MoseVon Frank MountainRomanzof MountainsKantishna DistrictItkillik River WestWolf Creek MountainMount Distan\DivideMission Creek\OwhatWiseman/Nolan CreekStranglewoman CreekDaniels Creek\BluffChistochinaDistrictNorth Bradfield RiverOrange Hill/Bond CreekRoy Creek\Mount PrindleSheep Creek\RatFork\BMPCaribou Mountain\HolonadaLucky Shot - Willow CreekYakobi Island\Bohemia BasinBoulder Creek-Death ValleyBaultoff Horsfeld\Carl CreekPoovookpuk Mountain\West CapeBernard Mountain\Dust MountainEster Dome\Grant Mine\Ryan LodeShumaginTrue NorthMount AndrewLittle SquawBowser CreekLiberty BellMount CoxcombDiscoveryGulchWoewodski IslandWTF\Red MountainKivliktort MountainSiniktanneyakMountainCleary Summit/Golden SummitTOKNOMESITKAKENAIHOMERCraigVALDEZSEWARDPALMERNENANANAKNEKKODIAKJUNEAUBETHELBARROWCORDOVAKOTZEBUEGLENALLENFAIRBANKSANCHORAGEPETERSBURGDILLINGHAMDELTA JUNCTIONKakeAniakTananaHoonahHainesGalenaAngoonYakutatWasillaSkagwayMcGrathEmmonakSand PointSaint PaulFort YukonFoxEekEkukAttuAtkaEyakUyakRubyKnikHopeElimAkiakEsterAlcanOphirAnvikKoyukHyderFerrySlanaKianaHealyEkwokEagleCohoeChaseSalchaUganikAkhiokCandleAkutanBelugaWillowTyonekTogiakTetlinTellerTelidaSuttonPaxsonNulatoNoatakNewtokMedfraKotlikKipnukKarlukKaltagHusliaHughesHollisGakonaEgegikCircleChevakBrevigBeaverAmblerAlatnaTolsanaLigniteKaguyakCouncilPaimiutDiomedeAfognakIgiugigNuiqsutCentralKasilofPelicanChiniakWisemanVenetieUgashikTonsinaTazlinaSusitnaSolomonSelawikRampartNoorvikNikolaiNikiskiNabesnaKoyukukKlawockKalskagIliamnaHoustonGulkanaGambellEklutnaDouglasDeeringChugiakChitinaChisanaChignikChickenChenegaBettlesAtqasukBucklandKachemakIditarodUmkumiutNapakiakColdfootNikolskiKasiglukNewhalenHamiltonCantwellBig LakeNanwalekKokhanokOuzinkieDot LakeWhittierTuluksakTatitlekSterlingStebbinsShagelukSeldoviaSavoongaPrimrosePlatinumNorthwayMekoryukMcCarthyMarshallLevelockKwethlukKivalinaKaktovikHydaburgGustavusGraylingGoodnewsGirdwoodEdna BayCold BayBoundaryAyakulikAuke BayAndersonAlakanukAkiachakBelkofskiOhogamiutNapaimiutKupreanofWaterfallMendeltnaDry CreekKoliganekDeadhorsePedro BayManakotakTanacrossTalkeetnaSalamatofRed DevilQuinhagakPoint LayNinilchikNightmuteNapaskiakLivengoodKing CoveChefornakBig DeltaAllakaketAleknagikTwo RiversHobart BayWhale PassLarsen BayOld HarborPort LionsEvansvilleKenny LakeNikolaevskHealy LakeWomens BayGeorgetownIvanof BayAtmautluakWainwrightUnalakleetTwin HillsShishmarefShaktoolikPoint HopePerryvilleOscarvilleNorth PoleMoosePassMetlakatlaKongiganakHooperBayHoly CrossFalse PassElfin CoveClam GulchChickaloonCoppervilleKing IslandMarys IglooLake LouiseNaukati BaySummitLakePoint BakerBill MooresPort HeidenMoose CreekNunapitchukTuntutuliakToksook BayStony RiverScammon BaySaint MarysPrudhoe BayPort MollerPort GrahamPilot PointPetersvilleMinto (New)King SalmonKalifornskyEagle RiverChuathbalukChistochinaChalkyitsikBirch CreekSaint GeorgeRed Dog MineNew StuyahokCoffman CoveChignik LakeWillow CreekSouth NaknekPitkas PointMeyers ChuckLime VillageKwigillingokHappy ValleyClarks PointPort ClarenceNelson LagoonPort AlsworthUpper KalskagPortage CreekMentastaLakeSaint MichaelPilot StationMcKinley ParkLower TonsinaEagle VillageCrooked CreekCopper CenterSilver SpringsShemya StationCooperLandingPauloff HarborChignik LagoonWhite MountainSheldons PointPort AlexanderArctic VillageAnaktuvuk PassPort ProtectionTetlin JunctionTenakee SpringsStevens VillageRussian MissionLake MinchuminaExcursion InletMountainVillageNorthway JunctionGolovin\(Cheenik)Chena Hot SpringsManleyHot SpringsHarding-Birch LakesNelchina (Abandoned)Tanunak954380797877767473727068676665646160595857565351494847464443424139383635343331302928272625242322212019181716151413121110251250175876219998979695949392919089888786858483828175716963625554525045403732261260259258257256255254253252249248247246245244243242241240239238237236235234233232231230229228227226225224223222221220219218217216215214213212211210209208207206205204203202201200199198197196195194193192191190189188187186185184183182181180179178177176174173172171170169168167166165164163162161160159158157156155154153152151150149148147146145144143142141140139138137136135134133132131130129128127126125124123122121120119118117116115114113112111110109108107106105104103102101100POGONIXON FORKGREENS CREEKUSIBELLICOALREDDOGFORT KNOXGOODNEWSBAYNomeYentaFaihavenFortymileKougarokEagleCouncilHopeAniakAniakCircleChandalarRubyBonnifieldTolovanaInnokoChistochinaNelchinaWisemanShungnakFairbanksPortClarenceRampartWillow Creek HotSpringsDelta RiverMelozitnaGoodnews BayKoyukJuneauValdezCreekNizinaKianaKianaYakutatRubyNelchinaKoyukYakutatFortymileWisemanMarshallKantishnaMcGrathCircleCouncilMcGrathGoodnews BayYakutagaKodiakNoatakAniakNoatakAniakHughesValdez CreekHughesChisanaPort ClarenceIditarodJuneauMelozitna114°W116°W118°W120°W122°W124°W126°W128°W130°W132°W134°W134°W136°W136°W138°W138°W140°W140°W142°W142°W144°W144°W146°W146°W148°W148°W150°W150°W152°W152°W154°W154°W156°W156°W158°W158°W160°W160°W162°W162°W164°W164°W166°W166°W168°W168°W170°W170°W172°W172°W174°W174°W176°W176°W178°W178°W180°180°178°E178°E176°E176°E174°E172°E170°E168°E166°E164°E162°E160°E158°E156°E154°E68°N66°N64°N64°N62°N62°N60°N60°N58°N58°N56°N56°N54°N54°N52°N50°N52°NARCTICCIRCLES:\LSGISprojects\2011\EdFogels2011\MinRes_06062011.pdf ArcMap 9.3 T. MoodyAL EU TIANISLANDSR U S S I AC A N A D AMineral Resources of AlaskaRESOURCE CATEGORIESOPERATING MINESMajor ProjectsOtherPast Operating MinesMineral Deposit TypesCoal DepositsPolymetallic Deposits (Precious and Base Metals)Other Deposits (Barite & Jade)Base Metal Deposits (Copper, Lead, Zinc, with minor Silver & Barite)Chromium, Titanium, Nickel, Copper and Platinum Group Element DepositsCopper and Molybdenum (with minor Gold) DepositsMercury and Antimony DepositsUranium and Thorium DepositsTin DepositsGold and Silver Deposits (with minor Arsenic, Antimony, Bismuth and Tungsten)Iron Deposits (with minor Gold, Copper, Titanium and Vanadium)Mineral information provided by the Alaska Department of Natural Resources and Division of Geological and Geophysical Surveys.Original of this version produced by:Alaska Department of Natural ResourcesDivision of Support ServicesInformation Resource ManagementOriginal Printed: June 7, 2011Coal ResourcesPlacer District -- Recent ActivityPlacer District -- Historic (pre-2004)P ACIFICOC EANReworked for Jennifer Adleman,AK Dept. of Commerce, Community, and Economic DevelopmentC:\RogerAllely\MinRes_0606201 ArcMap 9.3.1 R.Allely 11-17-2011Reworked (Mines & Minerals) version produced by:Alaska Department of Natural ResourcesDivision of Mining, Land, WaterAbandoned Mine Lands ProgramPrinted: November 17, 20112nd Mine Edits: January 11, 2012Placer Districts added March 16, 2012100010020030050MilesList of Mineral PropertiesC:\RogerAllely\MinRes_Labels_to_text_11042011_RA_a.mxd ArcMap 9.3.1 R.Allely 1-11-2012 1 Liberty Bell 2 Red Devil 3 White Mountain 4 Sawtooth Mountain 5 Scrafford 6 Cleary Summit/ Golden Summit 7 Gil 8 Ester Dome\Grant Mine\Ryan Lode 9 Democrat10 Blue Lead\Tibbs Creek\Gray Lead11 Purdy12 Stampede13 Apollo-Sitka14 Crevice Creek15 Nabesna Rambler16 Kennecott District17 Claim Point18 Red Mountain19 Alaska Oracle\Gilpatrick20 Lucky Strike21 Crown-Point\Kenai-Alaska22 Monarch\Jewel23 Granite24 Cliff Mine25 Knight Island\Pandora26 Chandalar District27 Nuka Bay District28 Copper Bullion29 Ellamar30 Latouche\Beatson31 Independence32 Golden Horn\Malemute\Granite33 Chicken Mountain34 Bremner Mines35 Kensington36 Lost River37 Big Hurrah38 Omalik39 Perseverance40 Golden Zone41 Mineral King42 Ramsay-Rutherford43 Midas44 Jualin45 Alaska-Juneau46 Polaris\Tulsequah Chief47 Hirst Chichagof48 Snip\Johnny Mountain49 Silback\Premier50 Kasaan/Poor Man51 Jumbo Basin52 Niblack53 Valdez Creek54 Lucky Shot - Willow Creek55 Wishbone Hill56 Binocular57 DeCoursey Mountain58 Treadwell59 Goldstream60 Reed Inlet61 Castle Island62 Salt Chuck63 Dawson/CJ64 Khayyam65 Apex El Nido66 Fidalgo-Alaska\Schosser67 Independence68 Pyramid Peak\Ruby Mine69 Daniels Creek\Bluff70 Jade Mountain71 Maid of Mexico Helen72 Amok73 Illinois Creek74 Nixon Fork75 Fort Knox76 Greens Creek77 Red Dog78 Usibelli Coal79 Eskay-Iskut80 Calder81 Bonanza Hills82 Nim and Nimbus83 Denali84 Stranglewoman Creek85 Step Mountain86 Quartz Hill87 Bear Mountain88 Cirque Tolstoi89 Reef Ridge90 Roy Creek\Mount Prindle91 Table Mountain92 Taurus93 Anderson Mountain94 WTF\Red Mountain95 Shumagin96 Bee Creek97 Fog Lake98 Kasna Creek99 Johnson River100 Bowser Creek101 Chip-Loy102 Tin Creek103 Coal Creek104 Zackly105 Chistochina District106 Baultoff Horsfeld\Carl Creek107 Halibut Bay108 Bernard Mountain\Dust Mountain109 Centennial110 Siniktanneyak Mountain111 Sun112 Rapid River113 Caribou Mountain\Holonada114 Mount Schwatka115 Bottom Dollar116 Big Windy117 Flume Creek118 Cosna Dome119 Donlin Gold120 Hayes Glacier121 Bornite\Ruby Creek122 Kougarok123 Ear Mountain124 Potato Mountain125 Cape Mountain126 Rock Creek127 Boulder Creek - Death Valley128 Lik129 Drenchwater130 Frost\Omar131 Iyikrok Mountain132 Nimluktuk133 Kivliktort Mountain134 Arctic\Ruby135 Smucker136 Avan137 Misheguk Mountain138 Poovookpuk Mountain\West Cape139 Ohio Creek140 Whistler - Mount Estelle141 Mike142 Rex143 Makushin144 Cape Kigunak145 Beluga146 Bering River147 Brady Glacier148 Yakobi Island\Bohemia Basin149 Bokan Mountain150 Sithylemenkat151 Wiseman/Nolan Creek152 Indian Mountain153 Hogatza154 Slate Creek155 Kantishna District156 Dry Creek157 Delta District158 Mount Eielson159 Purkeypile160 Sleitat161 Pebble Copper162 Kemuk Mountain163 Pyramid164 Orange Hill\Bond Creek165 Nabesna Glacier166 Windy Craggy167 Nunatak168 Sumdum169 Shorty Creek170 Candle171 Medfra172 Kaiyuh Hills173 McLeod174 Vinasale Mountain175 Pogo176 Sheep Creek\Rat Fork\BMP177 Magnetic Island178 Sedanka\Biorka179 Canoe Bay180 Kawisgag181 Groundhog Basin182 North Bradfield River183 Union Bay184 Klukwan185 Palmer MHC186 Margerie Glacier187 Zarembo Island188 Duke Island189 Mosquito190 True North191 Joker 88192 Discovery Gulch193 Elephant Mountain194 Money Knob\Old Smokey/Livengood195 Clear Creek196 Beaver Creek197 Stuyahok198 Mission Creek\Owhat199 Fortyseven Creek200 Cinnabar Creek201 Katagi Lake202 Eagle Creek203 Mount Distan\Divide204 Tofty205 Romanzof Mountains206 Esotuk Glacier207 Porcupine Lake208 Story Creek209 Whoopee Creek210 Roosevelt Creek211 Michigan Creek212 Ann213 Geroe Creek214 Chalet Mountain215 Purcell Mountain216 Wattamuse217 Chicken Mountain218 Von Frank Mountain219 Egnaty Creek220 Wolf Creek Mountain221 Christian River222 ACH Claims223 Levi Creek224 Itkillik River West225 Kady226 Outwash Creek227 Mount Coxcomb228 Shotgun Hills\Mose229 Arnold Kako230 Bogus Creek231 Sweeper Cove232 Boat Harbor233 Quartz Creek234 Jarvis235 Three Cub236 Chilligan River237 Gagaryah238 Red Mountain239 MAN240 Green Monster241 Anarraaq242 Woewodski Island243 Nyac244 Little Squaw245 Khotol246 LMS247 Chuitna248 Terra249 Kisa250 Goodnews Bay251 Mount Andrew252 LWM - Fortymile253 Chisna/Slana254 Ganes Creek255 Gold Hill256 Jumbo Dome257 Kamishak258 Kugruk259 Moore Creek260 Pebble South261 Western Arctic262 Nome Offshore263 ChickaloonC:\RogerAllely\MinRes_w_Placer_Labels_to_text_11042011_RA_.mxd ArcMap 9.3.1 R. Allely 3-16-2012SW Dam
Susitna Watana:
New Opportunity: Data Centers
Digital economy powerhouses such as Google, Facebook, Apple, and others will continue to increase and
expand data centers around the globe. With the opening of the Arctic, expanding terrestrial fiber in and
around Alaska, and the availability of a green energy source, Alaska may become a viable location for
large scale data centers that can bridge the Arctic and Pacific regions.
Cited economic impacts for recent similar projects include:
ͻ Facebook – Rutherford County, NC
Capital Investment: $450 million
Size: 300,000 SF
Full time jobs: 42
Incentives: $ 11.95 million
ͻ Microsoft – Mecklenburg County, VA
Capital Investment: $499 million
Size: NA
Full time jobs: 50
Incentives: $ 6.9 million
ͻ Google – Council Bluffs, IA
Capital Investment: $300 million
Size: NA
Full time jobs: 50
Incentives: $ 9 million
ͻ Time Warner –Charlotte, NC
Capital Investment: $100 million
Size: 178,000 SF
Full time jobs: 225
Incentives: $ 2.9 million
ͻ AT&T – King Mountain, NC
Capital Investment: $200 million
Size: 470,000 SF
Full time jobs: 100
Incentives: $ 0 million
ͻ Apple – Reno, NV
Capital Investment: $1 billion
Size: 350 Acres
Full time jobs: 200
Incentives: $ 89 million
ͻ United Healthcare – Elk River, MN
Capital Investment:$124 million
Size: 189,000 SF
Full time jobs: 20
Incentives: $ 1.9 million
ͻ Discover – New Albany, OH
Capital Investment:$97 million
Size: 97,000 SF
Full time jobs: 160
Incentives: $ 4.3 million
Key criteria for data center locations:
Power availability and reliability: Substation capacity of 7MW immediately, redundant feeds
from separate substations, reliability, adequate access to natural gas.
Telecommunications/Conductivity: Available lit and dark fiber optic broadband service, ideally
from multiple carriers. Dark fiber is important to address rapid growth, security, scalability, and
cost concerns.
Security/Risk Analysis: All sites will have some inherent risk. Location decisions will seek to
mitigate overall risk, including natural disasters and proximal hazards.
Building/Site Considerations: Conform to industry standards and land use ordinances,
appropriately powered.
Labor Market and Supplier Network: Because of the smaller workforce for need for operations,
labor availability and cost is not as critical as other factors. However, key positions and skill sets
are needed and can be a determining factor in data center investments.
Cost: Power generally accounts for 80 percent of a data center’s OpEx. The use of ambient air in
cooler climates has led to data center being located in new markets such as Scandinavian
countries.
Incentives: pricing tools that reduce the costs or financial risk associated with the investment,
particularly during late stage evaluation and negotiation.
Source: BLS Strategies (2012). Data Center Trends and Market Update. Presented at
International Economic Development Council Annual Conference at Houston, Texas.
1
Tuttell, Maryellen
From:Curtis.Jennifer@epa.gov
Sent:Tuesday, October 30, 2012 1:58 PM
To:Philip M. DeVita
Cc:Tuttell, Maryellen
Subject:Re: AEA SharePoint documents
Hello Phil,
Herman Wong in our Seattle office reviewed the Air Quality PSP and had the following comments:
1. Most of the impacts appear to be related to construction.
2. It was not specifically stated that the project proponent would model the construction emissions. The emissions
should be modeled.
3. There was no mention of any type of combustion sources during operation of the hydro plant. It should be verified.
4. There is uncertainty if background air quality monitoring should be performed. Someone should decide particularly
if EPA signs off on the plan.
5. It appears that there are only two alternatives, project and no project.
6. It was not clear if the project proponents intends to model for air quality benefits (i.e., emissions from nearby units
that the hydro plant would replace). At least I think that is what they were implying.
The verification of the construction emissions could be huge, so I would recommend bringing a permit engineer to do that
task.
If you have any questions concerning these comments, please let me know. Thank you for the opportunity to provide
input on the Air Quality PSP.
_______________________________________
Jennifer Curtis, NEPA Reviewer
US EPA-Alaska Operations Office
222 West 7th Ave., #19
Anchorage, AK 99513
Phone: 907-271-6324
Fax: 907-271-3424
Email:curtis.jennifer@epa.gov
From: "Philip M. DeVita" <pdevita@hmmh.com>
To: Jennifer Curtis/R10/USEPA/US@EPA,
Cc: <mtuttell@dowlhkm.com>
Date: 09/21/2012 09:05 AM
Subject: AEA SharePoint documents
HelloJennifer,itwasnicetotalkwithyouyesterday.IhavespokentotheAEAteamandtheysuggestedIsendyouthefollowing
information(seebelow)foraccessingthePSP.IamalsosendingyouacopyoftheairqualityPSPincaseyouwanttoforwardto
yourappropriateairqualityfolksforreview.
DidyouwantmetofollowupwithaspecificpersonatEPAregardingairquality,orarethecommentscomingtoyou?
Pleaseletmeknowifyouhaveanyquestions.
2
Regards,
Phil
Philip M. DeVita, CCM
Director of Air Quality
Harris Miller Miller & Hanson Inc.
77 South Bedford Street, Burlington, MA 01803
T 781.229.0707 x3115 I F 781.229.7939
pdevita@hmmh.com
ThereareseveralwaystoaccessthePSP.
AEA’swebsite–thePSPispostedonourwebsite(www.susitnaͲwatanahydro.org).Wealsohavealinktoourgenerallistserveand
ourworkgrouplistserve,whichpeoplecansignupfortobenoticedaboutpublicmeetingsandperiodicProjectupdates.Notethe
FERClicensenumberfortheProjectappearsonthewebsite;itis14241.
FERC’swebsite–thePSPwaselectronicallyfiledwithFERC.Thatcanbeaccessed,alongwithallotherdocumentsfiledwithFERCat
www.FERC.govorthroughthelinkonourwebsite.ThelicensenumberforthisProject(14241)appearsonourwebsiteandall
electronicallyfileddocumentsforthisProjectarereferencedbyFERC’sProjectnumber.FERCalsohasalistserveonitswebsitethat
peoplecansignupfortobealertedtoanyFERCfilingsforthisProject.
Technical Excellence. Client Satisfaction.
www.hmmh.com
NOTICE: This electronic mail message, including any files or attachments, may contain PRIVILEGED AND/OR CONFIDENTIAL INFORMATION intended only for
the use of the addressee. If you are not the addressee, or if you have received this electronic message in error, you may not copy or disclose its contents to
anyone. If you received this message by mistake, please notify HMMH immediately by e-mail reply and delete the original message and all copies from your
system. [attachment "Air Quality PSP.PDF" deleted by Jennifer Curtis/R10/USEPA/US]
APPENDIX 4
INFORMAL CONSULTATION DOCUMENTATION
SECTION 16 – PROJECT SAFETY
MEETING MINUTES
NTP #:
1010629 - NTP 10 Project Management and Planning SUBJECT: Initial conference with FERC
1010949 - NTP 6 & 11 Geotechnical Services
X 1010952 - NTP 7 Engineering Feasibility
1010950 - NTP 9 FERC Licensing Support
All NTPs - General Team Meeting DATE: Monday, August 20, 2012
LOCATION: Teleconference
Page 1 of 2
ATTENDEES
NAME
ORGANIZATION
MWH AEA Subcontractor (Org Name) Other Party (Org Name)
Bryan Carey X
Brian Sadden X
John Haapala X
Mike Bruen X
Paul Shannon FERC
Bill Allerton FERC
Bruce Brandt FERC
Ken Thieron FERC
Joe Meuller FERC
Doug Johnson FERC
Karl Swanson FERC
Walt Davis FERC
DISCUSSION ITEMS
ITEM DISCUSSION ACTION
1
Structure of the Board of Consultants was discussed. FERC are interested in
the organization of the Board of Consultants. AEA suggested that there would
be a main Board that would convene throughout the project, with some selected
extra members seconded to the Board for particular subject matter. The
example quoted was for the PMP studies for which a meteorologist and
hydrologist would be added to the Board for (say) 18 months, but would then no
longer participate on a regular basis. FERC reminded the meeting of the
importance of a Board of Consultants for this very large project, and highlighted
that the ILP increases the pressure to prepare a significant part of the final
design before the submittal of the license application FERC will request that AEA
prepare a paper outlining the structure of the Board of Consultants and operating
guidelines.
FERC to prepare a letter to AEA setting out
the role of the proposed Board of
Consultants including its structure and
operating guidelines, i.e. a Board of
Consultants Operating Procedures.
2
AEA indicated to FERC the tentative list of Board members:
Joe Ehasz # – General civil, geotechnical, and seismic engineering
Brian Forbes – RCC technology
“Skip” Hendron # – Rock mechanics and foundation
Henry Falvey – Hydraulics
Yusof Ghaanat – F.E. Analysis
George Taylor* – Meteorologist
A.N. Hydrologist* – unnamed hydrologist
# and * see item 3
AEA to formally transmit to FERC the
suggested Board of Consultants members
and their resumes – include with the note
on proposed structure etc.
3
The requirement for Board of Consultants involvement in review of study plans
was discussed. FERC wishes that both the PMP/PMF and the Seismic Hazard
Analysis study plans be reviewed by Board members. AEA will convene at least
two members of the Board for review of each plan – for the PMP/PMF plan the
two members marked with an “*” will review the document, and for the seismic
hazard study plan, the two members marked with a “#” will perform the same
function.
AEA to schedule early review of the study
plans by at least two members of the Board
of Consultants.
MEETING MINUTES
NTP #:
1010629 - NTP 10 Project Management and Planning SUBJECT: Initial conference with FERC
1010949 - NTP 6 & 11 Geotechnical Services
X 1010952 - NTP 7 Engineering Feasibility
1010950 - NTP 9 FERC Licensing Support
All NTPs - General Team Meeting DATE: Monday, August 20, 2012
LOCATION: Teleconference
Page 2 of 2
DISCUSSION ITEMS
ITEM DISCUSSION ACTION
4
Once the full Board is convened for its first meeting, and from then on, the Board
of Consultants meetings will be formal – with a briefing package provided in
advance of board meetings, and FERC representation at the meeting/site visit.
Include in Board Operating Procedures.
5
Discussed the need for inclusion of a seismologist on the Board of Consultants.
MWH informed FERC that Norm Abrahamson was one of its consultants working
on the Seismic Hazard Assessment with MWH and Fugro (former William Lettis
Associates staff). MWH suggested that as Joe Ehasz is on various ASCE
committees for seismic design, he would suffice for this role on the Board of
Consultants.
Norm Abrahamson to review seismic study
plan.
5
FERC require that the PSHA incorporate as far as possible the
Recommendations for Probabilistic Seismic Hazard Analysis: Guidance on
*Uncertainty and Use of Experts drafted by the Senior Seismic Hazard Analysis
Committee (SSHAC) in 1997. Need to clarify how uncertainty is being
addressed.
Define in Study Plan.
6
FERC noted the NOAA Atlas 14, Volume 7, Version 2.0, Alaska (2012) had
become available this year. MWH noted that this new publication is for rainfall
frequency only and contains no information on the PMP. Also, the rainfall
frequency values are for point data (10 sq. mi.) and there are no areal reduction
factors in the new publication, which means that the data cannot be directly
applied to the 5,180 sq. mi. Susitna-Watana watershed.
No action required.
7 A schedule for the first 18 months was discussed. MWH undertook to p rovide
AEA with a recommended Board of Consultants meeting schedule.
MWH to provide AEA with proposed
schedule.
8
There was a discussion of long-term earthquake monitoring system being
installed in 2012. Confirmed that a strong motion sensor would be added and
installed on the dam crest following construction.
Include in dam Instrumentation a strong
motion sensor.