The URL can be used to link to this page

Home My WebLink AboutGVEA Healy Fairbanks Intertie Requests for Proposal 1994PitateaAa.| : :. -!Text 2 Task N i End Total Cost 1993 1994 1988 =>M|| ask Name Resources |Duration Start "Dec Jan Feb Mar Apr May Jon Jul Aug Sep Od Now Dec Jan Feb Mar Apt May Jun Jul Aug Sep Oa Nov Dec Jan Feb Mar Apr May Jun Jul Aug |__-Sep Oa Nov Dec Jan Feb ar2400.07 |_Erect Structures Lineman2 ,F 8.00d|_Aug/28/96| Sep/o9/96 $1,427,946.30 . --2400.08 Approve Erection Engr-Line* §.00d; Sep/11/96|Sep/18/96 $2,600.00 - 7 _ [2400.09 String Wire -|Lineman2,Ce 59.00d|_Sep/18/96|_Dec/16/96 $1,288,163.43 . OE72400.10 Tension Wire Lineman2,Cc 11.00d|Dec/16/96}-_Jan/02/97 $120,082.80 - i.2400.11 Approve Conductor Engr-Line*5.00 d Jan/02/97 Jan/09/97 $2,600.00 .-_©|2500.00 |Link 3 Construction 172.60 d| Apr/1z/96|_Dec/23/96|_$4,660,729.45 u aL a Wile a wil Z 2500.01 Mobilize Equipment Lineman2,Cc 46.00d|_Apr/12/96|__Jun/19/96 $418,471.01 ::2500.02 Construct Foundations Lineman2 ,F 47.60d|_Jun/19/96|_Aug/27/96|'$1,164,927.89 ee esi2500.03 Approve Foundations Engr-Line 5.00d|Aug/27/96|_Sep/04/96 $2,600.00 .-_2500.04 Pick up Mat!-Link 3 Linemanz2,Cc 5.00d|Jun/19/96|-_Jun/26/96 $54,583.00 _2500.05 Deliver materials to staging area__'[Lineman2,Cq '13.00 d|_Jun/26/96|_Jul/16/96 $141,915.90 ; .a2500.06 Assemble Structures Lineman2 ,(|25.00]_Jul/16/96|_Aug/20/96 $272,916.01 .=2500.07 Erect Structures Lineman2 ,F 7.00d|Aug/19/96|_Aug/27/96 $1,311,952.70 .- 2500.08 Approve Erection Engr-Line §.00 d Sep/04/96|Sep/11/96 $2,600.00 , -_2500.09 String Wire Lineman2,Cq __64.00d|_Sep/11/96|_Dec/02/96|_$1,178,996.93 :-_-_2500.10 Tension Wire Lineman2,Cc 10.00 d Dec/02/96 Dec/16/96 $109,166.00 2500.11 Approve Conductor Engr-Line 5.00 d Dec/16/96 Dec/23/96 $2,600.00 ;-_O [2600.00 Link 4 Construction 124.50d|Sep/27/95|_Apr/02/96 $2,972,417.25 ot u LILLIE ZLZILILEX TILE ALA ll ULEaEEA 2600.01 Mobilize Equipment Lineman,Cor 32.00 d Sep/27/95 Novw/15/95 $291,110.012600.02 Construct Foundations Lineman,Pile 55.00d|Now15/95|_Feb/07/96 $897,353.52 enn een ee2600.03 Approve Foundations Engr-Line §.00d|Feb/13/96|_Feb/21/96 $2,600.00 ,-2600.04 Pick up Mati -Link 4 Lineman*,Co}3.00 d Novw/15/95 Novw/20/95 $32,749.90 := |2600.05 Deliver materials to staging area__|Lineman*,Co 6.00d]_Now20/95|_Now/29/95 $65,499.80 . - 2600.06 Assemble Structures Lineman*,Co 12.00d|_Now/29/95|_Dec/15/95 $130,999.60 . a 2600.07 Erect Structures Lineman®*,Sk}.3.00 d Jan/31/96 Feb/05/96 $847,979.80 :=2600.08 Approve Erection.Engr-Line §.00 d Feb/05/96|_Feb/13/96 $2,600.00 -_2600.09 String Wire Lineman*,Co 25.00d|Feb/13/96|-_Mar/20/96 $649,800.01 :re ee!2600.10 Tension Wire Lineman',Co 4.50d Mar/20/96 Mar/26/96 $49,124.60 :el2600.11 Approve Conductor Engr-Line 5.00 d Mar/26/96 Apr/02/96 $2,600.00 .;-_O [2700.00 Link 5 Construction '_§2.00d} Oct/10/95}Dec/27/95 $1,201,248.12 Zz TECLLLLLG LLL LILLE2700.01 Mobilize Equipment Lineman,Cor 9.00d}_Oct/10/95}-_Oct/23/95 $81,874.50 :ee2700.02 Construct Foundations Lineman,Pile 24.00 d|_Oct/23/95}_Now/29/95 $391,572.11 esnenennemen2700.03 Approve Foundations Engr-Line 1.00 d| Nov/29/95|Novw/30/95 $520.00 i2700.04 Pick up Matt -Link §Lineman',Co!1.00d|_Octr23/95|.Oct/24/95 $10,916.30 .'2700.05 Deliver materials to staging area Lineman*,Co 3.00d| Octf24/95|-Oct/27/95 $32,749.90 =2700.06 Assemble Structures Lineman”,Co;'-§.00d Oct/27/95 Nov/03/95 $54,583.00 Ge :=2700.07 Erect Structures Lineman',He|'1.00d]_Dec/04/95|_Dec/05/95 $365,993.10 oe . !2700.08 Approve Erection Engr-Line 1.00 d Dec/05/95!Dec/06/95 $520.00 \*.* 7 _a2700.09 String Wire Lineman*,Co}-11.00d|Dec/06/95}Dec/21/95 $240,165.61 .. . .”a 2700.10 Tension Wire Lineman*,Co}/2.00 d Dec/21/95 Dec/26/95 $21,833.60 .= .2700.11 Approve Conductor Engr-Line :1.00d; Dec/26/95| Dec/2795 $520.00 ; : =SgOEnergizeLine°Lineman,Cor|2.00d} Jan/O9/97|_-_Jan/13/97 $14,555.40 . ' -Final Inspection Engr-Line :500d} Jan/13/97|-Jan/21/97 *$2,600.00 : : Accept Project 0.00d!Jan/21/97|_Jan/21/97 "$0.00 , .,, .A N _ A ! $14,000,000.00 $10,480,052.41 :$9,052,045.09PeriodCosts . |=$5,233,028.15 faces $2.054,436.02: $2,878,900.97 $2.346,417.13 See $2,823,800.51 1,572.679.84 .054,436.$2,010,979.04;$0.00 |_$11,440.00 $1164185 $64,130.79 «$283,125.83 $241,311.70 __-$523,031.02 $450,168.79 «$640,416.63_OTATS oe wq__$841,022.14 52705658 s10.90788 -«stogeoas ___$1.081.938.47 aed 171 os ,91.384769.86_$1.431:946.46 Fe 08 0 ee Foo eTTTe aon a eer Se ee z $511,028.00 _$1.106.651.12 3 $1.078,556.22 $921,856.17 __$517,899.31 $56,927.06 $22,195.41 $4,855.25 om Milestone A =Summaryoo78 Ti NORTHERN INTERTIE PROJECT . 1993 1994 1995 Text 2 Task Name Resources |Duration Start End Total Cost Dec Jan |Feb |Mar _|Apr |May |Jun |Jul |Aug Sep |Oct |Nov Dec Jan Feb Mar |Apr |.May |Jun |Jul |Aug |Sep |Oct |Nov Dec Jan |Feb |Mar Apr 1 May ]-=x 7997 1000.00 |Northern Intertie 230 kV_100.25 miles 798.38 d|Dec/01/93) Mar/07/97 $66,568,267.99 {5 'i |f f La f 4 f z ZL ZL,z Zz 3 ;j !++{t t |"9 |Sep |Oct |Nov |Dec Jan |Feb |Mar O }1100.00 Environmental Assess w/Scope 330.38 d Dec/01/93 Apr/10/95 $520,799.33 |zzz Zi LLL LLL Li LLL LLLLLL LLL SLLLILLLLLLLLLLUL.ZZ ZZ f f ,4 Z SSIILLLLLLYTL }? Environmental RFP Project Mana:20.00 d Dec/01/83 Deo/29/93 $0.00 Eases Evaluate RFP Project Manat 5.00d}_Jan/10/94 Jan/14/94 $583.33 m= IPG Approves Proposal O.00d| Jan/25/94|-Jan/25/94 $0.00 A Notice-to-Proceed Issued Project Mana:2.00d|Feb/01/94 Feb/02/94 $0.00 f 1100.01 Select Alt Routes Project Mana:11.50 d| Dec/01/93|Dec/16/93 $9,200.00 aaa _. 1100.02 Select Substation Sites Project Mana:35.00 d Jan/14/94 Mar/09/84 $1,770.00 a Highway 1100.03 Select SVS/Energy Stor Sites Project Manai 35.00 d Jan/14/94 Mar/09/94 $1,080.00 : 1100.07 Identify Prefered Routes/Sites Project Mana:6.00 d Mar/10/94 Mar/17/94 $4,080.00 x . 4100.04 Route Surveys DVG Engr-Line*42.00 d|_Mar/01/94|_May/02/94 $209,536.60 aS i Mob/Demob Nortech 2.00 d Mar/01/94 Mar/02/94 $14,700.00 (>)S |Control/Radio link/Hardware Nortech ,206 §.00d Mar/01/94 Mar/07/94 $30,000.00 AG TANAN,¥.Wainwright DVG Data Acquisition 206 Helicopte 7.00d} Mar/o4rg4|-Mar/14/94 $78,970.00 Gy A RIVER AS ubstation |Post-Mission GPS Processing Nortech 8.00d Mar/09/94 Mar/18/94 $6,000.00 Digitizing Profiles Nortech 20.00 d Mar/21/94 Apr/20/94 $8,000.00 Se Feng, Digitizing Attributes Nortech 20.00 d Mar/21/94 Apr/20/94 $8,000.00 SS)Cre, Image Frame Links Nortech 20.00d Mar/21/94 Apr/20/94 $8,000.00 XK Plan/Profile Sheets Drawings 20.00 d Mar/31/94|May/02/94 $50,625.00 1400.05 Archeological Survey Archeologist 80.00 d Apr/08/94,-Aug/04/94 $230,400.00 $1100.09 Publish Notice-of-Intent Engr-Line 3.00 d Jan/25/94 Jan/27/94 $390.00 Meet w/State &Fed Agencies Engr-Line,Pri 10.00d|=Mar/18/94;} -Mar/31/94 $4,000.00 Nv Project Administration (D&M)PM,(D.90.00 d Feb/03/94 Jun/16/94 $4,413.60 Review Existing Data (D&M)PM,{D.20.00d}Feb/03/94|-Mar/03/94 $5,724.00 Parks Py 41100.11 Macro-Corridor Study (D&M)PM,(D.5.00d|_Mar/28/94 Apr/04/94 $6,258.00 highway Yow 1100.06 Identify Potential Impact Areas 5.00 d Mar/28/94 Apr/04/94 $0.00 cS 1100.10 Prepare Project Alternatives (D&M)PM,(D.20.00 d Mar/31/94|_May/02/94 $5,508.80 $1100.08 EA Draft Report (D&M)PM,(D:86.00 d Jan/25/94 Jun/01/94 $17,178.00 Board Approves Draft EA 0.00d|-Jun/01/94|-Jun/01/94 $0.00 1100.12 Hold Public Meeting Engr-Line 0.00 d|-May/10/94}-May/10/94 $0.00 REA Reviews Public Comments 15.00 d|--May/18/94| Jun/08/94 $0.00 1100.13 Publish Notice-of-Scoping Mtg (D&M)Proj An 20.00 d|_.jun/09/94 Jul/07/94 $2,475.00 1100.14 Public Scoping Mtg Engr-Line,(D.3.00h}--Jul/os/ve4{-_Jul/08/94 $480.00 Public Comments to REA (D&M)PM,(D.20.00 d Jul/0s/94|-Aug/05/94 $2,742.00 REA Determines Final Scope 20.00 d 4ug/19/94|Sep/19/94 $0.00 REA Reviews EA 60.00 d Sep/19/94 Dec/'16/94 $0.00 i.,ii Submit Final EA to REA (D&M)PM,(D:5.00 d dan/10/95 Jan/18/35 $14,980.00 =_-Py REA Prepares EA &FONSI 20.00 d Jan/18/95|-Feb/17/95 $0.00 ce EPA Publishes EA in Fed Rec 0.00 d| Feb/17/95|-Feb/17/95 $0.00 A 5 30 Day Comment Period -30.00 d Feb/17/95 Apr/03/95 $0.00 |» Record of Decision 5.00 d Apr/03/95 Apr/10/95 $0.00 =_ O 1200.00 Energy Storage System 570.38 d Dec/01/93 Apr/03/96 $20.317,998.00 Zz cL ZZ ZL ZZ ZZ ZELELL 7 77,--7 EPRI Study of Benefits 90.00d|Dec/01/83 Apr/15/94 $0.00 a ee ee a Selection -SVS,SMES,Battery 15.00 d Apr/19/94|-May/10/94 $0.00 ee| 1200.06 System Study for SVS/BES/SMES Material-SVC 60.00 d May/11/94|-Aug/04/94 $137,866.00 :Fn 1200.01 Acquire Energy Storage Site Land $30.00 d Mar/10/94 Apr/25/84 $50,000.00 1200.02 Prepare Technical Scope Sub-Designe!8.00d})May/11/94|-May/20/94 $51,200.00 a | Equipment Design RFP 35.00 d May/23/94 Jul/12/94 $0.00 a { Heaty Evaluate Equipment RFP §.00 d Jul/13/94 Jul/18/94 $0.00 ae Substation 1200.03 Confirm Scope of Work Sub-Designet 2.00 d Jul/20/94 Jul/21/34 $3,200.00 8 Conformed Scope for Cost Proposal 9.00d Jul/22/94;-Aug/03/94 $0.00 ae ol .: Evaluate Costs &Exceptions 2.00d} Aug/04/94} -Aug/05/94 $0.00 | Board Approves Design Award 0.00d; Aug/05/94;Aug/05/94 $0.00 A 1200.04 Design SVS/BES/SMES Material-SVC 90.00d| Aug/08/94|Dec/16/94 $6,737.866.00 1200.05 Fabricate SVS/BES/SMES Material-SVC 120.00 d Apr/10/95 Oct/04/95 $6,737,866.00 7 1200.07 Install System @ Wilson Sub Material-SVC 120.00d Oct/04/95 Apr/03/96 $2,200,000.00 1200.08 Install System @ Igloo Material-SVC 120.00 d Oct/04/95 Apr/03/96 $2,200,000.00 1200.09 Modify System @ TLS/GHS/HLS Material-SVC 120.00 d OcV/04/95 Apr/03/96 $2,200,000.00 oO 1400.00 Substation Design 130.50 d Jan/14/94 Jul/29/94 $74,504.00 Z { A Acquire Substation Site 30.00 d Apr/04/94 May/18/94 $0.06 Da ee! 1400.01 Prepare RFP for Design Project Manat 3.00 d Jan/1 4/94 Jdan/21/94 $300.00 = 1400.02 Evaluate Design Proposals Project Manav §.00 d Feb/18/94 Feb/25/94 $2,100.00 | Select Substation Design Firm Engr-Sub 0.00d| Feb/25/94| -Feb/25/94 $0.00 A Northern Intertie Period and Cummulative Cost Curves 1400.03 Finalize Design Contract Engr-Sub §.00d| F2b/28/94| --Mar/04/94 $2,600.00 = Board Approves Award 0.00 d Mar/04/94 Mar/04/94 $0.00 A 1400.04 Structure Selection &Design Sub-Designe:40.00d}_-Mar/07/94}-_May/04/94 $35,200.00 EE $12,000,000.00 T --$70,000,000.00 1400.05 Foundation Design Sub-Designe!20.00 d May/26/94 Jun/24/94 $17,600.00 a ee!:_-_es .,, 1400.06 Const.Documents Sub-Designe!10.00 d Jun/24/94 Jul/11/94 $8,800.00 ae een!a 1400.07 Bid Substation Construction Engr-Sub,Co 12.00d Jul/11/94 Jul/27/94 $6,864.00 eae!$10,000,000.00 + =as”+$60,000,000.00 1400.08 Open &Evaluate Bids Engr-Sub 2.00 d Jul/27/94 Jul/29/94 $1,040.00 a ao Board Approves Award Engr-Sub 0.00 d Jul/29/94 Jul/29/94 $0.00 A , -4 oO 1500.00 Substation Construction 34.00 d Anr/10/95 Jun/02/95 $1,012,709.31 Zz .+§§50,000,000.00 1500.01 Mobilization-Substation Lineman-Sub 5.00d| Apr/10/95|__Apr/20/95 $54,583.00 -$8,000,000.00 + 1500.62 Excavate foundations Lineman-Sub 5.00 d Apr/20/95 Apr/27/95 $54,583.50 -, 1500.03 Install Foundations Lineman-Sub 10.00 d Apr/27/95|=May/12/95 $146,456.00 |/+§40,000,000.00 1500.04 Erect Steel Lineman-Sub §.00d|May/i2/95|-May/19/95 $170,743.00 a $6,000,000.00 +a 1500.05 Place Breakers Lineman-Sub 2.00 d}May/12/95}=May/16/95 $467,993.60 | " 1500.06 Install Switches Lineman-Sub 5.00 d|_May/19/95|-May/26/95 $54,583.50 -ol ]+$30,000,000.00 1500.07 Connect Low Voltage Control Wires _|Wireman,Co!10.00d}-May/16/95|_-May/31/95 $38,121.50 $4,000,000.00 - 1500.08 Connect to Main/Xfr Bus Lineman-Sub 2.00d}May/26/95|May/31/95 $21,833.10 | aad ',| 1500.09 Inspect Wiring and Connections Wireman,Cor 2.00d|May/31/95|-_Jun/02/95 $3,812.10 a |+$20,000,000.00 Accept and Energize Breaker Bay 0.00 d Jun/02/95 Jun/02/95 $0.00 V\ ©1300.00 Geotechnical Studies 155.50 d|-_Jan/26/94|-Sep/12/94 $1,074,602.40 Z Z}$2,000,000.00 1300.01 Geotech RFP Project Mana:2.000!Jan/26/94|_Jan/27/94 $280.00 1 ; r $10,000,000.00 1300.02 Evaluate Geotech Propsals Project Mana:2.00d Feb/18/94|Feb/22/94 $1,080.00 ma Select Geotech Firm 0.00 d Feb/22/94 Feb/22/94 $0.00 A $0.00 $0.00 1300.03 Finalize Geotech Contract Project Mana:8.00 d Feb/23/94 Mar/04/94 $3,262.40 , , Board Approves Award 0.00 d Mar/04/94 Mar/04/94 $0.06 TA 1300.04 Soil Investigations -Line Geotechnical.80.00 d|May/03/94}Aug/26/94 $985,500.00 ;-_--1300.05 Soil Investigations -Substations Geotechnical |10.00d|=M-y/03/94/-May/".8/94 $35,200.00;|-_a '; 1300.06 Soils Kenzrt -Line Geotechnical,2U.00 d|*1.9712/94|-Sep/12/94 $35,200.00 a 1300.07 Soils Report -Substation Geotechnical,annd) May/i6/94)-May/26/94 $14,080.00 -|a O 1700.00 Apply For Easements/Permits 251.00 d Mar/i8/94 Mar/28/95 $152,274.00 Zz fa ZZ.ZZ 1700.01 Research Ownership |Contingency 25.00 d Bier/18/94 Apri26/94 $14,993.00 Z 7) 'North of Tanana River Researcher 10.00 d Mur/18/94 Mar/31/94 $1,980.00 | Fairbanks Substation Researcher 10.00 d Maz/18/94 Mar/31/94 $440.00 | Igloo Substation Researcher 25.00 d Mar/18/94 Apr/26/34 $1,100.00 aeSouthofTananaRiverResearcher25.00 d Mar/18/94 Apr/26/94 $8,800.00 Ce Agency Permits (BLM,ADL,etc.)10.00 d Apr/26/94|_May/11/94 $0.00 De | File FAA Construction Notice 1.00d May/11/94 May/12/94 $0.00 | 1700.02 Procure Right-to-Enter ROW Agent.46.00 d Aprf25/94|-Jun/30/94 $21,340.00 a 1700.03 Prepare Easement Documents ROW Agent,67.00 d|Jurv/30/94|Oct/05/94 $62,920.00 ol 1700.04 Acquire Easements/Permits ROW Agentt.114.50 d 0-1/05/94 Mar/28/95 $53,021.00 SS Release Right-of-Way Engr-Line*0.00 d]=Mar/28/95)-Mar/28/95 $0.00 O 1600.00 Engineering and Design 762.00 d Deciv6/93 Jan/15/97 $1,881,746.13}Z ZZ ZZ. 1600.01 Design RFP Project Manai 400d Dec/06/93 Dec/09/93 $2,240.00}mm ZA 1600.02 Evaluate Design Proposals Project Mana:5.00 d Jan/07/94|-Jan/13/94 $5,400.00]= Select Design Firm Project Mana:0.00 d Jan/25/94 Jan/25/94 $0.00 1600.03 Finalize Design Contract Project Manar 5.00 d Jan/25/94 Jan/31/94 $2,800.00 Board Approves Award 0.00 d Jan/31/94 Jan/31/94 $0.00 Line Design/Project Admin.726.00 d Feb/01/94 Jan/15/97 $746,006.13 Project Administration (D&L)PM,(D:717.00d|Feb/01/94}-_Jan/02/97 $90,788.00 ZA Data Review (D&L)PM,(Di 25.00d Feb/01/94 Mar/08/94 $36,533.33 .Develop Design Criteria (D&L)PE.(Dé 15.00 d Fen/23/94 Mar/15/94 $52.728.80 1600.04 Prepare Draft Design Manual (D&L)PM,Cc 55.00 d Mar/16/94 Jun/07/94 $104,948.00 SeReviewGeotechData(D&L)PM,(D:20.00 d Apr/07/94 May/09/94 $16,322.00 Finalize Foundation Design (D&L)PM,(D:10.00d|Sep/09/94;Sep/22/94 $10,320.00 a Construction Details (D&L)PM",(C 50.00d|_Aua/04/94 Oct/14/94 $55,228.00 1600.05 Design Line /Spot Towers Contingency,65.00 d Jun/08/94|Sep/08/94 $162,926.00 ---------_-_ -SsSshConstructionSpecifications(D&L)PM*,(C §5.00 d Jun/29/94;Sep/15/94 $37,072.00 Material Specifications (D&L)PM*,(C 50.00 d Mar/16/94||May/31/94 $30,396.00 LE Prepare Bid Documents (D&L)PM*,(C 15.00 d Oc/31/94 Nov/22/94 $10,992.00 .Dee} Routing Adjustments (D&L)PM,(D.10.00d|-_Aus/18/94|-_Aug/31/94 $10,512.00 aE Construction Engineering (D&L)PM*,(L 370.00 d Jul/05/95 Jan/02/97 $42,480.00As-BuillDrawings/Gioseout_[(D&L)PW".({|84004]Sep/07/95|Jan/i6/97|$84,760.00 NN SeasaA1600.06 Centerline Survey for ROW Limits Surveyor,Cor 105.00 d Jun/30/94 Dec/02/94 $762,300.00 ee,1600.07 Field Stake Structures Surveyor,Cor 50.00 d Sep/23/94 Dec/07/94 $363,000.00 : ;es « Oo 1800.00 Develop Clearing Contracts 111.00 d Apr/10/95|-Sep/21/95 $1,070,680.00 Zz 7 1800.01 Prepare/Bid Clearing Engr-Line*12.00 d Apr/10/95|=May/01/95 $6,240.00 Open Clearing Bids Engr-Line*0.00 h| May/01/95|May/01/95 $0.00 1800.02 Evaluate Clearing Bids Engr-Line*1.00d| Mavy/01/95|May/02/95 $520.00 Award Clearing Contracts Project Mana:0.00 d| May/02/95|= May/02/95 $0.00 \, oO 1900.00 ROW Clearing 111.00 d Apr/10/95|-Sep/21/95 $1,063,920.00 Zz Z:ZZ.7 1900.01 Clear Link 1 Clearing Crev 48.00d|May/02/95 Jul/12/96 $274,560.00 I 1900.02 Clear Link 2 Clearing Crev 55.00 d} Mav/17/95|Aug/04/95 $314,600.00 1900.03 Clear Link 3 Clearing Crev'50.00 d Jui/12/95|_Sep/21/95 $286,000.00 1900.04 Clear Link 4 Clearing Crev 23.00 d Apr/10/95}|-May/17/95 $131,560.00 SS aes 1900.05 Clear Link 5 Clearing Crev 10.00d{ Ma/17/95|_-Jun/01/95 $57,200.00 -O 2000.00 Line Construction Contracts 246.50 d Ap/10/95 Apr/12/96 $43,000.00 Zz - 2000.01 Link 1 Contract Documents Project Mana;15.00 d May/10/95 Jun/01/95 $4,200.00 a Open Construction Bids Engr-Line*0.00 hh} Jun/01/95|-Jun/01/95 $0.00 2000.02 Eval.Construction Bids Engr-Line* 2.00 d|-Jurf05/95|-Jun/06/95 $1,040.00 '4 Award Link 1 Contract Project Mana:0.00 d Jur/06/95 Jun/06/95 $0.00 A 2000.03 Link 2 Contract Documents Project Mana:15.00 d Fei/29/96 Mar/20/96 $8,400.00 Open Construction Bids Engr-Line*0.00 hh}Mai/20/96]_Mar/20/96 $0.00 , 2000.04 Eval.Construction Bids Engr-Line*2.00 d Mai/21/96 Mar/22/96 $1,040.00 A Award Link 2 Contract Project Mana:0.00 d Mar/22/96 Mar/22/96!:$0.00 2000.05 Link 3 Contract Documents Project Mana:15.00 d Mai/18/96|.Apr/08/96 $8 400.00 A Open Construction Bids Engr-Line*0.00 h Apisis3/96{Apr/08/96 $0.00 j : a 2000.06 Eval.Construction Bids Engr-Line* 2.00 d Apr 10/96 Apr/12/96 $1,040.00 A . Award Link 3 Contract Project Mana:0.00 d Api/12/96 Apr/12/96 $0.00 a 2000.07 Link 4 Contract Documents Project Mana:15.00d) May10/95;|-May/31/95 $8,400.00 ;- A Open Construction Bids'Engr-Line*0.00 h| May/31/95|}=May/31/95 $0.00 : 2000.08 Eval.Construction Bids Engr-Line* 2.00d; JunsO1/95|-Jun/02/95 $1,040.00 4 * Award Link 4 Contract Project Mana:0.00 d Jun/02/95 Jun/02/95 |.$0.00 ...A 2000.09 Link 5 Contract Documents Project Mana:15.00 d Apr/10/95|-May/04/95 $8,400.00 a Open Construction Bids Engr-Line*0.00 h May/04/95 May/04/95 $0.00 A 2000.10 Eval.Construction Bids Engr-Line*2.00d{ May/04/95|-May/09/95 $1,040.00 _ Award Link 5 Contract Project Mana:0.00d}May/09/95|May/09/95 $0.00 A O 2100.00 Materials 377.88 d|Sep/23/94 Apr/12/96 $19,766,306.00 Zz 2100.01 Prepare Final Material List/Spec.Project Mana:2.00 d Sep/23/94|Sep/26/94 $1,060.00 | 4 Develop Final Mat Cost Est.5.00d| Sep/27/94 Oct/03/94 $0.00 | Bid Material Contract 15.00 d| Aprf10/95|-May/04/95 $0.00 i Open Material Bids Engr-Line 0.00 d May/04/95 May/04/95 $0.00 A 2100.02 Evaluate Material Bids Project Mana:§.00 d May 04/95 May/12/95 $2,800.00 = Award Material Contract 0.00 d Jun/05/95 Jun/05/95 $0.00 A 2100.03 Accept Matt -Link 1 Material,Corr 20.00 d Aug/29/95 Sep/27/95 $4,888,466.00 EE 2100.04 Accept Matl -Link 2 Material,Con'20.00 d| Feb/26/96|_Mar/22/96 $5,775,891.00 2100.05 Accept Matl -Link 3 Material,Con 20.00d|Mar/14/96|]-_Apr/12/96 $5,094,474.00 a meen 2100.06 Accept Mat!-Link 4 Material,Con 20.00d|Aug/29/95|_Sep/27/95 $2,905,144.00 .smemmcrmeceem Ee ee 2100.07 Accept Mat!-Link 5 Material,Con'20.00 d Sep/11/95 Oct/10/95 $1,098,471.00 es O 2200.00 Construction Management 336.00 d Ocv/23/95 Mar/07/97 $532,144.96 - 2200.01 Link 1 Inspect /CM Construction t 109.00dj Mar/29/96|_Sep/05/96 $134,610.64 LLL ZL YUL LLL LLLETLTILLLLLLULIIITLILIILITLLELULELOTTE| 2200.02 Link 2 Inspect /CM Construction |144.00d Jun/06/96 Jan/03/97 $158,618.88 2200.03 Link 3 Inspect /CM Construction |122.00 d|Sep/05/96|-_Mar/07/97 $145,062.88 2200.04 Link 4 Inspect /CM Construction |92.00 d Novw/15/95 Apr/02/96 $65,180.16 2200.05 Link 5 Inspect /CM Construction I 43.00d|_Oct/23/95|_Dec/27/95 $28,672.40 --a ||SO2300.00 Link 1 Construction 155.50 d}Sep/27/95|-May/17/96 $5,325,880.84 = 2300.01 Mobilize Equipment Lineman,Cor 46.00 d Sep/27/95 Dec/06/95 $418,471.21 l 2) 2300.02 Construct Foundations Lineman,Pile 76.00 d Dec/06/95 Mar/29/96 $1,859,969.64 2300.03 Approve Foundations Engr-Line 5.00 d|_Apr/02/96|_Apr/10/96 $2,600.00 ee eS 2300.04 Pick up Matl -Link 4 Lineman*,Co 6.00 d|Dec/06/95|_Dec/14/95 $65,499.80 - 2300.05 Deliver materials to staging area Lineman*,Co 14.00 d Dec/14/95 Jan/05/96 $152,832.70 2300.06 Assemble Structures Lineman*,Co 25.00 d Jan/05/96 Feb/14/96 $272,916.01 es 2300.07 Erect Structures Lineman*,He 7.00 a!_Feb/15/96|_Feb/27/96|__-'$1,311,952.70 a 2300.08 Approve Erection Engr-Line 0.00d|Feb/27/96|_Feb/27/96 $0.00 - 2300.09 String Wire Lineman',Co §2.00 d Feb/09/96 Apr/29/96 $1,135,330.73 A 2300.10 Tension Wire Lineman*,Co 9.50 d Apr/29/96 May/10/96 $103,708.00 es 2300.11 Approve Conductor Engr-Line 5.00 d| May/10/96}-May/17/96 $2,600.00 a O 2400.00 Link 2 Construction 197.48 d Mar/25/96 Jan/09/97 $5,944 072.82 ] 2400.01 Mobilize Equipment Lineman2,Cc 50.00 d Mar/25/96 Jun/05/96 $454,860.01 Zz om 2400.02 Construct Foundations Lineman2 ,F 86.68 d Jun/06/96 Oct/08/96 $2,121,221.60 a a a Oa 2400.03 Approve Foundations Engr-Line*§.00d| Octios/96| Oct/16/96 $2,600.00 a ee 2400.04 Pick up Matl -Link 2 Lineman2,Cc 6.00 d Jun/06/96 Juns/13/96 $65,499.80 |ee! 2400.05 Deliver materials to staging area Lineman2,Cc 14.00 d|-Jun/14/96 Jul/03/96 $152,832.95 -_ 2400.06 Assemble Structures Lineman2,Cc 28.00 d Jul/05/96|-Aug/13/96 $305,665.91 ew $14,000,000.00 - Period Costs $9,052,045.09 $10,480,052.41 . $1,767,969.58 $1,826.029.72 $1,928.77479 $1,865,201.74 $2,353,171.52 $2 :siceteiaacaaaiaeROS--RTE 022.;ER 1,384,769.86 431,344.095,083.80 3 $2,116.677.76 979,785.2,346,417.13 BS $2,823,800.51 054,436.$0.00 |$11,440.00 $11,641.85 $64,130.79 $283,125.83 $241,311.70 $523,031.02 $450,168.79 $640,416.63rrr erent mmr nent mmm S641.022.14 $97.056.58 $10,907.88 $10,960.35 $1.031.938.47 aN e888 oricof ETT SoS $!edlhed oo se medz ie ented =$511,028.00 _$1,106,651.12 _$1,572.679.84 Srpemmemmm,8201097904 $1 o7g 555 99 $921.856.17 $517,899.31 $56,927.06 $22 195.41 $4855 25 Milestone A Summary EE Gv GOLDEN VALLEY ELECTRIC ASSOCIATION ING,Box 71249,Fairbanks,Alaska 99707-1249,Phone 907-452-1151 January 20,1994 Mr.Dave Highers General Manager . Chugach Electric Association 2]5 P.O.Box 196300 Anchorage,Alaska 99519-6300 RE:IPG Agenda -January 25,1994 Dear Dave, I propose the following agenda items related to the Healy-to- Fairbanks Intertie: 1,Approval of Scope 2.Approval to Award Line Design 3.Approval to Award Environmental Services 4.Approval to Award Digital Video Geographic Survey of Route Under separate cover we have mailed to each participant materialrelatedtothescope,schedule,RFP's,proposal of recommended proposer for each RFP,and letters of recommendation to award for each RFP. Steve Haagenson and I will be available to answer questions at themeeting.It would be helpful if participants would fax or callSteveormeinadvancewithanyquestionswhichoccurtothemso that we might be better prepared to respond. Also sent under separate cover,but subjects for the February agenda,are RFP's which are being mailed to solicitors for (1)substations and reactive compensation;(2)electrical system studies;and (3)Land Title Research. Best regards, Meu Michael P.Kelly General Manager cc:Intertie Participants Group 7 Pp ENGINEERS loz uo.&2 PLANNERS_CALCULATION SHEET SHEET OF PROJECT DATE i/e;I¢¥ SUBJECT DESIGNED CHECKED GQRiley1)anew |aaded we to L041 eu)awd ate \Thesee's) | ee ee ee ;iiLCntyneinCaswencnode:i a7 _).a |vobatedsimuttemeuly,Te 4;Fe achedEsa,lienomesnbanlalfees 1-comiptahoe by S 1424,Tey nenwgaaanefe-vtote.optima ic.Ree\neyXxalae the,Cecubacli r\ JOB NO. OFSHEET ENGINEERS PLANNERS =uJWw<=”z©-<al>oO=<oO DATEPROJECT CHECKEDDESIGNEDSUBJECT ADEA (n ae oh onNo.5appraraVI6.a i: as2 i;wt 1ifiB\:ovenf i iesf scannd ';eres|:aot ' ijoelflaaoneS ' i i |i be Lj4 Gevcocning cntofsonnei afecincmcnfecnmceenfeamaneange sawed vob i i : | : ! ! b ; : i! i : ; Geman a en enh j } i j :: ' j i ! i : : + + i eee aoe t i i i : ii |1 rene anere 4 ES + $+ ' i i ' ne mares pod src b , P, i i: } : i : i i bw . ge ; } pone i: } i ji i > : : | i a ares > ++ 3 + pond : { ; i : ! b i ' ' ii : ' ae he emp femme fre ne ee vo medi 1 } i : ; : : i: ¢ ' i t r jem io i jew wept \ ' i: =) : 'i im . : j H nde crmenn _ or en spe n 1 I Sa ne 7i|t i ii eng nbn:Ae ea cei i i + Hli otaeaar +- ' 4 : } i ot ped + 1 L i i 4 " + i 5i : i + ree iot ee #0RPR GOLDEN VALLEY ELECTRIC ASSOCIATION INC.Box 71249,Fairbanks,Alaska 99707-1249,Phone 907-452-1151 January 20,1994 Mr.Dave Highers General Manager Chugach Electric Association P.O.Box 196300 Anchorage,Alaska 99519-6300 RE:IPG Agenda -January 25,1994 Dear Dave, I propose the following agenda items related to the Healy-to- Fairbanks Intertie: 1.Approval of Scope 2.Approval to Award Line Design 3.Approval to Award Environmental Services 4.Approval to Award Digital Video Geographic Survey of Route Under separate cover we have mailed to each participant material related to the scope,schedule,RFP's,proposal of recommended proposer for each RFP,and letters of recommendation to award for each RFP. Steve Haagenson and I will be available to answer questions at the meeting.It would be helpful if participants would fax or call Steve or me in advance with any questions which occur to them so that we might be better prepared to respond. Also sent under separate cover,but subjects for the February agenda,are RFP's which are being mailed to solicitors for (1) substations and reactive compensation;(2)electrical system studies;and (3)Land Title Research. Best ie Michael P.Kelly General Manager cc:Intertie Participants Group January 3,1994 NORTHERN INTERTIE SCOPE Healy to Fairbanks page 3 A new 230/138 kV transformer is proposed for installation for parallel operation with the existing transformer at Teeland substation and the addition of 20 MVars of fixed capacitors on the tertiary. Verify that the controllers for the existing SVC's will operate correctly and share load with the new SVC installations.If hunting or controller interaction will cause detrimental effects on the system,replace the existing controls with new controls which will mitigate the detrimental effects. The optimal location of the reactive compensation has reduced the required additional compensation from 200 MVar of SVC capacity to 110 MVar of reactive compensation.Of the 110 MVar of compensation 50 MVar SVC or BES would be at Wilson Sub.,40 MVar SVC would be at Igloo Sub.,and 20 MVar shunt capacitors on the Teeland transformer tertiary. SUB-RC.XLS 69 kV to FMUS 7 138 kV to Gold Hill 138 kV to Ft Wainwright 69 KV ; 2 to Gold Hill ii 60/80/100 1 ' pd xt fo !69 kV 138 kV bays oe)eee bays1-43 !1 ©)4 be Qt .0 in a i} sq Il bee 4!:|reactive !'*compensation 'st po PTR TKS t|1 3a future 4 |to y 230kV Yj Leaee----1 L--Sy._i : '1 :i :| '' :' '1 69 kV to Ft.Wainwright 230 kV to Healy Proposed Interconnection Drawing for the Northern Terminal of the Intertie Page 1 SUB-RC.XLS 345 kV line to Cantwell and HealyCoi(operated at 138 kV) ; Helipad j L}t 1 i} Lowe eee : i I |-Bays to be constructed for 230 kV static .1 138kV ; ;Bays po Breakers to be rated 138 kVSystem1_@ 345 kV line to Douglas and Teeland (operated at 138 kV) Proposed Interconnection Drawing for the Igloo Substation on the existing Anchorage to Fairbanks Intertie Page 2 NORTHERN INTERTIE PROJECT tw ie L macy 1 mT ie?Tos Nome "De ina feet eve Fan Se GS SS an |iv]Taq |o TJ SSR ee wo)Mow wn ci on a vet hw 'Che.an Pa o wo on Fr)Aug xan et Nw Oe mn Fao P ggg A20KY_100 25 oben 208 Mul Dec JOL/rs|Masa 97 46 508.267heoo.2308a)Ov:s0103|_Apu rovebl___s6zy.200Lid2000diDv01/03)Dec 50/03)S90d1 sory 100s]gary tayod]58933)es mA Sopoe 20041 pares}pew 75y8 Pye 4 Foe LQal Fecvoi fos)Rea oal 2 Lig OL Sect an Routes Pree Li gg al Decaiserl Dery vo9!2300100gSores28001soryyas)nage 9/00 317900 be) Ngo gy Sabect vS/erwray Ses ge 22a dori ayoal_Ncy (0a tgLg?igeniey 320af mcay loved!sags t2/04 14.980.- 1g of rare”A200 Oh epl(oe]Mow Teradl 3 Sabscbipemee,Nonech,200d)Mails)Mog April $14,700 Ss Ponecn.Sagal Mes OL/oe_hice07(9a 330.000 = VG ag Acauamon,208 rene 790a]Manone]nag,Larval 378.970)- r.Nonech.20001 MorAnyod|Mager ttrod shana!--= bs Nonigch posal Mayaiodl Agsizaroa!$8.90 - Digruing Armas Nerech 3200ul Merci Ap zorce!38.000 = Nortech.42009)_Morfes Ags 390)as DagyProtte Faery eowenes 500g]Magy (a)Moeereroa'yr!: ory 2000 gb 4or/8r04)_sunray)gp oP Erorsne LODG)Manz roe)Meprzzroa sx.s Meet voce$erorune,1990gi Macey tsyoa|_Mapy3 7 14.909. Brogect pam,d sogp al Feownveal ary ieee)$41) Denppm 2009G)_reps]Morapyus sara =eyHigaMagzto-Coregct Say Dennen Sg]MepPAyOd|Apr parse tare. 00.08 200al Mr zeyoa|gr ayaa!Et - 199 19 Srecore Angers rm song)wastes soon sRroa)3358._- 29 SA Grae Reoe AMM G80 al sary,Bavoizosi $17.78 Board Agcroves Droit £4,200gt sevoleaal sgvoisoa|Et A en Hold Pops Mesmng.Enorune.QD gl MaeclOrnat Migw/tora!ms 4 PEA Comenerty 15.003)Moy/\Gyoa)__pangoeynd|EEE - Higa Mig |Denaro,2200901 sryoo/ea)naan oa ars.- 199 Pts errine,eon)aworos)sonra}sp ' Puce Gomeeres to GEA.ape,300a}__awosyoa Par m- L 7 ZOO)Aapay ovea|Senay1Sed)as mA ns 'cnat com lorees Deeziageal 2 -EEe to REA Damp,soda)sawias|sary igo)ta.sen.-= Sy 8 FONG JOM01 pry 06!Fete 17/751,20g:a ZN fips.299at hemi?61 Fa 7/95 19)4 20.2er Commare Pqnog.2000al Feer17 (751 _age,32 EE Resora of Deen Sonal AcApyosi Aces)200 |i= ip |near9:£700 al Cec01/3)Ags,#7921Pan9000atDecimal_acriseoa|"Sabectton-5V5,SMES,Bortery.ROOGl Agri9¢e4)Mays lor 30.991 =_-_- 1200.08 Sewer SAy9y for 20.00dl Moxt i/o!137 gemobgorgene|uang5 20000)mar tava!_Acr/26r04)090 Eee ||etd Prepore.Sy $90.0]Megetiiad]hac Zoro 361.290 oN a= Sspguners Coser 3.HOD G)Moiz3v0a|par i274 39)a ee S908)aati yeel aay Et = nC orden $2050 ot wom,LMal aera)ayy 32., Sonigeened Scope ins Com 2009)_asrasoal 22 -_ Erayate Cows &Exceptony 220d)Auooaas|BY s ogre Agcroves Dewcn Arora 990d)sua A604)_sug /cbvod!2900)4 1390 O ie 20.0001 syug/ones!Doss)34197 Se } nets Lam v.78 Mad)St!| Dated ih Septem IMO Ost ASE Rao1200OmiemcetSrvem9g09.Yamal ocyoess]Age s2.200.000' 1700 08.Lage Segere 129g)Ocy Ag ABI |400,00 base Ma 4/8)e797 dia paiAcaseZe.2000g|Age ipares)Mews Layee 22.90 Es 1.01 Jor Deagn AODal sare bays)saryz isa 30.99 - ened Crogect Mar 500g)Feoriaral Femrrsroa 90 os Sesect Speceon Deson Am leno 9a al Ferre!ma)a hoe Frome.orerct Freeing SORaL Ferret gy am.os fog srg.200d]MormayaMey,2200)é Lap oe 0a}Mag 6?/04|Mew aroa 33.200 5D Deeg 2000gl Mow2eveal puryzaye|317 400:a 00.08 Sent Docagrearey Yoon aavaaeal aay roe 38.000.- 400.02 Bg Sipegtion Commycton ___|Eng-sup,12a)awed ayia 6,68 - 40 o Soe 2 Cree Zl awe?PY cra)208.e poor Aw 3 Eros Mal sacorel _pazsve 19.90)4 1399 Cote ctOn,Jaga Aco)wave!51.012,709 311 'LLZLEZIRTEITEETZIZE retin Speen.BOQOt Apes!Ape 20706 3h bhp = eles $004)Agy Agua 25a Sy.= 300.O00G1 AgeZ7/061 Mager Me - 499 O6 Lees!Fou SRG)Moe206!Moet $170.74 = {90 Ob ZIVA Mes 2/961 agesoy96|$867 93 es 560 Ob SO al Moweye,Maw ee)-= 190 97 &vores &Logogl Monsees wae $90,121 504 =a 1500 Soe ba 300.41 Marz6r06!acy)96)32183.= 00.99.yapes Gi ps!B 90 90 saxtes. Pern Geviech FP reapct Mar ' 1390.2 sony o 4 img ore an Road Acutoves Aworg 4 1390 o4300 specs,= 1300 90 -ne.--e 13g ah pat -nee oton,Led bpp |soapy torpotReeorcn Owen Gs LETT Norm of rogogl mary tarpel sacriaat sisg0)-Fangs S.guction Reeorcner |90Dul Map 18/s4|_Mary 1y0al -_ ists upsaton Romarcray|2600q)MayIEM)Apr aeyca shim -s Sox ot 200}Moyivoal ager!290 a Agency AD 6 10ga]Aceaevoa]Moet iad 200)- fhe FAA C.LaQal Moys11704)Mays 29a]10.0){oo 1705 0.Ow Agere]4609al Apes!sev xvod $210.0ope|ay foramen Qocnenn |ROW Agent]47.00gh awwxyosl Octo roal +82.720 00419.04 ROW Ager asda Ocrc6yal Ma28/98)EyresPeeceeogine'D0dt scr (296 |Mar2835 a 4 190 09 IALgt Dec r05/05)sey 607]$1 gat 7a 1001Qeegnae4904]Dec 0603)Dec a077]ning @ 100 oR Project Mor $00ah srw?Oa)apy Leia an = 'S903 Deen Fn Protect Mart ogpal saveyes|sar zivaa!Et 4 00 Frat Desgn Coreoct SODgl aay sya)ory91roa]3.90.= Sora A pera 299g)sas71 sat_gary jira s200)4 ine £«Apt,729000)FeO)eal dary 14/97 |146.006!)Prosect som om gl 717al femoloal _sgryee7)so7omerycoeur2800ulfemoralwesoaroal$36 599 2)mee |||or se.96,18.90al.Fatoye304)napisy]eer - f Maa lipeem.d shooal moxvesel uavorree 'SS ore Dai eM,42009)AcrAR (oe,MoyAproa|i4gzz0 - Desay Ioan om,1900.31,s9e/09/4)sqpriz/04 £10,320:|-_ NORTHERN INTERTIE PROJECT 1993 ae,1905,18 terloa?Tom Nome Remuces|Ovaron |stan in Tota Coe -Gor nesae 7 -a ca =-=YF =x x =a =====3 1 =oT a Dor ry foo ¢ses Pa 50.09 9)Quy appl S62200 ||TS ree lesan une ¢Sou tower renga 960001 dnewvedl yowmyee|5142 928 0)a Sgewmucnon me pa $6.00]agyr0reel gy ya zor elsomoa"|S000gl Marr ayoa)Mages31/08 ope ee Qooymenn,co Pe Is09a1 Octy2I fal Mowizoa 39 - Rowe shi)OM 10.099]Augy ttyoa|_aegasp'cae!10512 = &co reel worse agus?a aApoatcorsesome|360091 Saco?ary|saa yop |g.Bow Cd 15.09ol Qecmereal 3762 200Purefogsuprert.S4__sa00¢!ssog3v)Oe erseel 343.077 el /N0.00 |Devesco Qecang curwocts Lig!spore!swaeel 34.070 98)nyotance,crorung*12.090]Apri W061 Maw 1/961 ere - Qo Geging 9 ere”ODN]Moy Ou MA!Su! cas Erpuge Ceca Noe ergs”Lopgj maou!Mae ss. Award Georg Cormocy 290.9)May Nge 21 aw ROW Oegang,111.09)Ags Word see|31.09),970sageBegpe|crpomna 48.094]Moy aay ForetorSeguazregen$6.90.31 Sows!spiagp a rer Glog un 3 Segara ¢Sponal pari276 sear $20.Eee 192 Od Qed re 4 Cregaing «23.90di Apes Orr)Mecaes7,Fi LP-I ees 5.Gog ire §Cieomne.19004)Mayt17/96)_ayy}397 2000707_|une Go.oreo 2ansQd|acs ive)age 9 0.09amn9tbye¢.reapct Mos]15:00.g)Mews ane!24.5000 on pen &rope'gan)pera 2 2CaBrassrere"-2.90.9)aarvoey6t 31.08:' Arend ure 1 Corergst,tect Mgr m9!EN a $000.Lurk 2 Cormac!Documene loremcrstar]18.00}Fxby70/061 Nay saan:-- een c:Eroriune'oma)mg:wg 32.09]4 £0.04 was ererune'2004]maZioel Massel sige ' Asoarg Uri,2 Cormoct oma May Ma.En 4 200.08 re.3 Cs 1300gL want Agamrvt!a0 =- Open &enor sve"290n\_Ag,8%50.90 a cmoe |trac Enarsne'-ZM91_Amriwveel Ap tzrol en . ayseg rte 3 Coniroct OOD a)Apizrtel ag t2s6l 20 4Sou?rk 4 Conmoct Donpranty 18009]Maye Oral Magy /31/961 sey - een ¢Fronne 2.09)Magee?1/06,Mead 764 sao 4 AVrite J Evg ¢rere"2909)_asyol,AG 51 ba |Awoed 8 4 Conmoct iter ee B £100 oP Unk5Cormoct Qooymeng Proctor 3500g1 Ags Ma gaa'Qoen c::QONnL Mew rogr es)Mae as ate gas crane'2.20.41 Maw/Oaro6)Moy sige Award Ure §Contract 290.4)May07r%6)_bar Et ong |Mater ol Sepe3 foal Age $19,748,208.001 10}20091 sens sel sere eroal xu Dev Cog en.$0091 sepe27/pal_Oc,ey) ners 189091 Act Worm Maw 0 a irene 2.00d]Mg Oarv6|Moy 39:4bonePretian5.000]Me ag Maes 20961 3a.-= Award Mpegs Coreget SOQG1 ares)sevonyc!EN 4erPCRSMiiargs}penCd 200091 Maye Seo27/06)aes a bon 06 Accept Mage rk 2 MoreenCd 2000G1 Fetzer!Moezr6l 36.75.99)ood - mt y ACSIA Wage -ae 2 Mgnongt,2000at meas aye)Ags t2vee!us aus 2300.08 Accept Man -Ure 4 nicppet 220g)awa)Seog el 52,905,tes:a aNd Accept Mon -ure §omeegt 20004)sapr 161 oct 21pm - wo |ce 3060dl O73/951_Mcrae a7!sizes!7 200.91 Lak!weet Corey 1-00gi Mey,a Ups 2 repect OM 'Conmmuctog 144.00g}pee |oo Uri 3 wepect (Oa Cormmacned 172 004!Mg AR 3 abp62, 8 iM Conemcned 92000)Now!rt 306|rs 5 rapesrca ony an009|OovisAe|Deainel star,eee |{|000 |un |Conamucscn,165091 Sap27/6|Mayo]seazs.engl0091ramencd440091$9077,wag 2)eel 1 {m"'Conant ngman,sm:ry ute0.399 OD frre 5205)aera eH 2.000.Lata 08 1 ureran”$0091 Dec o/s)ogc 596 09 mn 3 Ob Dearest 14003}pecs sszax2.- 0.08 Lena”259041 Fao 3272.91491!a [3200 oF Srect screen,Lremar,20091 Fee Seon),L311 962.= 00.08 ergeune.O90ol.Fee?961 Feeale?el,20 a 70.9 sang wee \inernany',$200.01 Feo (re)Agezercel _$1,136.3907;20010.Jenegn wee.Lnemesy 25091 acs (zoree)Mees 3102708.008 |=aL Approve Conguxt cree SONG)Mai sOregl Mow i7;2900 -= pan |unez Corgmacton 1gaadl Mop 2676)sryone7|$6 oe 972.02)2901 unenorg,500041 Mare!{| (ane conemgct unemanz=|84.08gi Qs 2.12122) 0.08 Erase'S99 al_Ocy gaat = bapoe |rey yr 2 uarreang,sonal Bee]346490 -= he Denes 14903}_agy'DaOHoe!3162832 -Z a Oe ATEEroie Decree.nena,28:009)Rae961yay:ee 2)Sect Seychege Lunenan2 ,2900]sae)3121.90,= auek inerure'<$909)Sey?14)seu!$2,000:= 24D.arg wre,unger,$000d1_sage)ess 31208 19).a ee3.10 iermon we unemang 11904)Decciene)sanepe7|_s12come oa 2400 Approve Conauctor creire”S204l sonnet!paryonys?)32000 lal |bine 3 Conemucson UReogl Acuizree!Dec 23,4.010720 464 . oR -a eed be !|bso |Conenact uemanz-|47 40a)agvicree)Agarz),Shion?es|one Err ee $0041 auai27,eae 2.000 = 0 6 2 rerang,$00g)_Anyi septs ¢| &Denes 3001 savzeeel aa pus gip -=ef:00 Ob uremani-|250041 aa Agtiyrel 72.9160 --Z i'd rect arucn ses,unernand=ZOO9)Aye!Apia)PIE = 500 08 reese TP)sani soto = 300 09 sore,vee namang,$4009)Sepyt|$1,179,9089;3300.19 Igrmco wre,nernan,199091 DecAg sel Docs owe - F500.1b Aererre Const rere Sal Oe /16/%61 Dec.23,33.900 = 00.9)bre 4 Cormmucton,124 50-91 Seve),Es brkirvth030rem.C4 32004 Sen 1/96]Nowisel s291,11201 -e52008CongresLrgman,S&O091 Now i561 fenerol $99?259 571 er Poy rere S00¢1 Feo i3ee]Feaf2 23.009.-= 00.8 Pick yo Mga le 4 LUranen'3.004)ows 66!News 379 04 os A Detver materia 2004]Now 76961 tow Sean = 00 Ob Asmeninne Suchs o6.unerngn”,L903)Nowe(29/95)Opef 3.130999 - 39 OF frect Suc ses pernan'290g)savy 440797 0.08 erosune $a Feewesel teey13,sem -= R sig wee.Lunamon 258009)Fapy23/06)Ma if a tn.10 lerpcn wee renga:aspal_Mag]sacrrers|pare =in Agzrove Conguctor rar sire S0ogl Mare scsan sl 2.90)" K70.00 |une §Cong:san $2099]Ocy!Deca7|soa137pQnUuremanC49DalOcy,123/98)sa ava - Ma ieed Congest Legere,24009)csi Now (20/964 SHUI?13)es rl inane igeg 07764 sso ' 99.94 4 Lineman”Mg0dl Oona Osirarns)sists,'bakes Qetest matenge :3004)Onze 06137,Je106.Assninie Sny ng e8 Lpeman”50001 Ocya7r6l Novas pasty Uw frost arch res nena 1204]Decal Dec Anes!306.295 |a 0.08 Enoruine Lond!Des 16/951 De:0,seauual ' snesorebarony MED NORTHERN INTERTIE PROJECT Reeneces |Cusanon |ssat tna tot Cow ====a <=a ed =- 1H 1900.i 1997 Aug,aD a Now Dw Jon Feo Mar ape New an Fy aug "ae Out Nor Dec x ho Te we ay Th 7]ri ===oe ==Irarnon*00g)Deca]Oecr21/05]5749 165.51 pean'5.909)Deer Dec es5)iF)=Engeune LOD0)Dec zeri6l Ox (27/05)350 00f 1uramgn,¢.2003)svooe|sanyiz97,Shah a .Ene dree Sop0|pay i30 y 52.4008 -Accept Prowect O0RG|parva]sayaue?209 Parks Link 3 27.0 miles .Wainwright ubstation 12.5 miles K Parks hignway SCALZ 1:250,000 Healy Substation /ORV LIT:PIT DRAWING NO.IDRYpen ¢ILalRue |ALASKA ENERGY AUTHORITY CONSULTING ENGINEERS PRO®SED REALY-FAIRSANKS INTERNE DATE:01/083i SOUTH ECLTE BS;ORS oes A.6 GOLDEN VALLEY ELECTRIC ASSOCIATION INC.Box 71249,Fairbanks,Alaska 99707-1249,Phone 907-452-1151 December 16,1993 John Clayton Burns and McDonnell PO Box 419173 Kansas City MO 64141-0173 Re:Request for Proposal -Healy to Fairbanks 230 kV Intertie Dear Mr.Clayton: Golden Valley Electric Association,Inc.,located in Fairbanks, Alaska,intends to contract with an engineering consulting firm for design,material specifications,and preparation of bid documents for a 230 kV (138 kV operating)transmission line from Healy to Fairbanks.The final design will be mainly X-tower design using weathering steel towers with suspension insulators,and a short section of single pole design north of the Tanana River,whichshouldincludeprovisionsforonecircuitof7.2/12.5 kv three phase underbuild.As an option,proposals may include details on additional scope of work which may be expanded to include bid evaluation,project management,and construction inspection. Digital Video Geographic (DVG)survey system data,aerial photography,and ground surveying will be provided by others. Golden Valley is proposing to construct Links 1,4,and 5 in 1995,and Links 2 and 3 in 1996.Design and environmental should be completed in 1994 to allow for delivery of long lead time itemssuchastowers,insulators,and wire,etc. Firms wishing to be considered should respond in the form of a proposal and statement of qualifications,along with the resumes of staff available to support the work,man-hour breakdown for each work packet (the general engineering responsibility chart is attached to illustrate specific responsibility sharing and is not. intended to be a complete list of required duties),fee schedule, design schedule to meet proposed construction schedule,firm'sabilitytoproceedwiththeworkimmediately,sample of a similar project recently completed by the proposed project personnel,list .of cold weather projects and other applicable experience performed by the proposed project personnel.Project proposals will be evaluated on price and the above supplied information.Personal presentations are not necessary,however,if you have questions, GOLDEN VALLEY ELECTRIC ASSOCIATION INC. Burns and McDonnell December 16,1993 Page 2Request for Proposal don't hesitate to contact us. Proposal and information requested shall be sent to Golden Valley Electric Association,Inc.,Engineering Department,PO Box 71249, Fairbanks,AK 99707-1249,and plainly marked "Proposal:Healy - Fairbanks 230 kV Intertie."Letters of Interest will be accepted until 5:00 p.m.local time,January 6,1994.The contract form for this work will be the standard REA Contract Form #236,including Golden Valley Purchase Order -Terms and Conditions. Sincerely, AgsLPagAONE oe Steven Haagenson Manager of Engineering Services Enclosure:Route Map Proposed Schedule Proposed Contract Forms General Engineering Cost Breakdown General Engineering Responsibility ChartMan-hour Breakdown per Resource/Task Chart DISTRIBUTION LIST FOR REQUEST FOR PROPOSAL HEALY TO FAIRBANKS 230 kV INTERTIE TRANSMISSION LINE DESIGN Dryden and LaRue Power Engineers Stone and Webster Engineering Corporation,Inc. Commonwealth Associates,Inc. R.W.Beck and Associates ECSI Engineering and Consulting Services,Inc. Burns and McDonnell ENGINEERING SERVICE CONTRACT ELECTRIC SYSTEM DESIGN AND CONSTRUCTION AGREEMENT mude ,19 .between (bereinafter called the ''Owner''), and of (hereinafter called the 'Engmeer''). WHEREAS,the Owner has obtained from the Administrator of the Rural Electrification Administration (bereinafter called the "'Administrator”)of the United States of America a loan or loans to finance in whole or in part a rural electric system pursuant to the Rural Electrification Act of 1936,as amended,and plans the construction ofa project designated ,being hereinafter called the 'Project,'consisting of approximately the following facilities: miles of KV line, miles of KV line, KVA substation(s)KV to COCKY, KVA substation(s)KVto_CK, miles of line conversion,___miles of line removal and the following: NOW,THEREFORE,in consideration of the mutual undertakings herein contained,the parties hereto agree as follows: ARTICLE I General Obligations Section 1.The Engineer shall render diligently and competently all engineering services which shall be necessary or advisable for the expeditious,economical,and sound design and construction of the Project with due consideration given to all ecological and environmental requirements.The enumeration of specific duties and obligations to be performed by the Engineer bereunder shall not be construed to limit the general under- takings of the Engineer. ARTICLE Il Pre-construction Period Section 1.The Engineer shall give thorough consideration to aesthetics and the protection of the environment in all phases.of construction of the Project including line routing and station locations.The REA FORM 236 (REV.6-72)1 publication,"Enmronmental Criteria for Electric Transmission Systems,”issued jointly by the U.S.Depart-ment of the Intenor and the U.S.Department of Agriculture sball be used asa guide in the planning of trans-mission systems.Where an Owner bas an "Environmental Statement"or a published environmental analysis,the Engineer shall incorporate all environmental commitments of the statement or the analysis that specifi- cally relate to the transmission facilities to be constructed. Seb HORTA MEK EA AR OL OOH HOKE CPE Ae IO MER A AOR WL ROER KXPARESUREKeYOMHDesDia32AH08OTOHPettFe3BOOSKBOSALoeDeeeBAKOKEDOIHKPREOGTGBDLPokattsKATMAptOPOeMHexX Fahd SEH gt ak ail a LO WILK WO CHAE XK MOK ISHIOK LOT SCSORCEOROSOR 09 30 KIN LT RLE EL X.MGR KOE RK De BO Mea WAS SX BO Ed Ft ne tO OL Sa Heat Hep Ip PRAT KLOK OK KKK RK KO68HEHAAI Section 3.If requested by the Owner,the Engineer shall prepare and submit to the Owner estimates of quantities of materials to be furnished by the Owner for use in connection with the construction of the Project. The Engineer shall procure and submit to the Owner forms of contracts and other documents for such mate- rials and for such other services as may be necessary or desirable in connection with the construction of the Project. Section 4.For transmission lines the Engineer shall prepare and submit to the Owner and the Adminis- trator for approval a summary of transmission line design data with supporting calculations.The Plans and Specifications and the Plan and Profile,if any,sball be based on the design data approved by the Owner and the Administrator. Section $.The Engineer shall prepare and submit to che Owner and the Administrator for approval plan and profile sheets for all transmission lines except N/A Section 6.In specifying right-of-way clearing for transmission lines where "feathering”?and/or undulat- ing boundaries are required,the Engineer shall mark all brush and trees to be removed unless such marking is the responsibility of another authority,The Engineer sball also compute ail clearing units,and sbow all clear ing units on the plan and profile drawings or on separate drawings prepared for this purpose. Section 7.The Engineer shall prepare,and witbin *days after the date of execution of this Agreement submit to the Owner and the Administrator for approval,two copies of complete and detailed plans and specifications,drawings,maps and other documents required for the construction of the Project (all of the foregoing being bereinafter collectively called the "Plans and Specifications”).In the preparation of the Plans and Specifications,the Engineer sball consult with the Owner to the end that the Project sball serve the purpose intended by the Owner and approved by the Administrator.Unless otherwise directed by the Owner with the approval of the Administrator,the Engineer sball use Construction Work Plans and Engineering Studies,as furnished by the Owner,as a basis for the preparation of the Plans and Specifi- cations,The Engineer shall diligently make such changes in the Plans and Specifications as may be required by the Owner and the Administrator as a condition of approval thereof. Section 8.All maps,drawings,plan and profile sheets,plans and specifications,contract forms,addenda, estimates,studies and other documents required to be prepared or submitted by the Engineer under this *Refer to project schedule REA FORM 236 (REV.6-72)2 Artucie (1 or other articies of tats Agreement spail conform to ine appitcable standard specufcanonsangotherformsprescribedbytheAdministrator,unless deviation therefrom shall have been previousiy aporo vedbytheAdministracor, SKK RADAR OK SU K ROM KOREAN GOR HI He OHIO XOXWHHLAHROCKIHWKKORXOKNOEEEKAMOEKFEREDKMtOHSKOTOWKGRKIASRALKWOKEOKNAGEBXKRMNMMRGKIONKMACKSKXORBRKHFARNRKRKAOR,HORKOS XENI NDE OK KAN KOK ROKK MO HAE XXOAKHAMRARKIEKNRKDENHERXDATERKDOKKNGGKKALEDDEKKKORKIKRRNTOICKXSeUAERRRRRXFERENICAEAKOTAKALRKYORKCHIRKATARRFRLRIERA CRONEKKKOPRARKEENRORCEK The term "Construction Contract”as used herein shall also include right-of-way clearing contracts,equipment contracts,or materials contracts if such contracts are utilized in the construction of the Project. Section 11.The Engineer shall be available XXRPERAPARKMRAE for consultation with respect to the details of the Plans and Specifications and all other matters pertaining to the preparation of the pro- posals for the construction of the Project or the supply of materials or services therefor.JAR CRHRERK DEXpestetveittcbestcetebekivdatedbebrctrtateteheaskctcitctatebesebehtreetreeteleacictcfctehehetek Section 12.If any change is to be made in the Plans and Specifications after the Construction Contract bas been approved by the Owner and the Administrator,the Engineer sball prepare and submit the necessary details for a contract amendment in accordance with the procedure prescribed by the Owner and the Administrator. Section 13.Prior to the preparation of Plans and Specifications by the Engineer,the Owner shall furnish to the Engineer the following as may be applicable: (a)Copies of pertinent Engineering Studies,including Construction Work Plans when available,on which to base the design of the electrical facilities to be built;key maps of the Owner's present and pro- posed facilities;and detail or vicinity maps showing location of existing lines,consumers served and ease- ments obtained. (b)Detailed lists of materials,if any,on band or on order which ave to be furnisbed by the Owner in the construction of the Project,togetber with the quantity and the value of each item of such material. REA FORM 236 (REV.6-72)3 (c)With respect to materials contained in the assembly umtts indicated for removal,a list showing values of individual maternal items for which the Contractor will be credited with respect to salvaged materials returned to the Owner if not included in item (b)above. ARTICLE Il Staking Section 1.The Engineer,with the approval of the Owner,shall determine when staking of the Project shall begin;peBdidt Cb Mat X CAR RDEPEh NE KM EIS KOO MOUNT WE OOO 0 Od OOO YK ON VK X KX CoRR RAS ME RGX UH RO Ke OM a MX AS RR KAD SOMONE EO ACT OYE KACO OPK OLOE K Bt KEK X PHOFOS LEE MeOMA PGE KA The Owner shall furnish qualified persons to negotiate with landowners or tenants with respect to such right-of-way authorizations and easements and the locations of meter poles or service entrances.POS RHgUMUEMDGN PICKER Wikige RTH EA BOCK KUM AGM CON LOR K WIL OK WK XKmbHACKISMALUKKKKARKOYDEOERNoarmProperOwnershallberesponsibleforstakingoftheProjectunderaseparatecontract. Before the Construction Contract shall have been approved by the Administrator,all project distribution line if less than 100 miles and all project transmission line if less chan JO miles should be completely staked.If project distribution line is 100 miles or greater,all conversion,repbasing,and removals (hereinafter called line changes)and one-third of the project distribution line not including line changes or 100 miles whichever is greater should be staked.If project transmission line is 30 miles or greater,one third of the project trans- mission line or 30 miles whichever is greater should be staked.Staking of the balance of the Project shail be completed before one-balf of the period specified in the Construction Contract for completion of construc- tion shall have elapsed but in no event later than sixty (60)days prior to the date of completion specified in the Construction Contract. The staking shall be done in a thorough and workmanlike manner and in accordance with the latest revision of the National Electrical Safety Code,applicable state codes,plans and specifications and approved trans- mission line plan and profile sheets.FORMA jae Hrs RAMOK AOS MIRE EAS 0 Ye OT I MRK EK XtOBKErCONTOMIBEECRIKESBKNOEKESPPOASOGBOMEEGMOEMEMIKOHOEKKXXXPROZAEHSAMDEBAKABLUEPOORHTKADOHKKMOEReBRLaSREBONCOHIOMETKONKXKKK SMBS RAK VOCS HA SKM FHM All stakes shail be marked to show the pole number.Where practt- cable,all stakes shall be driven in such manner that the pole number shall be visible from the pole hauling truck when poles are being distributed.Each transmission structure stake shall be marked with the station number and the heig d.class ofpole.Where it is probable that the Contractor will have difficulty tnlocatingstakes,spa ino drive a four-foot building lath or equivalent in addition and adjacent tothestake.The shall give due consideration to the location of the consumer's load center and service termination in staking pole locations on or near the consumer's premises so that the service entrance cable or low voltage conductors to buildings will be as short as possible. Section 2.The Engineer shall cause staking sheets or structure lists to be maintained in such form as the Owner with the approval of the Administrator shail require,on which shall be accurately entered all pertinent and useful information and directions concerning the construction of the Project,Five counter parts of the staking sheets or structure lists shall be supplied by the Engineer to the Contractor and two copies shall be supplied to the Owner.When revisions in staking sheets or structure lists are necessary,tbe Engineer sbail cause all copies of the staking sheets or structure lists to be corrected to reflect such revisions in che information or directions previously incorporated thereon. Section 3.The Engineer shail prepare and submit to the Owner and to the Administrator a report showing the quantity,kind,price,and extended total of all units of construction for each portion of the Project at the time such portion is released to the Contractor for construction. "REA FORM 236 (REV.6-72)4 Section 4.A competent resident engineer,with full auchonty to act for the Engineer,shail 9¢main:tained by the Engineer at the site of the Project at all ames when Staking is being performed. ARTICLE IV Construction Period rovide Construction Management (CM)serviceSection1,The Engineer shall Fug BAGH Gi MALIK BC RAL MORAL Rand Cal make diligent effort to insure the expeditious and economical construction thereof in accordance with the Plans and Specifications and the terms of the Construction Contract or contracts and insure that all specified environmental criteria are followed.The Engineer shail carefully inspect all materials prior to their incorpo- ration in the Project and sball promptly reject all materials not in compliance with the Specifications,The Engineer shall also wapmruweotkinspect the manner of the incorporation of the materials in the Project and the workmanship with which such materials are incorporated.Such inspection shall be deemed to be ade- quate if a reasonable percentage of all construction units are inspected at the time of installation.The Engineer,as representative of the Owner,shall bave sole responsibility for requiring the Contractor to per- form the Construction Contract in accordance with its terms and the Plans and Specifications;and,in performing the duties incident to such responsibility,the Engineer shall issue to the Contractor such direc- tives and impose such restrictions as may be required to obtain reasonable and proper compliance by the Contractor with the terms of the Construction Contract,Plans and Specifications,in construction of the Project;provided that the Engineer shail not be required to exercise any actual control over employees of the Contractor.The obligations of the Engineer bereunder run to and are for the benefit of only the Adminis- trator and the Owner. Section 2.The Engineer shall measure ground resistance at all substation ground fields prior to bond- ing the ground field to the substation structure.In addition,upon recommendation by the Engineer and authorization by the Owner,the Engineer shall measure the ground resistance at the following locations: (a)At all transmission structures with overhead ground wire prior to the installation of the overbead ground wire. (b)At all transmission structures with pole grounds prior to the installation of power conductor.The Engineer sball prepare a report of the ground resistance measurements mentioned above and submit such report to the Owner together with recommendations for changes,if any,required to insure satisfactory operation.To the extent such changes are approved,the Engineer shall make appropriate changes in the Plans and Specifications in accordance with the provisions of Section 12 of Article II. Section 3.The Engineer shall maintain at the site of the Project during the entire period of construc- tion a competent resident engineer with full autbority to act for the Engineer,unless specifically directed otherwise by the Owner in writing with approval of the Administrator.When necessary to assure adequate inspection,one or more competent inspectors shall also be maintained when construction umts are being installed ov corrective work is being performed,the number of inspectors being subject to approval by the Owner and the Administrator.The Engineer sball report,in writing,all defects in workmanship or materials to the Contractor and the Owner and sball instruct the Contractor to correct all such defects immediately, in accordance with the terms of the Construction Contract.A resident engineer shail be present during the final inspection of completed construction by a representative of the Administrator. Section 4.The Engineer shail test along lines,immediately after they bave been energized,for objec- tionable radio interference.All cases of radio interference due to faulty construction of,or defective equip- ment in the Project shall be reported to the Contractor for correction. REA PORM 236 (REV.6-72)5 ARTICLE V Final Documents Section 1.The Engineer shall prepare and,within twenty (20)days after the completion of con- struction of the Project by the Contractor,submit to the Owner and the Administrator for approval com- plete and detailed final documents. ARTICLE VI Compensation Section 1.The Owner shall pay the Engineerfor the services performed bereunder as follows: (a)For all services in connection with the preparation of the transmission line design data as required *by Article Il,Section 4 bereof,the sum of *Dollars (s_ **), plus the sum of **Dollars ($x*)per mile for each mile of Project transmission line included therein,which sum sball be due and payable ten (10)days after the approval of such services by the Owner and the Administrator. (b)For all services m connection with the preparation of the plan and profile sheets provided for in the approved Plans and Specifications,if and as amended,including lines which,pursuant to the direction of the Owner with the approval of the Administrator,shall not be constructed the sum of *k**Dollars ($___**__)per mile of Project lines which sum shall consist of: kkS____per mile of Project line for transit and tape survey,$**per mile of Project line *k*for level survey,$________.per mile of Project line for office engineering as evidenced by approved plan and profile sbeets.Such sums sball be due and payable ten (10)days after the plan and profile sbeets, sn untts of not less than ten (10)miles,are approved by the Owner and the Administrator. (c)For all services set forth in Article Il,Section 9 hereof,a sum equal to the out-of-pocket expense of the Engineer plus N/A percent (N/A %)thereof,plus subsistence expense,if any,paid to (or on bebalf of)employees,plus reasonable transportation costs of employees,plus the cost of prints and telephone and telegraph expenses,which sum shall be due and payable ten (10)days after approval by the Owner of the service performed and the invoice of the Engineer.Out-of-pocket expense shall be limited to money paid by the Engineer for direct labor,labor taxes,labor insurance,pro-rated sick leave,vacation, holiday,retirement,medical insurance,and life insurance benefits,all applicable to such direct labor,except that,in the case of services performed with the prior approval of the Owner by the following named officers, partners or others baving ownership interest in the Engineer the rates corresponding to "direct labor”set forth below shall apply: **Refer to estimated costs REA FORM 236 (REV.6-72):6 (d)For all other services set forth in Article Il bereof,including without limitation,the preparationofPlansandSpecifications,the award of the Construction Contract or contracts and any approved amend- ments thereto,and the preparation and awards of contracts for materials or services,the sum of *k*kk Kk Dollars ($),plus k*...enaDollars($_______)per mile for each mile of Project distribution line,including line changes,and **; .Dollars ($)per mile for each mile of Project transmission line included therein,which sum shail be due and payable ten (10)days after the approval of the Plans and Specifications and any amendment by the Owner and the Administrator. (e)For all services in connection with the staking of Project lines provided for in the approved Plans and Specifications if and as amended,including line changes other than line removals and including lines which,pursuant to the direction of the Owner,with the approval of the Administrator,sbail not be con- kk kkstructed,the sum of.Dollars ($____e )per mile of .aay **xxProjectdistributionline,and the sum of.Dollars ($___ per mile of Project transmission line,which sum shall be due and payable ten (10)days after delivery to the Owner each month of a certificate by the Engineer of the staking completed during the preceding month. Such payments shall not constitute unqualified approval of the staking and where restaking is required for reasons within the control of the Engineer no additional compensation sball be payable. (f)For the replacement of stakes made necessary by causes beyond the control of the Engineer and where the total mileage of such replacements is in excess of ten (10)percent of the total miles of Project lines staked,a sum equivalent to seventy-five (75)percent of the compensation specified in subsection (e)of this Section shall be paid for each mile of replacement of stakes in excess of ten (10)percent of the total miles of project line staked,which sum shall be due and payable ten (10)days after delivery to the Owner,each month of a certificate by the Engineer of the miles of replacement of stakes completed during the preceding month. (g)For ail services in connection with the supervision and inspection of the construction of the Project as set forth in Article I'/bereof: (1)The sum of *%($xx )per day for each engineer for the time each engineer is actually and solely engaged in the supervision or inspection of construction,when construction is regularly scheduled and actually performed including time when the Engineer is available and through no fault of the Engineer scheduled construction is not performed. (2)The sum of **($*%)per day for each inspector for the time each inspector is actually and solely engaged in the inspection of construction,when construction is regularly scheduled and actually performed including time when the inspector is available and through no fault of the Engineer scheduled con- struction is not performed. The Engineer shall submit to the Owner each week a statement showing the names of the | engineers and inspectors and the time actually spent by each engineer and each inspector during the preceding week in supervision and inspection work.Written approval by the Owner of such statement sball be a condition precedent to the payment by the Owner of any compensation under this subsection ().**Refer to estimated costs REA FORM 236 (REV.6-72)7 Compensation payable under this subsection (g)shall be due and payable ten (10)daysafterthedeliveryeachmonthofastatementbytheEngineerofthesupervisionandinspectionworkperformedduringtheprecedingmonthandapprovedbytheOwneras provided in the preceding paragraph. (b)For all services in connection with substations or switching stations,except supernsion and inspection of construction,an amount equal to N/A percent ¢___N/A %)of the cost of construction of such substation or switching station which sum shall be due and payable as follows: (1)50%of the compensation estimated by the Owner to be payable under this subsection (b) sball be payable witbin 30 days after the approval of the Plans and Specifications by the Owner and the Administrator. (2)Such additional amount as will,with payment under (1)equal 80%of the compensation estimated by the Owner to be payable under this subsection (b)sball be payable within 30 days after the approval of the Construction Contract by the Owner and the Administrator. (3)The remaining compensation under this subsection (b)shall be due and payable 30 days after completion of the Project as bereinafter defined. "Cost of Construction”sball mean the total cost of labor and materials used in the con- struction of the substation or switching station as shown in the Final Inventory Documents and Inventory of Work Orders in respect of work performed by the Owner, (i)For all other services in connection with the Project,including without limitation,the making of the Final Inventory and the preparation of all final documents and maps,the sum of. **Dollars ($___*™__),plus **Dollars ($__**__), .........2 *xpermileforeachmileofProjectdistributionline,including line changes,and kkDollars($_______--.)per mile for each mile of Project transmission line included in the Final Inventory which sum sball be due and payable thirty (30)days after completion of the Project as hereinafter defined. Section 2.The total compensation to be paid for all services performed by the Engineer under this kk oe spreeAgreementisestimatedtobe,but not limited to $for transmission facilities,and kk $for distribution facilities. Section 3.Compensation payable to the Engineer under this Agreement shall be in addition to taxes,or levies (excluding Federal,state and local income taxes),which may be assessed against the Engineer by any state ov political subdivision directly on services performed or payments for services performed by the Engineer pursuant to this Agreement.Such taxes or levies,which the Engineer may be required to collect or pay,shall,in turn,be added by the Engineer to invoices submitted to the Owner pursuant to this Agree- ment,one (12%)percent per month Section 4.Interest at the rate of XbASCMEGRhesshall be paid by the Owner to theEngineeronallunpaidbalancesduetheEngineercommencingthirty(30)days after the due date;provided **Refer to estimated costs REA FORM 236 (REV.6-72)8 that the delay in payment beyond the due date is not caused by any condition within the contrsl oF tre Engineer.Such compensation shall be paid ten (10)days after the amount of interest bas been determinesbytheEngineerandtheOwner. Section 5.For the purposes of this Agreement,a transmission line is defined as any line 33 kV or more. Section 6.All computations of miles of Project lines actually constructed or cost of Stations erected in connection with the determination of compensation payable under this Article VI,shall be determined from the Final Inventory Documents,Inventory of Work Orders in respect of work performed by the Owner, Plans and Profile,or structure sheets suppoxted by the final documents approved by the Owner and the Administrator;provided,bowever,that where the original mileage used as a basis for the preparation of transmission line design data or plans and specifications shall bave been reduced by action of the Owner after having been initially established by agreement of the Owner and the Engineer,compensation under Sections 1 (a)and 1 (d)of this Article VI shall be determined from the mileage first established and for which such work bas been completed by the Engineer.Compensation paid under this Article VI shall be subject to adjustment in conformity with this Section 6. Section 7.Prior to the time when any payment shall be made to the Engineer pursuant to this Agreement,the Engineer if requested by the Owner shall furnish to the Owner,as a condition precedent to such payment,a certificate to the effect that all salaries or wages earned by the employees of the Engineer in connection with the Project,bave been fully paid by the Engineer up to and including a date not more than fifteen (15)days prior to the date when such payment sball be made.Before the time when the respective final payments provided to be made pursuant to this Article Vi shall be made to the Engineer by the Owner,the Engineer shall also furnish to the Owner,as a condition precedent to such payment,a certificate that all the employees of the Engineer bave been paid by bim for services rendered by them in connection with the Project and that all other obligations which might become a lien upon the Project bave been paid. Section 8.The length of the Project lines sball be determined by taking the sum of all straight bori- zontal span distances between pole or structure stakes or from center to center of poles or structures carrying conductor,plus the length of service measured borizontally from center of last pole to point of attachment to the consumer's building.In computing the length of Project lines,underbuild and the additional circuit in the case of double circuit lines shall not be considered. ARTICLE VII Miscellaneous Section 1.The Owner may at any time terminate this Agreement by giving notice to the Engineer in writing to ebhat effect not less than ten (10)days prior to the effective date of termination specified in the notice.Such notice shall be deemed given if delivered or mailed to the last known address of the Engineer. From and after the effective date specified in such notice,this Agreement sball be terminated,except that the Engineer shail be entitled to receive compensation for services bereunder as provided in Section 2 of this Article VII. Section 2.In the event that this Agreement at any time be terminated pursuant to Section 1 of this Article VII,the compensation which sball be payable to the Engineer by the Owner shail be computed so far as possible in accordance with the provisions of Article VI.To the extent that the provisions of Section I of Article VI cannot be applied because construction is incomplete at the effective date of such termination, the Engineer sball be paid for engineering services in respect of incomplete construction a sum which shall bear the same ratio to the compensation which would bave been payable under the provisions of Section I of Article VI,if such construction bad been completed as the engineering services in respect of such REA FORM 236 (REV.6-72)9 incomplete construction bear to the engineering seroices which would have been rendered if constructionbadbeencompleted, If requested by the Owner,the Engineer shall submit to the Owner in duplicate a verified statement of bis actual expenses in respect of such incomplete construction.All compensation payable under this Section 2 shall be due and payable thirty (30)days after the approval by the Owner of the amount due hereunder. Section 3.The Engineer shall bave the right,by giving to the Owner not less than thirty (30)days notice in writing,to terminate this Agreement if the Engineer shall bave been prevented by conditions beyond the control and without the fault of the Engineer (i)from commencing performance of this Agreement for a period of twelve (12)months from the date of this Agreement and (it)from proceeding with the completion offull performance of any remaining services,required of the Engineer pursuant tothisAgreement,for a period ofsix (6)months from the date oflast performance by the Engineer of otber services required pursuant to this Agreement.From and after the effective date specified in such notice this Agreement shall be terminated,except that the Engineer shall be entitled to receive compensation for services performed bereunder,computed and payable in the same manner as set forth in Section 2 of this Article. Section 4.Upon completion of the Project or termination of the Contract,the Engineer shall be obligated forthwith to deliver to the Owner all maps,tracings,and drawings of the Project and ail letters, documents,and other material,including all records pertaining thereto. The term "Completion of the Project..sball mean full performance of all obligations under this Contract and all anendments and revisions thereof as evidenced by the approval of the Administrator of the final documents. Section 5.The following REA bulletins further describe the work to be performed by the EngineerpursuanttocertainprovisionsofthisAgreement: REA Bulletin Tide 20-21 National Environmental Policy Act 40-6 Construction Methods and Purchase of Materials and Equipment 62-1 Transmission Line Manual 80-6 Summary of Construction Releases 80-11 Reports of Progress of Construction and Engineering Services81-46 Closeout Procedure and Documents for Contract Construction of Distribution and Transmission Facilities 81-9 Preparation of Plans and Specifications for Distribution and Trans- mission Facilities In the performance of the Engineer's general obligations,other REA bulletins may be applicable. Section 6.The Engineer sball prepare and execute in such form and detail as the Owner and the Administrator shail direct all estimates,certificates,reports,and otber documents required to be executed by the Engineer pursuant to the terms of the Construction Contract or the Loan Contract,including progress reports of engineering services and reports of the progress of construction. Section 7.The Engineer sball approve each monthly estimate of the Contractor prior to payment by the Owner.Such approval shall include a certification by the Engineer that all construction for which payment is requested bas been completed in accordance with the terms of the Construction Contract and that all defective construction,of which the Contractor sball have received fifteen (13)or more days' written notice,bas been corrected.The Engineer shall also maintain at the site of the Project a cumulative inventory of all units of construction incorporated in the Project. 6 REA FORM 236 (REV.6-72)10 Section 8.The Engineer shall notify the Owner when the Project,or any section thereof,shall bereadytobeenergized.When requested by the Administrator such notice shail also be given to the Admims- trator.Whenever the Owner shail notify the Engineer that the Project,or such section thereof,may be energized,the Engineer shall,when directed so to do by the Owner,cause the Project,or such section thereof,to be energized. xx Section 9.The Engineer shall take out and maintain throughout the period of this Agreement the following minimum insurance: (a)Workmen's compensation insurance covering all employees of the Engineer who shall perform any of the obligations of the Engineer bereunder,whether or not such insurance is required by the laws of the State governing the employment of any such employee.If any employee is not subject to the workmen's compensation laws of such State,such insurance sball extend to such employee voluntary coverage to the same extent as though such employee were subject to such laws. (6)Public liability and property damage liabiliss 1 099,OOo.all operdaoarunter 09 0,gree: ment;limits for bodily injury or death,not 'ess than SYBKROO for one person and SPUCNAAXfor each accident;for property damage,not less than S25500U for each accident andBXROO aggregate for accidentsduringthepolicyperiod.$1,000,000 $1,000,000 (c)Automobile liability insurance on all self-propelled vebicles used i 409.9:;,0 99,the Agreementwhetberowned,nonowned,or bired;public liability limits of not less than XHOBXRID for one person and 'or each accident;property damage limit ofkSt@ 200 for each accident.STOO O00 nh Samet ore mO00,000Thepoliciesofinsuranceshallbeinsuchformandissuedbysuchinsurer as sball be satisfactory to the Owner.Upon request,the Engineer sball furnish to the Owner a certificate evidencing compliance with the foregoing requirements. Section 10.The obligations and duties to be performed by the Engineer under this Agreement shall be performed by persons qualified to perform such duties efficiently,The Engineer,if the Owner shail so direct and the Administrator sball so approve,sball replace any resident engineer or other persons employed by the Engineer in connection with the Project.The Engineer shall file with the Owner and the Adminis- trator a statement,signed by the Engineer,of the qualifications,including specific experience of each engineer and inspector assigned to the Project and the duties assigned to each. Section 11.Approvals,directions and notices provided to be given hereunder by the Administrator to the Engineer ov the Owner shall be deemed to be properly given if given by any person autborized by the Administrator to give approvals,directions or notices. SEXCIOARK FAEAR ARM PHERE RM RRR KARE BERGER LERERT BSE EER KLEYERWOKCCEONITKRAPRRWREAKRIEMEGPIELERKAYLEERIKEOIHEXWROLPITKCROOKHeRRGPHtKHORMASEIHRKFERRERRAREHepesLesCETESASRSEMTBEER Section 13.This Agreement may simultaneously be executed and delivered in two or more counter- parts,each of which so executed and delivered shall be deemed to be an original,and all shail constitute but one and the same instrument. Section 14.The obligations of the Engineer under this Agreement sball not be assigned without the 'approval in writing of the Owner. Section 15.The Engineer shall comply with all applicable statutes pertaining to engineering and REA FORM 236 (REV.6-72)it **The limits of insurance have been increased to be complientwith7CFRPart1788,Subpart C -Insurance for Contractors,Engineers and Architects 7CFR 1788.48 -Contract Requirements. Section 16 -The Engineer shall establish and implement aprogramtomonitorthequalityoftheconstruction.The Engineershallnothavecontroloverorchargeofandshallnotbe responsible for construction means,methods,techniques,and sequences or procedures,or for safety precautions and programs in connection with the Work,since these are solely the Contractor's responsibility under the Contract for Construction.The Engineer shall not have control over or charge of acts or omissions of the Contractor,Subcontractors,or their agents or employees,or of any other persons performing portions of the Work. Section 17 -All documents and drawings provided by Engineer related to this Project,are not intended or represented to be suitable for reuse by GVEA or others on expansions of this Project or any other project.Any such reuse without written verification or adaptation by Engineer for the specific purpose intended shall be at the reuser's sole risk and without liability or legal exposure to Engineer. The Engineer shall have the right to include representations of the design of the Project,including photographs among the Engineer's promotional and professional materials.The Engineer's materials shall not include the Owner's confidential or proprietary information. Section 18 -Claims,disputes or other matters in questions between the parties to this Agreement arising out of or relating to this Agreement or breach thereof shall be subject to and decided by arbitration in accordance with the Construction Industry Arbitration Rules of the American Arbitration Association currently in effect unless the parties mutually agree otherwise. Demand for arbitration shall be filed in writing with the other party to this Agreement and with the American ArbitrationAssociation.A demand for arbitration shall be made within areasonabletimeaftertheclaim,dispute or other matter in question has arisen.In no event shall the demand for arbitrationbemadeafterthedatewheninstitutionoflegalorequitable proceedings based on such claim,dispute or other matter inquestionwouldbebarredbytheapplicablestatuesoflimitations. No arbitration arising out of or relating to this Agreement shall include,by consolidation,joinder or in any other manner,anadditionalpersonorentitynotapartytothisAgreement,exceptbywrittenconsentcontainingaspecificreferencetothisAgreementsignedbytheOwner,Engineer,and any other person orentitysoughttobejoined.Consent to arbitration involving anadditionalpersonorentityshallnotconstituteconsenttoarbitrationofanyclaim,dispute or other matter in question notdescribedinthewrittenconsentorwithapersonorentitynot named or described therein. -1llA- The award rendered by the arbitrator or arbitrators shall be final,and judgement may be entered upon it in accordance with applicable law in any court having jurisdiction thereof. Section 19 -Nothing contained in this Agreement shall create a contractual relationship with or a cause of action in favor of a third party against either the Owner or Engineer. Section 20 --Unless otherwise provided in this Agreement,the Engineer and Engineer's consultants shall have no responsibilityforthediscovery,presence,handling,removal or disposal of or exposure of persons to hazardous materials in any form at the Project site,including but not limited to asbestos,asbestosproducts,polychlorinated biphenyl (PCB)or other toxic substance. Section 21 -The Engineer's Proposal for Design Services dated ,199_,and the Engineer's Proposal for Construction Management and Inspection Services dated ,199_,by mutual agreement,incorporated into and made a part of this contract. -11B- who will be in responsible charge of the Projectwarrantsthat NAME OF ENGINEER issued to bem by the State ofpossesseslicensenumber day of 19. 22 Section if.The attached Golden Valley Electric Association, Inc.(GVEA)Purchase Order Terms and Conditions are hereby,bymutualagreement,incorporated into and made a part of this contract.If conflicts exist between the Form 236 Contract and the Purchase Order Terms and Conditions,the Form 236 will govern. on the IN WITNESS WHEREOF,the parries bereto bave caused this Agreement to be duly executed. Golden Valley Electric Association OWNER By ATTEST:PRESIOENT SECRETARY ENGINEER By PRESIOENT,PARTNER® ATTEST: SECRETARY *Strike out inapplicable designation. REA FORM 236 (REV,672)12 GOLDEN VALLEY ELECTRIC ASSOCIATION,INC.(GVEA) Purchase Order-Terms and Conditions PRICEQUANTITIES:The price or prices and quantities stated on the face of this purchase order shail be firm and fixed except as sitered with written approval of GVEA's purchasing agent.The price stated shail inciude federal,state end local taxes unless otherwise expressly provided. ACCEPTANCE OF ORDER:This purchase order confirms a contract between the parties on the terms of this purchese order and eny other retevent document(s)aslistedonitsfece.By ecceotance of this purchase order and/or performance here- under,Seller agrees to comply fully with the terms end conditions of sale set forthonboththefrontandreversesidesofthisdocument,and any supplements hereto which are incorporated by @ reference herein.Acceptance of this purchase order must be made on its exact terms and if additional or different terms are proposed by the Seller,such response will constitute a counteroffer and no contract snailcomeintoexistencewithoutGVEA's written consent to the counteroffer.Seiler represents that al!goods supplied ere free end clear from ail claims and liens of any nature whatsoever.Nothing in this order or acceptance shail be construed to make Seller an employee or agent of GVEA.This purchase order together with any relevant documents or attachments to it constitutes the entire agreement between the parties.Any deviation from this agreement must be accepted in writing byGVEA. INSPECTION ANO ACCEPTANCE:Final inspection of goods and services shail be upon GVEA's premises uniess otherwise agreed in writing.Any acceptance ofgoodsissubjecttoinspwithinarbietimeafterreceipt.Payment of the invoice does not constitute insp nor of materiais covered by the order,and GVEA reserves the right to inspect the goods before payment.If, upon inspection,any goods are found to be unsatisfactory,defective,or of inferior quality of workmanship,or fail to meet the specifications furnished or the re- quirements stated in the purchase order,GVEA may return such goods to Seiler at the Seiler's sole risk and expense,inciuding the cost for handling and transport- ation,inspection,and any other charge connected with noncompliance of the purchase order. SHIPPING:All shipments and routing shail comply with the directions on the face of this purchase order or,in the absence of specific shipping instructions,goods shall be shipped FOB destination via the most economical means availabie.All transportation,shipping and forwarding charges must be prepaid unless other-wise indicated on the purchase order.GVEA reserves the right to refuse any and all shipments with collect charges.Seiler shail notify GVEA of shipments within sufficient time to permit GVEA to arrange for unioeding.and any claim for de- murrage resulting from Seller's failure to comply shail be paid by the Seiler.Seilershailbeartheriskoftimelydeliveryofshipmentsinroute.The risk of loss shail remain with the Seller until delivery of goods into GVEA's possession at desti- Nation,subject to Seiler responsibility for adequate packaging. WARRANTY:The Seiler warrants articles supplied on this purchase order to conform to specifications stated herein and to be fit and sufficient for the purpose manutactured,of good material and workmanship,and in the absence of otherapplicableexpressorimpliedwarrantyspecifying3longerperiod.free from defects for a minimum period of tweive (12)months from delivery to GVEA.This warranty shail survive any inspection,delivery or ptance of the goods or services,or payment therefore by GVEA.Seiler further warrants that Seiler shailcomplywiththerequirementsofallapplicablefederal,state and local jaws,ruies,ordir and reguleti such as,but not limited to OSHA,Mazerdous MateriaisTransporationAct,Toxic Substances Control Act and Consumer Product Safety CHANGES/CANCELLATION:GVEA may require pea to this Order at any timeandwrittenmodificationshallbemadeaswithceforincreasedcost,date of delivery,or other matters affected by the changes). GVEA may,at it's opti 1 any hi d merchandise previously ordered,subject to the obligation to pay for merchandise hipped prior to cancel .the purchese order covers merchandise manufactured or fabricated to specifications of GVEA,Seller shall discontinue ail performance on the subject matter,except 3s otherwise directed,immediatety upon receiving notice of such canceilation.In thewaneofsuchcancellation,end providing Seiler is not in default,GVEA snail pay toeller: e)=The cost incurred by Seiler in connection with this order prior to notice ofcancellation;or b)Such other costs,including canceiletion charges under subcontract,as GVEA may heve approved. The total cancellation payment,plus previous payments,shall not exceed the total price of this order.Upon such payment,et GVEA's option,title to any materiais or uncompleted merchandise shail pass to GVEA. REMEDIES/WAIVER:Time is of the essence of this order,and in the event that performance or delivery is not timely,GVEA reserves the right to cancel,purchase eisewhere,andor hoid Seller accountable for resuiting costs and damages in-curred.Seiler shail promptty notify GVEA of any event that threatens to delay performance or delivery. Any waiver by GVEA of any breach or default shail not be deemed continuing or applicable to other breach or detauit. 10, 11. 12. 13. 14, 18. 16. 17, THIRD PARTY CONTRACT/ASSIGNMENT:Neither this order nor any rights andobligetionsunderitsnailbeassignedorcontractedtothirdpartiesbySeilerwithoutthepriorwrittenconsentofGVEA.GVEA shail promotly be furnished with written notice and @ signed copy of any assignment.Any claim far payment by Assignees shail be subject to those defenses and set-offs which GVEA may have against Seiler.Seller shail insure that any third party contract andor assignment shail incorporate the provisions of thia order by specific reference hereto. INDEMNIFICATION:Seller shail indemnity GVEA for any ioss,claim,damages. liability,expense (including ressonabie attorney's fees)of any cause of actionwhatsoeverarisingoutofanyactoromissionoftheSeiler,its agents.employees orsubcontractors.Seller snali maintain such public liability,property damage.em- ployee liability and compensation insurance es to protect GVEA from any said risks and from any ciaims under any applicable workers'compensation and occu- pational disease acts. GVEA reserves the right to require that it be named as en additional insured on Seiler's insurance policies,that certificates of such insurance coverage be fur- nished upon request and that such additional insurance as it deems necessary be provided. The Seller agrees to defend,at its expense,GVEA and GVEA's employees,or any others using the product of GVEA,and hoid them harmiess,with respect to any and ail claims that the products or materials furnished by the Seller under this order infringe any United States end/or foreign patent,trademark,copyngnt andor other property right of third parties. BUY AMERICAN:Seiler shail adhere to the "Buy American”requirement of REA Bulletin 43-9.Any deviations from this requirement must be spproved in writing byGVEA's purchasing agent. LABOR AGREEMENTS:It is understood and agreed that the Seller shail abide byGVEA's project labor agreements if work st the jobsite is required in this order. SERVICES:Seiler and GVEA understand and agree that all "services”con- templated by this agreement and provided by Seiler to GVEA shail have the same complete and entire meaning as the word "goods”in application of the UniformCommercialCode.All warranties as provided for by application of the Uniform Commerciai Code,inctuding implied warranties of merchantabililty and fitness for@particularpurpose,shall apply to any and ail services provided by Seiler to GVEA 83 provided for in this agreement.Any and all other warranties,whether written or orai,statutory,express or implied,provided by Seiler to GVEA shail apply to the services specified in this Agreement. FEDERAL LAWS,ORDERS AND REGULATIONS:GVEA and ail subcontractors, vendors,end suppliers egree and certify that they shail comply with the re- quirement of all pertinent federal laws,orders and regulations including but natlimitedtoExecutiveOrder112461,a8 amended,and the requiations at 41 CFR 60-1through60-60,st 41 CFA 60-250 and 60-741 and Sections 38 USC 2012/503. CHOICE OF LAW:Any civil action arising from thia purchase order shail be broughtintheFourthJudicialDistrictfortheStateofAlaska.The laws of the State of Alaska shail govern the rights and the obligations of the parties under this purchase order. LOBBYING DISCLOSURE:Any contract or sud ect which ds $100.000 shail comply with Federal Law,which governs this contract,and requires that all contractors and any subcontractors comply with the following: No Federal appropriated funds have been paid or will be paid.by or on behalf of the undersigned,to any person for influencing or attempting to influence an officer oremployeeofanyagency,a Member of Congress,an officer or employee of Congress,or an employee of e Member of Congress in connection with theawardingofanyFederalcontract,the making of eny Federe!grant,the making ofanyFederalioan,the entering into of any cooperative agreement,and the exten-S10N,Continuation or renewal,amendment or modification of any Federai contract, grant,loan or cooperative egreement. Hf any funds other than Federal sppropristed funds have been paid orwill be paid toanypersonforinfluencingoranemptingtoinfluenceanofficeroremployeeofanyagency,a Member of Congress,sn officer or employes of Congress,or an em-ployee of a Member of Congress in connection with this Federal contract,grant,loan,or cooperative egreement,the undersigned shail complete and submit Stan-dard Form-LL,"Disclosure Form to Report Lobbying,”in accordance with its instructions. By acceptance of this contrect with GVEA,you sre certifying that you are incompliancewiththisfederalrequirement.if you are required to complete StandardForm-LLL,"Disclosure Form to Report Lobbying,”you must submit this form toGVEAatthetimethiscontractisenteredinto. WAIVER OF RIGHT TO FILE LIENS:Seller hereby agrees not to file any mechanics',laborers',or materiaimen's tien or other lien against any GVEA premises or any part thereof on eccount of any services or goods furnished under this order or anyadditionsoraddendatothisorder.Seller hereby waives the right to file any suchlien,and shail,if requested,execute a waiver of lien in recordabie form in favor of GVEA and the premises.Seller shail insure that any third party contract andorassignmentshailincorporatetheprovisionsofthispurchaseorderbyspecificreferencetothesetermsandconditions. SEVERABILITY:The invalidityin wholeor in pert of any condition of this purchaseordershallnoteffectthevalidityoftheotherconditions.The remedies reserved in these terms and conditions shail be lative and additional to any remedies in law oF equity. -2=-- HF138WBS.XLS General Engineering Cost Breakdown by Design Task and Links Project:Healy to Fairbanks 230 kV Intertie Task #Link # 1.0 PROJECT ADMINISTRATION 1-4-5 MH $ 2-3 MH $ 2.0 DATA REVIEW 1-4-5 MH $ 2-3 MH $ 3.0 DESIGN CRITERIA 1-4-5 MH $ 2-3 MH $ 4.0 DESIGN MANUAL 1-4-5 MH $ 2-3 MH $ 5.0 SOILS INVESTIGATION 1-4-5 MH $ 2-3 MH $ 6.0 SURVEY /LINE ROUTING 1-4-5 MH $ 2-3 MH $ 7.0 CONSTRUCTION DETAILS 1-4-5 MH $ 2-3 MH $ 8.0 STRUCTURE SPOTTING 1-4-5 MH $ 2-3 MH $ 9.0 CONSTRUCTION SPECIFICATIONS 1-4-5 MH $ 2-3 MH $ 10.0 MATERIAL SPECIFICATIONS /LIST 1-4-5 MH $ 2-3 MH $ 11.0 BID OOCUMENTS 1-4-5 MH $ 2-3 MH $ 12.0 ENGINEERING DURING CONSTRUCTION 1-4-5 MH $ 2-3 MH $ 13.0 RECORD DRAWINGS /CLOSEOUT 1-4-5 MH $ 2-3 MH $ Page 1 HF 138WBS.XLS General Engineering Cost Breakdown by Design Task and Links Project:Healy to Fairbanks 230 kV Intertie Task #Link # 14.0 BID EVALUATION 1-4-5 MH $ 2-3 MH $ 15.0 PROJECT/CONSTRUCTION MANAGEMENT 1-4-5 MH $ 2-3 MH $ 16.0 CONSTRUCTION INSPECTION 1-4-5 MH $ 2-3 MH $ 0.0 EXPENSES 1-4-5 $ 2-3 $ TOTAL LABOR AND EXPENSES CONTINGENCY 10.00% GRAND TOTAL N.T.E. Page 2 HF138WBS.XLS General Engineering Responsibility Chart Project:Healy to Fairbanks 230 kV Intertie X =Primary Responsibility x =Minor Support RESPONSIBILITY Task #GVEA |ENGR|OTHERS 1.0 PROJECT ADMINISTRATION 1.1 Project initiation meeting X X 1.2 Monthly Progress Reports ,X 1.3 Project Administration xX 2.0 DATA REVIEW 2.1 Area Maps X 2.2 Determine right-of-way and structure type requirements X 2.3.Local,State and Federal agency Coordination X X 2.4 Line Routing and P!selection Xx X 2.5 Field review line routing Xx 2.6 Final Route Map x x X 2.7 Cost Estimate Verification x X 3.0 DESIGN CRITERIA 3.1 Review existing Design Criteria X X 3.2 Conductor and shield wire selection X 3.3 Conductor and shield wire design tension and damper req.X 3.4 Structure Designs X 3.5 Clearance Requirements X 3.6 Guy and Anchor criteria X 3.7 Distribution Requirements X 4.0 DESIGN MANUAL 4.1 Basis Design Document X 42 Provide Staking Sheets /map for existing Distribution X 4.3 Distribution Design X 4.4 Design Data Summary (REA Form 265)X 4.5 Obtain REA approval of basic design document X X 5.0 SOILS INVESTIGATION 5.1 Geotechnic drilling x X 5.2 Geotechnic analysis X 5.3 Foundation /Embedment Design xX 5.4 Ground Resistance Measurements Xx 6.0 SURVEY /LINE ROUTING 6.1 Field survey -specifications and contract admin.xX 6.2 Obtain field survey info.and perform structure staking X 6.3 Assist surveyor during structure staking X x Page 4 HF 138WBS.XLS General Engineering Responsibility Chart Project:Healy to Fairbanks 230 kV Intertie X =Primary Responsibility x =Minor Support RESPONSIBILITY Task #GVEA |ENGR]OTHERS 7.0 CONSTRUCTION DETAILS 7.1 Prepare distribution staking sheets for new facilities x 7.2 Structure data sheets X 7.3 Structure staking sheets and drawings X 7.4 Prepare structure drawings X 7.5 Prepare assembly drawings X 8.0 STRUCTURE SPOTTING 8.1 Spot structures on plan and profile X 8.2 Structure Height templates Xx 8.3 Sag templates-conductor and shield wire X 9.0 CONSTRUCTION SPECIFICATIONS 9.1 Prepare stringing sag charts xX 9.2 Prepare engineer's estimate for construction X 10.0 MATERIAL SPECIFICATIONS /LIST 10.1 Material inquiries X 10.2.Preliminary bill of materials X 10.3 Final bill of materials X 10.4 Prepare Material Bid Specifications X 10.5 Obtain bids for materials X 10.6 Issue purchase orders for line materials X 10.7 Expedite,inspect,and receive materials xX 11.0 BID DOCUMENTS 11.1.Prepare construction contract packet -REA form 830 xX 11.2 Issue construction contract for review xX 11.3.Review design and construction contract packet X 11.4 -Solicit construction bids.X 11.5 Prebid Conference X 12.0 ENGINEERING DURING CONSTRUCTION 12.1.Provide engineering assistance during construction X 13.0 -RECORD DRAWINGS /CLOSEOUT 13.1.Perform as-built revisions Xx 13.2 Complete REA Closeout Documents -Form 254,etc.X Page 5 HF138WBS.XLS General Engineering Responsibility Chart Project:Healy to Fairbanks 230 kV Intertie X =Primary Responsibility x =Minor Support RESPONSIBILITY Task #GVEA |ENGR]OTHERS 14.0 BID EVALUATION 14.1.Conduct bid opening X 142 Evaluate construction bids X 14.3.Notice to Proceed X 14.4 Preconstruction Conference X X 15.0 PROJECT/CONSTRUCTION MANAGEMENT 15.1.Construction contract administration X 15.2 Conduct initial mtg with std.info exchange x 15.3 Conduct partnering mtg.with Contractor/GVEA X xX xX 15.4 |Review Contractor construction schedule x x Xx 15.5 Work with inspector for production and field decisions X 15.6 Review and recommendation for partial payments X 15.7.Maintain records of completed units/scheduled wk x 15.8 Develop and present Change Orders to GVEA xX 15.9 Interpret contract for Contractor x 15.10 Maintain log of contract discussions and changes X 15.11.Assist GVEA with Agency Coordination X 15.12 Backup inspector as needed X 15.13 Conduct Finai Inspection xX 15.14 Perform as-built revisions X 16.0 CONSTRUCTION INSPECTION 16.1.Daily on-site inspection of construction activities Xx 16.2 Provide daily inspection reports X 16.3.Conduct regular meeting with contractor X 16.4 Work w/CM to select best options for field conditions X 16.5 Develop data for change orders xX 16.6 Assist GVEA with material record keeping X x 16.7 Review and approve wire stringing procedures x 16.8 Maintain a log of contractor discussions /changes X 16.9 Maintain independent reports of testing activities X 16.10 Assist GVEA with agency coordination X x 16.11.Prepare corrective punch list X 16.12 Conduct final inspection xX 16.13 Maintain as-built drawing set Xx 16.14 Preparation of close-out documents/drawings x X Page 6 Project:Healy toF airbanks 230 KV Intertie HF 138WBS.XLS Man-hour Breakdown per Resource /Task Unit$$$$$$$ Project Project Manager Engineer Engineer AutoCAD Clerical Staff CM Inspector TOTAL COSTS || PROJECT ADMINISTRATION 1-4-5 2-3 AADATA REVIEW 1-4-5 2-3 DESIGN CRITERIA 1-4-5 2-3 DESIGN MANUAL 1-4-5 2-3 SOILS INVESTIGATION 1-4-5 2-3 SURVEY/LINE ROUTING 1-4-5 2-3 CONSTRUCTION DETAILS 1-4-5 2-3 STRUCTURE SPOTTING 1-4-5 2-3 CONSTRUCTION SPECIFICATIONS 1-4-5 2-3 MATERIAL SPECIFICATIONS /LIST 1-4-5 2-3 BID DOCUMENTS 1-4-5 2-3 A'SENGINEERING DURING CONST RUCTION 1-4-5 2-3 RECORD DRAWINGS /CLOSEOUT 1-4-5 2-3 AHAPage 7 HF138WBS.XLS Project:Healy to Fairbanks 230 kV Intertie Man-hour Breakdown per Resource /Task [|Unit$$$$$$$$TOTAL Project Project Engineer AutoCAD Clerical CM Inspector COSTS Manager Engineer Staff | BID EVALUATION 1-4-5 $ 2-3 |$ PROJECT/CONSTRUCTION MANAGEMENT 1-4-5 |$ 2-3 |$ CONSTRUCTION INSPECTION 1-4-5 $ 2-3 :$ SUM |];]$ Total MH=> Page 8 BV GOLDEN VALLEY ELECTRIC ASSOCIATION INC.Box 71249,Fairbanks,Alaska 99707-1249,Phone 907-452-1151 January 17,1994 Mike Kelly Intertie Participant's Group State of Alaska Alaska Industrial Development and Export Authority 480 West Tudor Anchorage AK 99503-6690 Recommendation of Transmission Line Engineering Design Proposals HEALY TQ FAIRBANKS TRANSMISSION INTERTIE Dear Mike: Golden Valley Electric Association,Inc.Engineering Department requested proposals for the supply of transmission line design services from seven consultants.We have completed evaluation of the submitted proposals and would like to offer a recommendation for acceptance of the Dryden &LaRue,Inc./Power Engineers(D&L/Power)proposal. The attached evaluation form was created for the four proposals received to allow for a fair comparison based on experience, ability to perform,man-hour effort,and price.Of all the proposals,Dryden &LaRue was felt to provide the best value,local experience,and realistic view of the tasks to be performed. The participation of Power Engineers provides additional depth of experience in both design and construction management which will help provide a high quality,cost effective transmission line. The selection of D&L/Power was primarily based on the team's superior value demonstrated by their extensive arctic experience in design and construction management of successful projects,local Alaskan design team with the ability to provide timely services, and price.The following shows the ranking for design and construction management based on price alone: Proposer Design CM/Inspection Total Commonwealth 3 1 1 D&L/Power 2 2 2 R.W.Beck.1 4 3 Stone &Webster 4 3 4 GOLDEN VALLEY ELECTRIC ASSOCIATION INC. Mike Kelly January 17,1994 Page 2 , Healy to Fairbanks Transmission Intertie Engineering Design Proposals The Commonwealth proposal indicated one on-site engineer for 12 months with 18 months of construction and limited the number of X- tower types to four;light and heavy tangent,light angle,and heavy angle.It is felt that the Commonwealth proposal is deficient in the construction management approach,and even though there is a not-to-exceed (NTE)value in the proposal,cost increases will be attempted to cover these deficiencies. Would you please review the evaluation forms.The Dryden &LaRue/ Power Engineers proposal is attached for your review.If you need additional information or would like to review any other proposals, please call me at (907)451-5647.The design firms are anxiously awaiting announcement of our selection and notice to proceed to allow for commencement of work. Sincerely, G72 Steven Haagenson,P.E. Manager of Engineering Services SH:mmf Enclosures HF138D1E.XLS 8-Jan-94 Transmission Line Proposal Evaluation Healy to Fairbanks 230 Kv Intertie Transmission line General Engineering Total Total Proposers General Local Schedule/Staftfing Man-hours Projected Cost Line Design Comments Experience Experience (ability to start to per proposal Optimization of Firm By the Proposed soon and maintain Complete including 10 % Team schedule)Project Contingency i]X- Commanweaith &structure types and Assoc.Inc good some good 8,684 Des $606,198.00 yes engr assistance for 12 months Anch-Fbks Intertie 7,656 CM $420,404.00 CADD format Fritz Ck to Soldotna 10%$102,660.20 TLCADD Snettisham 16.340 NTE $1,129,262.20 Dryden &excellent Stresses coord.w/g20tech LaRue /good GHS to Gold Mine excellent 7,444 Des $584,822.00 yes P&P in Intergraph format Power Engrs.Bradley Lake 8,344 CM $632,644.00 5 construction coniracts experienced in 10%$121,746.60 TLCADD full range of towers Alaskan soils partnering approach 15,788 NTE $1,339,212.60 Local Alaskan Labor R.W.Beck Electronic mail to GVEA and Assoc.Inc good good excellent 5,925 Des $423,513.00 yes AutoCAD 12 format Goldhill to FWS 13,040 CM $996,833.00 Partnering Approach Tyee Lake 10%$142,034.60 ?Timeline global 4 contracts 18.965 NTE $1,562,380.60 optimization Stone and Webster Design Alaska -Foundations Engineering Corp.good some good 9,974 Des $884,647.00 yes Total Quality Management Univ -Quartz 12,452 CM $699,554.00 AutoCAD format Bradley Lake 10%$158,420.10 TLCADD south central 22,426 NTE $1,742,621.10 Page 1 HF138D1E.XLS 8-Jan-94 Transmission Line Proposal Evaluation Healy to Fairbanks 230 Kv Intertie Transmission line General Engineering 1.00 2.00 3.00 4.00 5.00 6.00 7.00 8.00 9.00 10.00 11.00 12.00 13.00 14.00 0.00 DESIGN Project Data Design Design Soils Survey Constr.Struct.Constr.Matl Bid Constr.Close Bid Expenses Man Costs per Admin |Review |Criteria |Manual |Invest.|Line |Details |Spot.|Specs |Specs |Docs.|Engr |out |Eval.|Hours Proposal Commonwealth Link 1-4-5 321 75 335 36 163 90 630 466 178 245 50 805 59 21 3474 and Assoc.Inc MHs &Costs $17,604 34,582 $16,583 $2,419 $8,655 $4,043 $29,536 $20,168 $9,193 $12,816 $2,442 $64,569 $3,303 $1,574 $44,990 $242,477.00 Link 2-3 481 113 503 54 245 134 946 700 266 367 74 1,207 89 31 5210 MHs &Costs $26,407 $6,874 $24,874 $3,629 $12,983 $6,065 $44,304 $30,252 $13,789 $19,225 $3,663 $96,854 $4,955 $2,362 $67,485 $363,721.00 8,684 $606,198.00 Dryden &Link 1-4-5 456 198 506 225 143 53 319.542 321 282 61 212 517 80 3915 LaRue /MHs &Costs $39,947 $17,403 $37,091 $16,200 $11,485 $4,435 $22,162 $32,253 $26,022 $19,881 $4,456 $18,691 $34,672 $6,841 $14,573 $306,112.00 Power Engrs. Link 2-3 582 54 168 75 183 67 405 688 107 94 79 268 659 100 3529 MHs &Costs $50,841 $4,601 $12,364 $5,400 $14,617 $5,645 $28,206 $40,993 $8,674 $6,627 $5,672 $23,688 $44,128 $8,707 $18,547 $278,710.00 ;7.444 $584,822.00 R.W.Beck Link 1-4-5 207 109 74 231 77 23 618 370 46 152 152 105 373 58 2595 and Assoc.Inc MHs &Costs $16,536 $8,621 $4,799 $15,167 $5,167 $1,639 $32,137 $19,355 $3,119 $8,394 $9,293 $8,685 $15,670 $4,711 $32,127 $185,420.00 Link 2-3 265 139 96 297 99 29 793 474 58 196 196 135 479 74 3330 MHs &Costs $21,234 $11,070 $6,162 $19,475 $6,635 $2,105 $41,266 $24,853 $4,005 $10,779 $11,933 $11,152 $20,121 $6,050 $41,253 $238,093.00 §,925 $423,513.00 Stone and Webster Link 1-4-5 647 265 880 226 1157 132 468 888 252 355 194 176 72 53 5765 Engineering Corp.MHs &Costs $48,238 $20,227 $53,599 $16,234 $79,029 $10,931 $26,185 $51,400 $17,410 $22,632 $13,487 $14,154 $4,272 $4,195 $124,958 $506,951.00 Link 2-3 497 335 455 210 69 44 514 1,104 205 344 128 188 72 44 4209 MHs &Costs $33,306 $25,480 $27,418 $14,382 $5,405 $3,431 $29,772 $63,468 $13,157 $21,194 $8,509 $15,111 $4,272 $3,395 $109,396 $377,696.00 9,974 $884,647.00 Page 2 HF138D1E.XLS 8-Jan-94 Healy to Fairbanks 230 Kv Intertie Transmission line General Enc Proposers 15.00 16.00 0.00 PM/CM/Inspection PM/CM Inspect Expenses Man Costs per Hours Proposal pcommonweaith 1363 1699 3062 and Assoc.Inc $59,970 $57,167 $51,024 $168,161.00 2,045 2,549 4,594 $89,956 $85,751 $76,536 $252,243.00 7,656 $420,404.00 Dryden &1232 2329 3561 LaRue /$107,184 $122,813 $42,625 $272,622.00 Power Engrs. 1,568 3,215.4,783 $136,416 $169,355 $54,251 $360,022.00 8,344 $632,644.00 R.W.Beck 3082 2627 5709 and Assoc.Inc $138,603 $138,282 $159,539 $436,424.00 3,958 3,373 7,331 $177,979 $177,567 $204,863 $560,409.00 13,040 $996,833.00 Stone and Webster 777 4990 )5767 Engineering Corp.$43,632 $280,338 $0 $323,970.00 975 5,710 0 6,685 $54,796 $320,788 $O $375,584.00 12,452 $699,554.00 Page 3 IDRYDEN é LalRvue,IINc.CONSULTING /ENGINEERS 6436 Homer Orive.Anchorage.AK 99518 Mailing Address.P.O.BOX 111008,ANCHORAGE,AK 99511-1008 (907)349-6653 e FAX 522-2534 January 5,1994 Mr.Steve Haagenson, Manager of Engineering Services GOLDEN VALLEY ELECTRIC,INC. P.O.Box 71249 Fairbanks,Alaska 99707 Reference:Request for Proposal -Healy to Fairbanks 230 kV Intertie We at Dryden &LaRue,Inc.(D&L)together with POWER Engineers,Inc.are pleased to respond to GVEA's Request for Proposal for design of the Healy to Fairbanks 230 kV Intertie.D&L and Power each have the capabilities to provide the design effort required by your proposal.The combined capabilities of our two firms,however,form a truly unequal- ed pool of technical talent for your project.This is the largest transmission project in Alas- ka in many years and we are anxious to demonstrate our combined proficiency.Dryden & LaRue will be the prime design firm,POWER will be a subcontractor to D&L. 'The D&L staff have designed Transmission lines for several Co-Ops throughout the state. POWER is a large design organization with many miles of transmission line design and the capacity to backup and support D&L in all aspects of the design effort.For this project, POWER will specifically be responsible for the tower spotting,preparation of Plan &Pro- file sheets,and providing the inspection services.D&L will perform all the other duties with support from POWER as needed. The majority of the work will be performed in Anchorage at D&L's office.The tower spotting could be performed in Anchorage or Idaho.We believe it is more beneficial to do the work in Idaho because it will provide access to all of POWER's capabilities. Our present work load at D&L does not include any long term projects.Several of our staff will be available by mid January and the Project Engineer will be full time committed - to this project.Our proposal cost is based on the assumption that our design effort can proceed per our schedule.If there are significant changes to the schedule we may need to discuss the impacts. The following pages provide:a brief statement of qualification,description of the selected project team and experience,our work plan,schedule,cost proposal and resumes.Supple- mental information includes some samples of our proposed work. Electric Power:Transmission,Distribution,Substations,Control Systems,Generation,System Studies GOLDEN VALLEY ELECTRIC,INC.January 5,1994 Mr.Steve Haagenson Page 2 We trust the information herein demonstrates our interest and capability to complete your design effort in a timely and cost effective manner.If you have any questions or desire additional information,please contact me at 349-6653. DRYDEN &LaRUE,INC.MeghLooDelbertS.LaRue,P.E. DSL:jf\wrk4.pro REQUEST FOR PROPOSAL HEALY TO FAIRBANKS 230 kV INTERTIE Prepared for: GOLDEN VALLEY ELECTRIC,INC. P.O.Box 71249 Fairbanks,Alaska 99707 Prepared by: DRYDEN &LaRUE,INC. P.O.Box 111008 Anchorage,Alaska 99511 January 5,1994 TABLE OF CONTENTS A.Statement of Qualifications ......0...0.ccc eee eee B.Project Team 6.eeeeeeeeeeeene C.Work Plan 2...ce ee ee eeeeeeteens D.Schedule 2...cee ee ee ee eee ee eee eens E.Cost Proposal ..........cee cee ee ee eee eee eee eee eee F.Resumes oeeeeeeeeeeeeeeeeeeteeee Supplemental Information Attachment A -Spotting and Plan &Profile Specification Sample Transmission Design Report Two Samples of Plan &Profile 32 40 A,STATEMENT OF QUALIFICATIONS We are confident the D&L/POWER team can efficiently perform all the design and construc- tion management requirements for your project.As an introduction,the following few pages give a brief description of each company's qualifications. DRYDEN &LaRUE,INC. Professional Consulting Engineers Founded in 1977,D&L has been providing total project services to Alaskan utilities,in the discipline of electrical engineering for more than 16 years.These services range from initial system planning and studies,evaluation,engineering and design,to on-site inspection,construc- tion supervision,expert witness testimony,and construction/project management. The principal business goal of D&L is to provide a team of professional engineers that can re- spond to the needs of Alaskan utilities with competence,quality,and efficiency.We consider our principle assets to be:the good will of past and present clients;the high quality of our services;and most importantly,the integrity and ability of our people. Our organization can adjust to a wide range of projects and duties.We can perform complete project management and engineering responsibilities--or adapt to almost any other arrangement required by the client. We serve a variety of clients including federal and state agencies,local municipalities,private and publicly-owned electrical utilities,construction contractors,and other energy related industries. The professional staff at Dryden &LaRue has been providing innovative solutions to engineer- ing,design,and construction problems throughout Alaska.One of our staff members devel- oped the first tubular steel X-frame towers used in the construction of high voltage transmis- sion lines in Alaska.Another staff member designed a low cost Single Wire Ground Return transmission system,which can be constructed for about one-half the cost of a conventional transmission system.Other staff members have developed low cost transmission tower tripod footings suitable for helicopter construction,avalanche resistant transmission structures,and a shear release device which severs when a predetermined loading is exceeded on a transmis- sion conductor. Transmission/Distribution Systems Design Dryden &LaRue has extensive experience in designing transmission,distribution,and substa- tion facilities within Alaska.Over the last 16 years,D&L has.designed numerous substations and over 500 miles of transmission and distribution facilities for Alaskan utilities. -l- We have often been called on to solve unusual transmission system problems such as heavy snow and ice loading and unequal conductor loadings.We have participated in the develop- ment of new and unique designs for transmission lines which pass through known avalanche zones.D&L is recognized as the prominent Alaskan specialist in avalanche damage mitigation. We have recently completed the design for two state-of-the-art Static-Var Compensation Substations.The unusually high magnetic fields and 1000 amp buswork required an innovative design approach. Typical T&D design services offered include: Transmission ¢design manual preparation *route selection *right-of-way acquisition/coordination *meteorological investigation *structure design *geotechnical investigations ¢foundation design *conductor and structure selection studies *oil containment ¢hardware selection *material specifications *construction documents *CADD drawings Distribution *brief environmental reports ¢design manual ¢highway relocation *right-of-way acquisition coordination *structure design *UG cable selection and design *conductor and structure selection studies *hardware selection *material specifications *construction documents *CADD drawings Substation *site selection *structure selection/design ¢foundation selection/design *ground grid design and testing *open-bus and metal-clad design ¢relay,metering &control *switchgear selection *motor control center design *hardware selection *material specifications *construction documents *checkout and testing *operation manual preparation Construction/Project Management D&L has a team of experts to plan,review and manage every aspect of your project.Each project is organized and carried out under the leadership of one of our experienced project managers.The project manager is the official D&L representative in dealing with the client and,as leader of the project team,is responsible for cost,schedule and performance.Effective project management is achieved by providing the project manager with timely and accurate information,along with experience and judgement,enables our project manager to make prudent decisions.Construction/project management services offered include: *contract administration ¢bid document preparation &evaluation ¢document control &retrieval *progress and cost control *review environmental concerns *work order inspection *on-site inspection *quality control *closeout documentation *as-builts drawings Application Manuals *transmission &distribution *substations *meteorological criteria *overhead line loading limits ¢CADD specifications Support Staff A multitude of functions are performed by D&L's capable and efficient support staff.They prepare and assemble the many specifications,plans,reports,studies,evaluations and other documents generated by our professional staff.D&L employs skilled draftpersons who pro- duce detailed CADD drawings for complicated electrical,mechanical and civil designs. POWER ENGINEERS,INC. Professional Consulting Engineers POWER provides a full range of design engineering services to utility customers for both wood-pole and steel-structure facilities.Having been involved in more than 4,000 miles of transmission lines,POWER is experienced in all phases of transmission projects including preliminary engineering,studies and economic analyses,land acquisition,detailed design, preparation of design documents,and construction management through 500 kV.Project settings have varied from the barren deserts of the Southwest to the rugged mountains of the central Rockies and varied topography and climates of Alaska,Hawaii and Vermont. Transmission engineering personnel regularly attend technical seminars and short courses on transmission design in order to keep abreast of the latest developments in the field.This continual training assures our clients technically advanced design and innovative engineering techniques.Because so many of POWER's transmission projects have been built in environ- mentally sensitive areas,our engineers and designers are experts in aesthetic structure design and in incorporating mitigation measures to ease impacts on land,visual and wildlife resources. POWER maintains an extensive library of computer software specifically designed to assist our engineers in the design and optimization of transmission lines.One such program,which is proposed for this project,is the Bates TLCADD and TLDesign Structure Spotting System. This package is designed to aid transmission engineers and designers in determining the optimal location,height,and type of transmission line tower/poles along a given route.The program is well suited for optimizing transmission lines from 69 kV to 765 kV.Included are functions for optimizing conductor and tower family selections as well.Whenever practical, POWER strives to use this package.Our engineers and clients have found that it is significant- ly superior to manual methods of line spotting. POWER is recognized as a leader in design of major transmission lines around the country. As evidence of this national recognition,POWER was recently selected as the design firm for two major 345 kV transmission lines in Nebraska and Indiana.This is but the latest example of how POWER's reputation for responsive and quality engineering services is valued by our clients. B.PROJECT TEAM The project team is composed of selected professionals from Dryden &LaRue and POWER with the necessary talents and time available to produce an efficient design.The team mem- bers presented here are all licensed professional engineers with specific transmission line design experience. Dryden &LaRue will be responsible for the complete project.Power will provide structure spotting,preparation of plan and profile sheets and inspection services under the direction of the D&L.All other design work will be directly by D&L.Delbert LaRue will be the project manager.Al Peabody will review work for quality control,his proficiency in design of other Alaskan projects has established a solid reputation.Ken Dyson will be the local project engineer and will work with Ron Carrington the co-project engineer from POWER.We propose to use both the Anchorage and Hailey offices to take full advantage of the various personnel available for the project.Ron Carrington will be part of the project initiation in Alaska.He will work with Ken Dyson on Task 2 (Data Review).The remainder of the project will be conducted in both offices as appropriate for productivity. POWER proposes Ron Carrington as co-project engineer,and the lead for structure spotting and plan and profile drawing effort.Gary Kunick and Dave Boutelle are proposed to perform the engineering/designer work associated with TLCADD.Plan and profile drawing will be performed by our Intergraph technicians headed up by Scott Thurber and Joe Knight.Check- ing the plan and profile drawings will be conducted by Gary Kunick and Dave Boutelle.John McGrew will provide management direction.Clerical and administrative staff will be utilized as required. The following list identifies individual team members by firm and major responsibility.A resume for each individual is included in Section F. Principal Consultant Dryden &LaRue -Anchorage,Alaska Del LaRue -Project Manager Ken Dyson -Project Engineer Al Peabody -Quality Control Jack Anderson -Design Engineer Dan Bishop -Staff Engineer Subcontract Consultant POWER Engineers,Inc.-Anchorage,Alaska &Hailey,Idaho Ron Carrington -Project Engineer John McGrew -Management TEAM EXPERIENCE Cold Weather Experience This section describes our team experience by first listing Cold Weather Projects and then presenting details of selected recent projects similar to the Healy/Fairbanks Line. Dryden &LaRue's proposed project personnel have been designing transmission lines in Alaska since 1970.Many of these lines are located in cold climate regions.Our experience includes interior Alaska as well as the North Slope and encompasses the last 20 years. POWER's personnel are experienced in the design of transmission lines in cold climates and difficult terrain and soil conditions.Much of POWER's experience in cold weather design is a result of extensive experience in designing transmission lines in mountainous terrain. Transmission lines designed in the high reaches of the rocky mountains often have similar temperature design criteria as that used in the interior of Alaska.The difficulty of designing for extreme temperatures is compounded in mountains by the difficult terrain,severe ice,snow, and wind loading,and the occasional long spans required.POWER will bring this experience and commitment to the proposed project team. Cold Weather Line Project Location Anchorage/Fairbanks Intertie Willow to Healy,Alaska Johnson Rd/Delta Fairbanks,Alaska North Pole/Wainwright Fai.'inks,Alaska Bradley Lake Homer,Alaska Conoco Well Feeders Prudhoe Bay,Alaska Airport Supply Atqasuk,Alaska Distribution System Aqichak,Alaska Distribution System Napakiak,Alaska Distribution System Taylor,Alaska Walakpa Well Sites Point Barrow,Alaska Dry Creek/Tincup/Valley Eastern Idaho Lost River/Spar Canyon Central Idaho Thompson Creek Mine Central Idaho Recently Completed Projects Following are five recent projects selected from our joint experience to demonstrate our capa- bilities.References are included with each project to allow for verification of the experience. We are confident these clients will substantiate our commitment and technical expertise. Bradley Lake 115 kV Line (1) (2) (3) (4) (5) (6) Date of Completion: Description of Project: Project Construction Cost Engineering Costs Client Reference: Key members of this project that will be used for the Healy/Fairbanks work are: 1991 Determine feasibility and prepare design for two 19-mile 115 kV transmission lines from the Bradley Lake power- house to interconnect with Homer Electric.Project includ- ed development of feasibility,design criteria and assess- ment of alternative routings,tower types,and conductors. Cost estimates were developed for different overhead con- figurations and a section of submarine cable. $17,000,000 $1,100,000 David Eberle -Phone:(907)561-8050 Alaska Industrial Development and Export Authority Del LaRue -Project Manager and Design Engineer Al Peabody -Design Engineer Anchorage Fairbanks Intertie 345 kV (1) (2) (3) (4) (5) (6) Date of Completion: Description of Project: Project Construction Cost: Engineering Costs: Client Reference: Key members of this project that will be used for the Healy/Fairbanks work are: 1983 Performed overall project review on the 345 kV,175-mile transmission line to intertie the communities of Anchorage and Fairbanks.Dryden &LaRue's responsibility encom- passed all aspects of transmission lines including:agency contacts,public meetings,route selection,meteorological coordination,design criteria,and design. $90,000,000 $140,000 David Eberle -Phone:(907)561-8050 Alaska Industrial Development and Export Authority Del LaRue -Design Engineer and Alaska Liaison -7- Dry Creek-Tincup-Valley_161 kV Transmission Loop (1)Date of Completion: (2)Description of Project: (3)Project Construction Cost: (4)Engineering Costs: (5)Client Reference: (6)Key members of this project that will be used for the Healy/Fairbanks work are: 1983 POWER provided design engineering services for this 80- mile,161 kV transmission loop in western Wyoming and eastern Idaho.A variety of structure types were used to suit the different terrain and configuration requirements, including double-circuit tubular steel poles,single circuit wood poles,and cross braced H-frame structures.Approxi- mately 20 miles of the line was designed for 12.5 kV un- derbuild.A portion of the line passed through rugged, nearly inaccessible terrain necessitating careful routing and several canyon crossings including one 2,000-foot span. The variety of terrain crossed and the distribution under- build required the use of several different ruling spans.The line was designed for the notoriously severe winters in the area with recorded low temperatures of -65°F and average snow depth of 6 feet with drifts up to 20 feet high and several miles long. $3,600,000 $200,000 Les Bell (former Manager of Lower Valley Light &Power) San Diego Gas &Electric Phone:(619)696-2796 John McGrew -Construction Manager Dave Boutelle -Design Engineer New Denver Airport 230 kV Line (1)Date of Completion: (2)Description of Project: 1992 The Public Service Company of Colorado (PSCO)contract- ed POWER to design 33.5 miles of new double circuit 230 kV transmission line as part of the New Denver Airport project.POWER's services included geotechnical explora- tion,structure and foundation design,construction drawing and specification preparation,material procurement,and construction management.. -8- New Denver Airport 230 kV Line (2) (3) (4) (5) (6) Continued: Project Construction Cost: Engineering Costs: Client Reference: Key members of this project that will be used for the Healy/Fairbanks work are: Black Mountain 69 kV Line (1) (2) (3) (4) (5) (6) Date of Completion: Description of Project: Project Construction Cost: Engineering Costs: Client Reference: Key members of this project that will be used for the Healy/Fairbanks work are: POWER Also performed an economic and functional analy- sis of structure/conductor configuration to arrive at the opti- mum structure type. POWER made initial ground resistivity and electrical ef- fects measurements during the field investigation. POWER's design optimized conductor configuration,reduc- ing to a minimum the electrical and magnetic fields,radio and TV interference,and the audible noise.POWER used the specifically designed EPRI computer program ENVIRO for the electrical effects analysis.At the end of the con- struction phase,POWER conducted a final electrical effect survey. $8,500,000 $350,000 Arvin Michel -Phone:(303)571-7511 Ron Carrington -Project Engineer 1993 This project consisted of 11 miles of single-and double-cir- cuit 69 kV tubular steel pole transmission line.Responsible for routing,permitting support,estimating,design,line optimization,specifications,procurement,and construction management.This project required close coordination with the BLM and regional utilities for land use and crossing permits. $4,500,000 $300,000 Dave Malsbary -Phone (805)392-2615 Ron Carrington -Project Engineer -9. C.WORK PLAN Introduction This section contains Dryden &LaRue's (D&L)proposed Work Plan for designing the Healy to Fairbanks 230 kV transmission line.Dryden &LaRue will be the prime design firm, POWER will be a subcontractor to D&L.We will utilize the strengths of both companies to bring the appropriate expertise to the project.Our project approach is to expedite the designefforttofitthetightscheduleandminimizecost.To do this we will use standard designs from a previous successful projects when possible.We will use REA guidelines and not attempt to create an expensive,unique transmission line. The following Work Plan is composed of the 16 tasks described in the RFP.A brief descrip-tion of each task is followed by a listing of services included in the task and the deliverables. D&L is confident the following Work Plan is responsive to GVEA's requirements and demon- strates our understanding of the engineering design responsibility as outlined in the RFP. Task 1 -Project Administration This task will provide the normal project administration duties beginning with an Initiation Meeting in Fairbanks.It will provide GVEA with timely,and concise information regarding design completion schedule,cash flow and project status via monthly reports.Current status of the project will be available by contacting the Project Manager at any time. Services Included *Project Schedule ¢Cash Flow Requirements *.Status Reports Deliverables *Project Schedule*Cash Flow Schedule Y. ¢Monthly Status Reports Task 2 -Data Review This task will provide GVEA with engineering input to the line routing process.Based on area maps,agency concerns and other consultants we will jointly establish a proposed line routing. -10- This routing will be field reviewed by helicopter to discover any major engineering problems. The cost of two days helicopter rental is included for the field effort.We will participate in the development of the final route maps.Also included in this task is an update of our 1991 construction cost estimate prepared for AEA.This estimate was developed from individual bid units which can easily be revised and updated.It may be beneficial for GVEA to include some services from the geotechnical engineers as part of the routing.ae Services Included ¢Assist in line routing and PI selection Field review line routing Assist in preparation of Final Route Map ¢Update previous construction cost estimate Deliverables *Updated construction cost estimate Task 3 -Design Criteria This task will review design criteria previously utilized by GVEA,such as the criteria devel- oped by Stanley for the existing Healy Line,LEMCO for a previous 138 kV and our Fort Knox single pole wood transmission line.We will make an independent determination of which portions of the previous design criteria is applicable to the new 230 kV line.Recom- mended changes to the combined design criteria,based on our experience in Alaska,will be presented to GVEA for discussion and concurrence.A climatological investigation will not be conducted. Portions of the line are expected to be in marginal permafrost soils.It will be imperative that the geotechnical investigation include design parameters for the permafrost areas.We expect to work with GVEA in developing the proposal for the geotechnical. Final design criteria will include: Snow,ice,wind &temperature conditions. Ground Clearance. Overload Capacity Factors for high wind and heavy ice and snow conditions for application during conductor,structure,foundation,guy and anchor design. «Conductor Separations between conductors of same and different circuits for differen- tial ice &snow loading and galloping. Electrical Separation Guy and Anchor Loadings Also,this task will develop the family of structures for the line from tangent through deadend. The basic structure will be the guyed X-tower.We will use our in-house designs from similar X-tower lines to develop the structure details. -ll- The design requirements for the underbuild in Link 5 will be reviewed with GVEA and final- ized. We will develop criteria for river crossing foundations and structures. Services Included «Review existing Design Criteria from previous projects Obtain GVEA concurrence for Design Criteria ¢Develop family of structures Obtain GVEA concurrence for Distribution Design Criteria Deliverables ¢Review comments to existing design criteria ¢Final Transmission Design Criteria ¢Drawings of Tangent,Angle and Deadend Structures ¢Final Distribution Design Criteria Task 4 -Design Manual This task will prepare a Basic Design Manual which will serve as the guideline for designing the Healy/Fairbanks transmission line.The Manual will incorporate the Design Criteria devel- oped in Task 3.It is assumed a manual similar to the Fort Knox Line will be acceptable.This documentation will at least contain the following: Structure,anchoring and foundations sketches Supporting calculations--structures,anchors &guys. Lightning and Grounding performance Sag and tension data Structure &Foundation Application criteria Staking guidelines REA Form 265SeAee The Design Manual will compile the factors and calculations used to determine the final line configuration,and will document the selected structures,conductor and foundations used in the design.Typical information contained in the design manual includes: «Development and tabulation of structure application criteria to include tower height, maximum horizontal span,maximum vertical span and guying requirements in con- formance with applicable codes. «Design and specifications for guying and anchoring requirements by structure type and tabulation of guys and anchors by structure type. «Generation of staking guides to be used during construction staking. -12- «Specify conductor design points (temperature,wind,ice,snow)and determine the initial and final sag and tension at each design point.Generate sag and tension data required for structure spotting using conductor stress/strain data. ¢Determine the maximum allowable span for each structure type based upon an analy- sis of vertical clearance requirements,conductor blowout and galloping for conduc- tors of the same and different circuits. ¢Determine the final ruling spans for the conductor and generate stringing tables for appropriate temperature ranges. «Review and evaluate the OHGW performance of the present GVEA lines.Develop new OHGW system. ¢Indicate which loading condition controls for each design area and provide a summa- ry description of controlling data. Also included in this task is design of the distribution underbuild.The design will incorporate the Design Criteria developed in Task 3. The Basic Design Manual will be submitted to REA for approval. Services Included ¢Prepare Basic Design Manual ¢Design distribution underbuild ¢Submit to REA for approval Deliverables ¢Basic Design Manual ¢Distribution design ¢REA Form 265 ¢REA approval Task 5 -Soils Investigation This task will interface with GVEA in development of the scope of services for the geotechni- cal investigation.Particular attention will be given to the performance of existing foundations and the problems of marginal permafrost.Also,the geological investigation will include ground resistance measurements to allow for initial lightning protection design.Ground resistance testing is a typical activity for the geologist and can be collected during their field activities.It is anticipated that several grounding assembly units will be developed during the design process to allow the construction inspector final selection. We will utilize soils data provided by the geotechnical consultant to determine the design of foundations and anchors. -13- Services Included *Assist in geotechnical scope development *Develop designs for foundations and anchors ¢Develop designs for grounding Deliverables ¢Foundation design *Grounding design Task 6 -Survey/Line Routing This task will assist the surveyor during structure staking.Staking guides prepared in Task 4 will be used.We will support the staking effort with office and field expertise as needed.We will assist GVEA in identifying minor reroutes and additional ROW requirements that are necessary to accommodate the D&L prepared line design.This would include such items as additional easements for anchors,and minor reroutes required because certain tangent poles and line angles must be relocated. Services Included ¢Assist surveyor in structure staking Deliverables «None Task 7 -Construction Details This task will prepare the structure data and staking sheets.Also,we will prepare the neces- sary construction detail sheets consisting of;structure drawings,assembly drawing,foundation .drawings,guy and anchor drawings.The following list applies to the transmission line???,+i we will use standard REA units for the distribution design. @ Structure Data Sheets -A staking sheet type listing of the transmission units will be prepared to match the plan and profile's.These sheets may not be required if GVEA agrees to the unit listing on the plan and profile sheets. @ Staking Sheets -Standard staking sheets will be prepared for the new distribution facili- ties. ¢Structure Drawings -Drawings will be prepared for the following structure types and will include details for three phase and single phase underbuild where appropriate. -14- ¢Tangent Structure «Single Deadend «Light Running Angle ¢Tangent Double Deadend «Medium Running Angle «Angle Double Deadend o River Crossing Structures Structure drawings will show views necessary for clarity,material call-out,and applicable notes.Each drawing will include a material list with item numbers,quantities and descrip- tion. @ Assembly Drawings -Assembly drawing will contain assembly details not shown on the structure drawings.Typical assembly drawings will consist of the following.Assembly drawing may be placed on the structure drawing if space permits. rs Conductor Attachment ¢OHGW Attachments ¢Grounding Details ¢Miscellaneous Details Drawings will show details with necessary clarity,material callout,and applicable notes. Each drawing will include a material list with item numbers,quantities and description. ¢Foundation Drawings -Prepare foundation drawings uniquely identifying each foundation type.A typical cross section and plan view of each foundation type will be shown as appropriate.It is expected that the Tanana River crossing will require specific river foundation designs.We have recently completed an extensive study of the Chugach Electric -Susitna River crossing foundations and are very familiar with the appropriate designs. Drawings will show details with necessary clarity,material callout,and applicable notes. Each drawing will include a material list with item numbers,quantities and description. @ Guy and Anchor Drawings -Prepare typical guy arrangement drawing,guy and anchor assembly drawings for each type of guy and anchor assembly.Drawing will list guy assemblies,anchor assemblies,guy angle/configuration,guy slope and other pertinent considerations. Drawings will show details with necessary clarity,material callout,and applicable notes. Each drawing will include a material list with item numbers,quantities and description. Services Included *Preparation of structure and staking sheets ¢Preparation of construction drawings Deliverables ¢Structure Data Sheets ¢Distribution Staking Sheets ¢Structure Unit Drawings -15- ¢Assembly Drawings *Foundation Drawings ¢Guy and Anchor Drawings Task 8 -Structure Spotting This task will prepare the plan &profiles sheets and spot the structures.Included in this task is the following: Receive data from others for structure spotting including,digital centerline and side profile data,planimetric manuscripts,environmental and/or landowner stipulations and constraints, location of underground obstacles,and other data which may restrict structure locations. Review information provided by others relative to environmental and landowner stipula- tions,locations of highways,roads,driveways,creeks,rivers,railroads;communications and power line crossing data;and any other known data which may prohibit structures in a given location or require structures in a given location.We will determine estimates of added costs for locations with unusually high construction costs. Enter conductor sag-tension data,minimum clearances,structure application criteria and estimated installed structure costs into the TLCADD program.Enter digitized profile data into the terrain data file of the TLCADD program. Edit terrain data files to note locations where structures must be located,where structures cannot be located,and add extra location costs to those locations with unusually high construction costs. Determine successive structure locations,types and heights through use of the Bates TLCADD Release 5 structure spotting computer program,utilizing a global optimization process to arrive at the minimum cost structure selection which will meet structure applica- tion criteria,clearances,and structure location constraints. Generate a profile plot of the spotted line and check the profile against survey data. Spotting will be reviewed against the restriction imposed on structure locations and spot check clearances and structure application as a check against data entry error. It will be necessary to determine leg length differences before final material orders.There are several methods to obtain the ground profile information.We are proposing the Mapper will provide us with topographical data that can be used for initial leg lengths.Final leg lengths can be determined from surveying during the structure staking. A Transmission Design Report will be generated which includes structure number,structure type and height,structure height,station,elevation of point of support,span length,wind span, maximum weight span,minimum weight span,iced weight span,wind/weight span ratio: ground clearance,and cumulative estimated cost.The Design Report will be used to generate Structure Lists and staking sheets. -16- Drafted plan and profile drawings will be prepared at one inch equal to two hundred feet (1" =200')horizontal scale and one inch equal to ten feet (1"=10')vertical scale. The following information will be depicted on the plan view: ¢Structure Location ¢ Stationing ¢Structure Coordinates (Northing and Easting) The following information will be depicted on the profile view: ¢Left,Center &Right Ground Profile «Span Ahead ¢Conductor Sag ¢Structure Type ¢Structure Location ¢Structure Number ¢Structure Height ¢ Stationing ¢Foundation ¢Foundation Type ¢Ground line Elevation This task will require considerable information from others,the following assumptions have been made in the response to the RFP. Assumptions | ¢Input data for structure spotting to be developed by others,and provided to us in a format that can be downloaded into TLCADD-Revision 5.Requirements for providing input data for structure spotting and development of the plan and profile drawings is defined per Attachment A. @ Project is assumed to be 100.50 miles long.Link segment lengths are defined as follows: Link #Link Length (miles) 1 26.0 2 29.5 3 27.0 4 12.5 3 5.5 @ Data from Links 1,4,and 5 needs to be complete and in the format specified in this proposal prior to sending to us.Data for Links 2 and 3 needs to be complete and sent within two weeks of sending Links,1,4,and 5. @ We are assuming that any work performed as a result of changes to the centerline andotherreceiveddataaftertheoriginaldataisreceivedwillbeperformedperourFeeSched- ule -1994, -17- Services Included ¢Transmission Design Report *Structure spotting «Plan &Profile Sheets Deliverables *Transmission Design Reports -in TLCADD format (see Sample in Supplemental Informa- tion Section) ¢Plan and Profile Drawings -hard copy (maximum 3 sets),one set of mylars and in electronicmedia.Drawings will be in Intergraph format with standard POWER layering (See SampteDrawingNo.11-69 kV Transmission Line and Profile in Supplemental Information Section:, ¢Structure Height Template Task 9 -Construction Specifications This task will prepare the technical construction specifications which are to form a part of the contract document.We will incorporate general construction specifications which are assumed to be provided by GVEA.Also incorporate site-specific GVEA,agency,landowner and environmental requirements and stipulations that would effect the method or sequence of construction.Based on the RFP we expect five separate construction packages and that we will be able to repeat a significant amount from the first package.The construction specifications would typically include the following: «General Requirements ¢Hardware ¢Right-of-Way Clearing ¢Insulator ¢Revegetation ¢Conductor Stringing ¢Guys,Anchors,Anchor Rods ¢Grounding ¢Access Roads ¢Foundations ¢Overhead Crossings ¢Miscellaneous ¢Structures Also included in this task is the preparation of stringing tables for installation of the conductor and OHGW.Stringing tables will be based on the final structure spotting from Task 8. We will also produce an engineering level construction cost estimate. Services Included ¢Preparation of Construction Specifications ¢Preparation of Stringing Tables ¢Preparation of Construction Cost Estimate Deliverables ¢Construction Specifications -18- 4 awl *Stringing Tables *Cost Estimate Task 10 -Materials Specifications/List This task will prepare materials specifications for materials and hardware.We propose the material specifications will be developed as needed (see Section D,Task 10). As an example for the steel towers we will:specify fabrication methods,tolerances,hole sizes, hole position,material and other such requirements as may be required.Similar specification data will provided for other materials.Materials and hardware will be selected from the REA welistofapprovedmaterials,if listed,andinquires from manufacturers.geteu A preliminary bill of materials will be developed after Task 4.A review with GVEA will determine a schedule for development of final material specifications to facilitate early order of long lead items.Several of the items;e.g.conductor,can be specified early in the process with very little risk.As the design progresses it will be possible to develop specifications to bid other materials.We propose the final material specifications to be an on-going process throughout the design to expedite the delivery. Services Included *Prepare Preliminary Material Specifications *Develop a Schedule for Final Material Specifications ¢Prepare Final Material Bid Specifications Deliverables *Preliminary Material Specifications *Schedule for Final Material Specifications *Final Material Bid Specifications -Task 11 -Bid Documents This task will prepare the Construction Contract (REA Form 830)including Notice and Instruc- tion to Bidders,Contractor's Proposal Agreement,Schedule General Conditions,List of Owner Furnished Materials,and administrative particulars.Prepare bid unit description and quantities -for inclusion into contract document.We will insure a proper correspondence between Con- struction contract,construction specification and drawing. We will identify risks and assist GVEA in avoiding,balancing and shifting construction risks. We also expect to assist GVEA during the bidding process as requested.We will be prepared to discuss information necessary to prepare a responsive bid such as:project scope;design features;project schedule;material and equipment requirements;and landowner,agency and -19- 7 tk " environmental constraints/stipulations.We will assist GVEA in the issue of bid addenda as may .a be required during the bidding period.We assume that five (5)separate bid packages will need to be prepared for construction., Services Included ¢Prepare Construction Contract (REA Form 830) ¢Prepare Notice &Instruction to Bidders ¢Assist GVEA in the bidding process Deliverables *Construction Contract Form 830 ¢Notice and Instruction to Bidders Task 12 -Engineering During Construction This task will provide technical support to GVEA during construction.Travel to the project site is not included in this Task.We assume the onsite Construction Manager will request assistance if the questions cannot be answered locally.We assume one day per week during a 60-week construction period or 480 manhours. Services Included *Technical support during Construction Deliverables «None Task 13 -Record Drawings/Closeout This task will prepare the final close-out document and reconcile all construction payments and scope of final project.Based on the RFP we expect five separate construction packages.We will prepare and submit the required REA documents closing out the construction activities. Also,generate "Record Drawings"which incorporates all field and design changes made during construction.Furnish GVEA one set of mylar reproducibles. Services Included °Prepare appropriate Closeout Documents ¢Prepare Record Drawings based on field data supplied -20- Deliverables *Closeout Documents (REA Form 254,etc.) *Record Drawings Task 14 -Bid Evaluations This task will assist GVEA in conducting the preconstruction conferences with the contractors. We expect to respond to technical questions asked by Contractors at the Prebid Conference. We have assumed the line will require five construction bids. Also included in this task is Shop Drawing Review this is especially important for the tower manufacturing.Al Peabody has extensive experience in this work and will be responsible for this task. Services Included *Assist GVEA in conducting five (5)Preconstruction Conferences *Review shop drawings Deliverables *Engineering review of shop drawings Task 15 -Project/Construction Management This task will provide the project management and construction management (PM/CM)to assure the construction is completed in accordance with the specifications and to the satisfac- tion of GVEA.We expect to assign the D&L Project Engineer to the jobsite as the best qualified individual to oversee the implementation of his design.He will be supported by inspection personnel from POWER with extensive field experience. We expect to incorporate the "partnering"concept into this project.With the contractor, engineer and owner all working together to minimize conflicts this concept will be beneficial to all the parties involved.We will provide a facilitator to conduct the layout meeting.This meeting will establish the guidelines and process for implementation of the various aspects of problem solving. Along with conventional duties,the construction manager will also be responsible for directing the inspection activities and working with the contractor in maintaining record drawings. A typical PM/CM task is anticipated with at least the following duties: rs Construction contract administration rs Review Contractor construction schedule -21- Review and approve partial payments Maintain records of completed units/scheduled week Develop and present Change Orders to GVEA Interpret contract for Contractor Maintain log of contract discussions and changes Assist GVEA with Agency Coordination Conduct Final InspectionSeAaA The amount of CM/PM time is directly attributable to the contractor and his construction schedule.Since this is beyond our control,the following assumptions describe a minimum inspection effort.We expect to discuss the actual requirements closer to the time of construc- tion. Schedule @ Schedule of construction for Links 1,2,3,4,and 5 will be per the project schedule in- cluded in the RFP. @ We are assuming the CM/PM will be required for a total of 350 days to construct Links 1,2,3,4,and 5. Budget @ We have assumed 350 days at the job site with a $100/day allowance for living expenses. Services Included ¢All typical PM/CM duties associated with overseeing the construction activities Deliverables *Minutes of Start-up Meeting and all subsequent meetings *Log of Partnering decisions and discussions ¢Maintain a file of up to date material information ¢Maintain a current construction schedule ¢Conduct monthly construction meetings *Recommended partial payments ¢Maintain records of completed units *Produce change orders for GVEA approval «Report of final inspection ¢Maintain record drawings *Agency coordination Task 16 -Construction Inspection GVEA will be provided with resumes of potential inspectors for approval.This task will perform daily on-site inspection of construction activities including: -22- «Observe the handling and installation of conductors from delivery through final clearance for energization.Include tension stringing procedures,sagging,clipping, splicing,and protection of the conductor during installation. ¢Ensure that the Construction Contractor incorporates all changes made during con- struction on a set of working drawings.Do not recommend release of the Contrac- tor's retention until the completed marked-up documents are received from the Con- tractor.Coordinate with GVEA completion of the close-out drawings. ¢Perform a comprehensive final inspection.Review past inspection reports to ensure that all previously identified deficiencies have been remedied.Perform a final in- spection to review the entire project.Do not authorize the Construction Contractor to proceed with energization until all deficiencies have been corrected. ¢Conduct ground resistance tests at each tower site and select the appropriate ground- ing unit. ¢Assist GVEA with project close-out documents. The following assumptions are made for this proposal. Schedule @ Schedule of construction for Links 1,2,3,4,and 5 will be per the project schedule in- cluded in the RFP. @ We are assuming that Links 1,4,and 5 will start construction in June,1995 and continue though January,1996 as scheduled in the RFP.One inspector is assumed for Link 1 for a construction window of one hundred fifty six (156)days.One inspector is assumed for Links 4 and 5 for a construction window of one hundred twenty four (124)days. @ Links 2 and 3 will start construction in March,1996 and continue through January,1997 as scheduled in the RFP. Budget The amount of inspection time is directly attributable to the contractor and his construction schedule.Since this is beyond our control,the following assumptions describe a minimum inspection effort.We expect to discuss the actual requirements closer to the time of construc- tion. ¢Allow for two (2)inspectors with vehicle,mobilization and demobilization expenses,for one hundred twenty four (124)continuous days and for one (1)inspector for an additional thirty-two (32)days,the duration of the construction phase for Links,1,4,and 5 (156 total days)to implement and maintain the construction inspection objectives.Per diem will be required for one inspector for one hundred twenty four (124)days (Links 4 and 5).The inspector Link 1 is assumed to be man camped whose per diem expenses will be -24- D.SCHEDULE The following pages contain our proposed schedule of our work plan for the design tasks.It is based on the main topics from the RFP schedule and assumes the activities and data neces- sary for the design effort will be available when needed.There are two schedules presented. The first is for the design effort and the second shows an overall project plan.Our design schedule shows some slack time near the end of 1994.GVEA may need to move some of the design effort to better match with some of the other activities. -26- S-Jan-1994Project:GVPROtackchart Jan Liduendemed,it AFI Oec|Aug |sep |oct |Noy |Lenalatel,on ee ee ee eeeeeehit nEE nl doce cccccccccecececscscesesescsesesessetstesteceetevevevevesessesstevevevsess -- 2 T 4 2i $7 J-_4° ee ee ee ee of ee i ia i ee a i ee i eo 7 PS > - DS RD ORR Eaon eee+f cccccubuececuecsuseccecuceecescecsuseccucsececseseeceeecaeececuececauseescuncsseeseessieeeees 1Toj ai 74: ee (rear Se heeheah 7 ] ia AlJleasa rs Jilqii 2 Ez. § e,328 43 3 $3g38 36 = gedeok 5S25 56 a SeG GHEE =8z2 a < essb 4G 235 5a = z 2,28 =2z2f 22 56%2&8 2 3 w@®84 z=§$S395 ne ee <558§ e358€&Ss26o252 5B 222 pFeR_RzeezeRE ZBEG HST 8 6°S64$ 635286 8«g2 8$€n os85 5&2 385 25ESB g)®65 eH 48H BT Ck es i ereeeee Poge 1-1 S-Jan-1994Project:GVPROTrackchart aaenee a"4:2 eer re ee iyie eSCee COO eer eeechee 4 2 4 L $7Ss (SSGR GSQR RS I eo -L cs cs Os iS 37ce esa a areary BA boo oc ccc cccccccceccncccuccecceccceccecccsc|esccescccse|ese[eccccecccccsccnsccneceeceeceeeeeseeceeeesseeeeesnees a F a a SPa RR >" rae Ge ns Genres ree brn thn tr Pee ee 47 2 22 3] t ecco cecccecccecccecceeceueseeceeceesceseesaes Pi ee eeeee aoe¢-BOD occ ccc ccc cece cece cece cee ence eee eee eee enna cane eee ce nent eee en ase sene sense eseneee neon eceneeneeecentees oqOSes (nanan eeeenaee eee wc cece m ewww wee teen e ree eae snewenaeseresaee _aGD ccc cc cee cee e merece eee e eee nese n rene cen nese ass erer cease sassssnsnsasscsasecesersararcsereraasasscrnsess =4 = BY cece ccccecccccesevessessusssessse ph cesesssessessesstssesssessesselisssnsssessesseseeeseesseee SS we BTdoco cecceccecccccececccccseeecececeeseececeePececsesseccessssseesseseeaeeeeeseceseneeeeeeeeeseensteseesa g n5o 3Fe2332=933a z2 FA $888g85 bh «,8 88S&2225= zFs ae@,2 288>226 P,P SEP RRESEEEE <s8 3258 8S228e2Ee - [4 "4we ec2g FESS ERS Ese8 off 28s SSFEGi SSE seSB 37° °°eoeect ee BER aes S =z -N"+ - - - - - - - Page 1-2 S-Jan-1994Project:GVPROrack¢hart a a a aE SSEaa aera a aS aa TD TD a $7SN a _4onota-ao}oePs eer rr re i i i ir ic i cra 7 T e+ " Sy ccc cece cece cece nee cseeeeeeceeeseaeees wee ebiieen peeee cece ccc cee eaeeennesensceeseeseeeseaneereecesneeees 4 T 4 2 37 LL C-O (a PG OS -437iee ee ris (naar OarsDeeee ae Oe ee 4soBN occ ccc ccc ccc ceccceee cece ceeavevecescennncnfececccecccefees focccccccaceseeeeececeesteccceeeeeteeeensssenetneeeees - oeChe fe (es(enn ere Gee22ee ee eee ee ouaPeee eens Pee bee ee rrr ee ee ee ee oS]ee ee Pere ee ee re rrr Pre Pn er aeeee ee ee [ -- 7odejafePe Pm OO reaee om+eee eeSe rrrns ns(ee (en 7 TBy BYlc cccccccecsceccseecessessseseeseseeteleoneesBde cece cecesseeeeseeeenieeeeneeenneessesesees = : a a 55 rr n Ee 3 2 €6§2§$-. i} hu z Be@3 77) z2 z .§£2.8386 65 ro 5 4 ££8a -uw - Sse 8s gx 5a = SEE ZS =eBz4 a F BEER &2 2B226 F 2sa& 8z=? 3622 = «ze 2% 2-228egSE 9 2 #2 #2*®8H&2§85 age wo=-5#&6G 3=°° >Ss set? z2e2 i222 82FG=b=£-8w5Sf&28832aon [=] P2ieeas8SF2238FEREB sia daa ua Gi Geaiih<662qe06€6SKCSoOFeFeee eeeM Page 1 3 We will work diligently to maintain the attached schedule with the full understanding of the complexities and tight coordination of this project.There are some parallel activities that could effect our schedule.The Environmental Assessment will be running parallel to the design and could create some backtracking.Soils investigations and surveying will need to dovetail with the structure spotting activity. The following list briefly describes our schedule for each Task and the potential conflicts with other activities as we see them. ¢Task 1 -This is project administration and should not conflict with other activities. ¢Task 2 -Data review will be partially completed in January.The final routing activity is expected to require input from the environmental effort.This portion could be delayed several months,but must be completed for the surveying centerline data.Centerline surveying will feed into the structure spotting (Task 8). ¢Task 3 -The design criteria can be developed independently.It will be used for development of the basic design manual (Task 4). ¢Task 4 -Work on the design manual will begin after completion of the design crite- ria development.The design criteria and information gained from the data review, Task 2,will be utilized to develop the most applicable design guidelines.In order to meet the schedule for spotting of structures,Task 8,REA approval for the basic design manual should be as expeditious as possible. ¢Task 5 -From the basic design information developed in Task 4 along with informa- tion provided by the geotechnical investigation the foundation and anchor design will be developed. ¢Task 6 -Surveying assistance will be provided during the structure staking.This task is contingent on completion of the structure spotting,Task 8. «Task 7 -The structure data sheets and staking sheets are dependent on completion of the structure spotting,Task 8.Final foundation drawings are contingent on com- pletion of Task 5., ¢Task 8 -The spotting of structures can begin once the plan and profile information is received from the surveying group and the basic design manual is approved. ¢Task 9 -Construction specifications will be developed after the completion of the construction detail (Task 7)and the foundation design (Task 5). ¢Task 10 -Material specifications can be supplied for different components of the project at different times.The long lead items would be investigated and their speci- fications developed as soon as possible.We foresee the wire will be the first specifi- cation available,followed by the structures and insulators.If required,tower bidding can be conducted prior to the finalizing of quantities.Bids may be requested with -30- E.COST PROPOSAL Fee Schedules The following Fee Schedules represent the 1994 billing rates for individuals.Based on the GVEA schedule we expect to complete our design work in 1994.If we are delayed in com- pleting the design,through no fault of ours,beyond 1994 we may wish to discuss a change in billing rates.We do not expect to change overhead or multipliers,but wages to individuals do change and we may need to pass this change on to GVEA. Inspection is expected in 1995 and 1996,billing rates for the construction manager and inspec- tors may need to be adjusted. NTE -32- Note: (1)The Fee Schedule is subject to review on January 1 each year. (2)Expenses incurred as a necessary part of the engineering services provided under this contract will be billed at actual cost.These expenses include airfare,subsistence,repro- duction,telephone tolls and other items billed through Dryden &LaRue,Inc.at the discre- DRYDEN &LaRUE,INC. FEE SCHEDULE January 1,1994 PRINCIPAL ................$95.00/hour PROJECT MANAGER ........$90.00/hour PROJECT ENGINEER.........$87.00/hour SENIOR ENGINEER .........$78.00/hour SENIOR FIELD ENGINEER .$73.00/hour STAFF ENGINEER ..........$65.00/hour FIELD ENGINEER ..........$55.00/hour AUTOCAD DESIGNER/DRAFTSMAN -$55.00/hour WORD PROCESSOR .........$35.00/hour CLERICAL &EXPEDITOR .....$25.00/hour SUPPLIES Blueline Prints ..............$1.50 each Drafting Adhesive ............$1.50 each Mylars 6.ke eeeee $5.00 each Mileage .............00eee $0.30/mile PaintJet Prints ...............$0.75 each Plotter Bond ...............$2.50 each Vellum 2....ee ee eee eee $2.50 each Xerox Copies ............5-.$0.15 each tion of the engineer. (3)Services and materials purchased by Dryden &LaRue,Inc.at the request of the Owner 'will be billed at actual cost times 1.10 multiplier (10%).These purchases include con- struction materials,tool purchase and rental,freight on materials,subcontracted engineer- ing services,construction labor and others as directed by the Owner. (4)Unusual overtime requirements requested by the Owner may be billed at 'straight time'times 1.25 multiplier (25%). (5)Interest at the rate of 1.5 percent per month may be charged on all unpaid accounts after 30 days. -33- Page 1 HEALY -FAIRBANKS 230 KV INTERTIE PROJECT POWER ENGINEERS INC. SCHEDULE OF CHARGES -1994 This standard Schedule of Charges is for professional services.Unless agreed otherwise,charges for work on continuing projects will be based on the then current Schedule of Charges.A new Schedule of Charges will be issued to be effective January 1 of each new year and as necessary on an intermediate basis to accommodate new items or revised charges.Invoices will be submitted monthly and/or upon completion of the work and will be due and payable when issued.All accounts not paid within thirty (30)days from the invoice date will beara SERVICE CHARGE OF 1.5%PER MONTH for each month the invoice is unpaid. NN ICATI Project Manage ..........c.:csssescscrscoreroresoosereconseeasecsoconsatsctessacoesesenasoseasoaessessetsseacsocreaeessssvsssssuscosscssossceesons $93.00/hr. Senior Consultant Project ENginee'.............:.cscsesccsssocssscesssccessssceesonsesssecvsavessesacanscossvesoossonssecucesenssscsonsteedsarssenssoccosssoereeseeee $83.00/hr. Consultant Senior Project Administrator Supervisory R-O-W Agent Engineer III .,.........ccccsseeecesceesceconscereetseeetenccscsencencocsconscoescseescocseesorsotehenseevessecssdesecessseesossonseessneeessssonasaasenens $73.00/hr. Designer IV Engineering Technician IV Environmental Specialist III Senior R-O-W Agent ENMGineers I).........ccecsscsceesccenceneessseescsesesssacesesesessssesssecesssssasesseeecesssaeesssssssscseasdsesesecesanesansesecsarssanseesssesenssasas $63.00/hr. Designer Ill Engineering Technician II! Environmental Specialist ll Purchasing Agent Senior Administrator R-O-W Agent ENMQine@er Iau...ces ccseeeecsscesecseeneescesseesesescesesssnssnsesssesssssssecssssneseessessensecuesseneessentasaesoeesenseensensessessaneeceeessenen $54.00/hr. Designer Il Engineering Technician II Environmental Specialist ! Administrator Field Representative |V Senior Purchasing Specialist DESIGNED I...ceseecescssesssneseeccesteconssesessssusussusssusesessseseesscnesaeaeenesssscensssssasseseeaeseeaeensseescaaeasesensessrsesssaeereed $46.00/hr. Engineering Technician |: Administrative Assistant Field Representative Ill Purchasing Specialist Drafter...ccccssscscssssssssssocseeseessseessrersssesonoocssoccovcosssgosousasesccenseacosousacocessessccssssseeeneeuseneeesssecoossensecsaeanseasens $39.00/hr. Staff Assistant Field Representative I! Typist...ceesccsssescoeseescsoesseensesessessesssssssseassncessocaccacsessssesscccentooscossasasetansacsnseresstentenssnssansestenessoseeassenesaees $29.00/hr. Data Entry Operator Field Representative | Utility No premium is charged for overtime work.Personnel with specialized experience are employed by or on retainer to POWER.Charges for thesespecificationsarenegotiatedonanindividualbasisdependingontheassignment.Professional time for depositions and testimony is charged at 1 5 times the rate for services;full-day minimums apply. GM135A (10/18/93) Task # HF138W8S.XLS General Engineering Cost Breakdown by Design Task and Links Project.Healy to Fairbanks 230 kV Intertie Link # 1.0 2.0 3.0 4.0 5.0 6.0 7.0 8.0 9.0 10.0 11.0 12.0 13.0 PROJECT ADMINISTRATION 1-4-5 456 MH 2-3 582 MH DATA REVIEW 1-4-5 198 MH 2-3 54 MH DESIGN CRITERIA 1-4-5 506 MH 2-3 168 MH DESIGN MANUAL 1-4-5 225 MH 2-3 75 MH SOILS INVESTIGATION 1-4-5 143.MH 2-3 183.MH SURVEY /LINE ROUTING 1-4-5 53.MH 2-3 67.MH CONSTRUCTION DETAILS 1-4-5 319 MH 2-3 405 MH STRUCTURE SPOTTING 1-4-5 542 MH 2-3 688 MH CONSTRUCTION SPECIFICATIONS 1-45 321 MH 2-3 107__MH MATERIAL SPECIFICATIONS /LIST 1-4-5 282.MH 2-3 94 MH BID DOCUMENTS 1-4-5 61 MH. 2-3 79 MH ENGINEERING DURING CONSTRUCTION 1-4-5 212 MH 2-3 268 MH 'RECORD DRAWINGS /CLOSEOUT 1-4-5 517 __MH 2-3 659 MH Page 1 $16,200 $5,400 $11,485 $14,617 $4,435 $5,645 $22,162 $28,206 $32,253 $40,993 $26,022 $_8.674 $34,672 $44,128 HF1I38WBS.XLS General Engineering Cost Breakdown by Design Task and Links Project:Healy to Fairbanks 230 kV Intertie Task #Link # 14.0 BID EVALUATION 1-4-5 80 MH $6,841 2-3 100 MH $8,707 15.0 PROJECT/CONSTRUCTION MANAGEMENT 1-4-5 1,232 MH g 107,184 2-3 1,568 MH $136,416 16.0 CONSTRUCTION INSPECTION 1-4-5 2,329 MH $122,813 2-3 3,215 MH $169,355 0.0 EXPENSES 1-4-5 $_57,198* 2-3 $_72,798% TOTAL LABOR AND EXPENSES |1,217,466 | CONTINGENCY 10.00%121,746 -_alGRANDTOTALN.T.E.=====>||1,339,212 || - { *Expenses include Task 15 &16 which are: 1-4-5 42,625 2-3 54,251 Page 2 Project:Healy to Fairbanks 230 kV Intertie Man-hour Breakdown per Resource/Task Unit $$90/Hr $87/Hr $65-87/Hr_$55/Hr $35/Hr $87/Hr $52/Hr Project Project Engineer TOTAL Manager Engineer Staff AutoCAD _Clerical CM Inspector COSTS PROJECT ADMINISTRATION 1-4-5 284 160 12 $39,947 2-3 362 204 16 50,841 DATA REVIEW 1-4-5 42 130 24 2 17,403 2-3 14 30 8 2 4,601 DESIGN CRITERIA 1-4-5 54 164 153 120 15 37,091 2-3 18 54 51 40 5 12,364 DESIGN MANUAL 1-4-5 24 60 123 18 16,200 2-3 8 20 41 6 5,400 SOILS INVESTIGATION 1-6-5 1 42 70 13 7 11,485 2-3 13 54 90 17 9 14,617 SURVEY/LINE ROUTING 1-4-5 11 35 7 4,435 2-3 13 45 9 5,645 CONSTRUCTION DETAILS 1-4-5 35 9 79 9 7 22,162 2-3 45 125 101 125 9 28,206 STRUCTURE SPOTTING 1-4-5 1 a8 114 320 9 32,253 2-3 13 110 146 408 11 40,993 CONSTRUCTION SPECIFICATIONS 1-4-5 63 168 &%6 26,022 2-3 21 56 28 2 8,674 MATERIAL SPECIFICATIONS/LIST 1-4-5 65 78 123 36 19,881 2-3 15 26 4i 12 6,627 Project:Healy to Fairbanks 230 kV Intertie Man-hour Breakdown per Resource/Task Unit $$90/Hr $87/Hr $65-87/Hr_$55/Hr $35/Hr $87/Hr $52/Hr Project Project Engineer TOTAL Manager Engineer Staff AutoCAD _Clerical CM Inspector COSTS BID DOCUMENTS 1-4-5 9 28 14 10 4,456 2-3 11 36 18 14 5,672 ENGINEERING DURING CONSTRUCTION 1-4-5 106 106 18,691 2-3 134 134 23,688 RECORD DRAWINGS/CLOSEOUT 1-4-5 35 176 88 176 42 34,672 2-3 45 224 112 224 54 44,128 BID EVALUATION 1-4-5 14 25 39 2 6,841 2-3 18 31 49 2 8,707 PROJECT/CONSTRUCTION MANAGEMENT 1-4-5 1,232 107,184 2-3 1,568 136,416 CONSTRUCTION INSPECTION 1-4-5 2,329 122,813 2-3 ° 3,215 169,355 SUM 1,474 2,268 1,852 1,542 308 2,800 5,544 $1,087,470 TOTAL MANHOURS:15,788 F.RESUMES This section consists of resumes for the following personnel: Dryden &LaRue,Inc. Delbert S.LaRue,P.E. Ken L.Dyson,P.E. Jack S.Anderson,P.E. Alan B.Peabody,P.E. POWER Engineers,Inc. Ron Carrington,P.E. John McGrew,P.E. Dave Boutelle Gary Kunick Joe Knight -40- EXPERIENCE PROFILE DELBERT S.LaRUE,P.E.,President Dryden &LaRue,Inc. Education Purdue University,B.S.,Electrical Engineering Registration Registered Professional Electrical Engineer -Alaska No.EE 3939 Professional Affiliations ¢National Society of Professional Engineers ¢Institute of Electrical and Electronics Engineers Publications "Unusual Structures for Alaska Transmission"by D.S.LaRue,R.J.Montambo,R.W. Retherford,Transmission &Distribution Magazine,October 1979,Vol.31,No.10. Experience Mr.LaRue's 30 years of experience in the electrical power industry includes 8 years outside and 22 years within Alaska.A summary of his Alaskan experience follows: Mr.LaRue founded the consulting firm Dryden &LaRue,Inc.in 1977 to provide valued engineering services to several Alaskan utilities.Since the beginning,D&L has worked contin- uously with an ever widening base of utilities to provide the engineering that is needed.Mr. LaRue is responsible for administration of the company and functions in all capacities from project manager,quality assurance control to typical engineering duties.The company has purposely been kept small to better respond to local needs and to maintain quality control of the engineering product. Prior to forming Dryden &LaRue,Mr.LaRue was employed by Robert W.Retherford Associ- ates as a Project Engineer.As such his responsibilities included:transmission and distribution - system design,project management and construction supervision,bidding and contract adminis- tration management,system analysis,economic analysis and feasibility studies,and planning and design of village systems. His Alaska experience began at the Municipality of Anchorage as a Project Engineer.While employed there his responsibilities included:transmission and distribution system design, project management and construction supervision,bidding and contract administration and formulation,economic analysis and feasibility studies,and planning. -41- REPRESENTATIVE PROJECTS -Delbert S.LaRue DRYDEN &LaRUE,INC.President Anchorage,Alaska 1977 -Present Alaska Energy Authority Tyee Lake Transmission Line (1989-Present) As Project Manager investigated snow loading and foundation problems on 70 miles of line from remote hydroelectric site to Petersburg.Developed meteorological and climatological loadings.Developed and analyzed options to modify existing structures and foundations to accommodate climatological loadings.Prepared design and specifications for insert steel towers along four miles of line. Thompson Pass Repair/Rebuild (1989-1990) As Project Manager furnished design and construction management for repair/rebuild for two miles of 138 kV transmission line damages by massive avalanche in Thompson Pass. This line interties Glennallen with Valdez.Provided fast-track replacement,failure mode analysis of existing structures,and designed new replacement structures. ASEA Brown Bovari -Power Systems Inc. Daves Creek and Soldotna SVC Stations (1991-1993) Project Manager:As a subcontractor to ABB-PSI,Dryden &LaRue was responsible for physical design of the 30 MVAR Daves Creek and 70 MVAR Soldotna Static Var Compen- sation System constructed for the Alaska Energy Authority.Provided contract document preparation and review,contract negotiations,design,technical support,claims avoidance and certain aspects of project management. Chugach Electric Association,Inc. University Cleanup (1988) As Project Engineer provided complete design and construction management for the cleanup of an insulating oil spill at University Substation.This project consisted of the design of a temporary 230 kV bypass bus,the temporary relocation of a 300 MVA 230/138 kV trans- former and 230 kV OCB,removal of contaminated soils,and reinstallation of all relocated equipment.In addition,a complete oil spill containment system with surface catchment and underground storage was designed and installed. -42- REPRESENTATIVE PROJECTS -Delbert S.LaRue Gilbert/Commonwealth Anchorage/Fairbanks Intertie (1980-1983) As Alaskan Project Engineer performed overall project review on the 345 kV,175-mile transmission line to intertie the communities of Anchorage and Fairbanks.His responsibili- ty encompassed all aspects of transmission lines including:agency contracts,public meeti- ng,route selection,meteorological coordination,design criteria,and design. Glacier Highway Electric Association,Inc. Auke Bay (1980-1982) As Project Engineer provided project management for the design and construction of a 7- mile,69 kV transmission line with 12.5 kV underbuild and distribution substation.This project included all aspects from routing through close-out with the REA. Homer Electric Association,Inc. Ski Hill (1984) As Project Engineer provided complete design of 20 MVA 115/12.5 kV distribution substa- tion with underground secondary.Project included siting,115 kV tap design,complete substation design and construction management. Various (1983-1984) As Project Engineer assisted the utility with a multitude of small distribution line projects, a construction specification book,and system studies.Also provided field inspection services for cable TV installation on the utility facilities. Kodiak Electric Association High Substation (1990-1993) As Project Manager provided complete design of 20 MVA 69 kV/12.5 kV substation with two income 69 kV lines and four 12.5 kV feeders.Project included siting,complete substa- tion design and construction management. Cannery (1985-1989) As Project Engineer provided complete design and construction management of 4.5 miles of 69 kV transmission line with 12.5 kV underbuild.The project included self-supporting steel towers with double circuit 69 kV and double circuit 12 kV through a highly populated section of Kodiak.Also,wooden H-structures were designed for a steep hillside above town.This project also included line routing,and extensive right-of-way support. -43- REPRESENTATIVE PROJECTS -Delbert S.LaRue Kodiak Electric Association Continued ¢Airport,Swampy,Main (1982-1984) As Project Engineer provided project management for the design of 6 miles of 138 kV transmission facilities (wooden H-type)and three major substations (138 to 12.5 kV and 138 to 69 to 12.5 kV). Matanuska Electric Association,Inc. Long Range Plan Review (1980) As Project Engineer reviewed and updated the system Long Range Plan.This project included extensive electrical performance analysis and integration into existing and potential power supplies. North Slope Borough Atqasuk Airport Lighting (1986-1987) Design Engineer:Design and construction management responsibility for Atqasuk airport lighting.This project consisted of one-mile of distribution line,and a complete runway lighting system with PAPI approach,runway and taxiway lights,NDB,control building and fire suppression system. City of Seward Transmission Line -South (1990-Present) Project Manager for the design and construction management of 24 miles of 115 kV trans- mission line with 12.5 kV underbuild to replace existing 69 kV line.The project includes wood H-frame and single wood pole design.This project included line routing,extensive right-of-way support,design and construction management. Spring Creek (1987) As Project Engineer provided administration and design responsibility for a complete turn- key project.This project consisted of siting,design,construction management and startup of a 20 MVA,69/12.5 kV distribution substation with 4 feeders. Nash Road (1985) -As Project Engineer provided administration and design responsibility for a complete turn- key project.The project utilized existing materials to design and build 2 miles of 69 kV transmission line with 12 kV underbuild. -44- REPRESENTATIVE PROJECTS -Delbert S.LaRue Stone &Webster Corporation Quartz Creek Line Upgrade (1991-1992) As the Alaskan Project Engineer assisted Stone &Webster with the design for rebuilding the existing 115 kV Quartz Creek line from 115 kV to 138 kV.This line extends approxi- mately 90 miles and interties Anchorage and Kenai peninsula.Provide avalanche hazard identification and mitigation.Develop avalanche resistant structures,review design docu- ments.Field investigate new structure locations. Bradley Lake Hydroelectric Project (1984-1991) As a subcontractor to Stone &Webster on the Bradley Lake Hydroelectric Project,D&L was responsible for all aspects of the feasibility and design for two 19-mile 115 kV trans- mission lines from the powerhouse to interconnection with Homer Electric.The scope included development of design criteria and assessment of alternative routings,tower types, and conductors.Cost estimates were developed for different overhead configurations and a section of submarine cable. Valdez-Cordova Intertie (1982-1983) As Project Engineer performed feasibility,route selection,detailed cost estimating and preliminary design for the Valdez-Cordova Intertie.Seven alternative transmission schemes were analyzed including overhead and submarine cable. -45- EXPERIENCE PROFILE KEN L.DYSON,P.E. Dryden &LaRue,Inc. Education -B.S.(1987),University of Texas at Arlington,Electrical Engineering -B.S.(1977),Southwest Texas State University,Resource and Environmental Studies Registration Registered Professional Electrical Engineer -Colorado -28737 +Texas -71781 Experience Mr.Dyson has been working in the engineering field for over 14 years.As a new employee of Dryden &LaRue Ken will be part of the professional engineering staff specializing in transmission design. While working for Stone &Webster Engineering Corp.as an Electrical Engineer in the Transmission &Distribution Section,he was responsible for all phases of transmission line design.Mr.Dyson's primary tasks included:Preparation of design criteria;Determination of code requirements for wind and ice loads,and conductor tension constraints;Use of ALCOA Sag/Tension program;Mechanical and Electrical evaluation of conductors;Calculation of structure loading trees;Calculation of conductor blowout;Determination of insulator,hardware, and guying requirements;Preparation of material and construction specifications;Preparation of permit applications;Determined application for use of standard light duty steel poles; Overseen digitization of topo maps for use with TLCadd;and Utilized TLCadd for structure spotting. Projects of responsible charge: Hawaiian Electric Company,Wajau -CIP 138 kV Lines Lead Design Engineer:Responsible for design of 8 miles of double circuit 138 kV with double circuit 46 kV underbuild,on self-supporting tubular steel poles.Project includes design of 46 kV switching and line tap capabilities. Hawaii Electric Light Company,Fifth Cross Island 138 kV Line Lead Design Engineer:Responsible 'for design of 55 miles of 138 kV line utilizing direct embedded and guyed light duty steel poles.Design incorporated special construction considerations because of terrain (lava flows). -46- EXPERIENCE -Ken Dyson Iowa Power Company,345/161 kV Des Moines Loop Support Engineer:Performed sag/tension analysis on conductors for matching sags and for tension constraints of substation deadend structures. Basin Electric Power Cooperative Lead Engineer:Evaluation of transmission line crossings of the Missouri River,for lighting and marking compliance with FAA guidelines.Involved review of FAA documents and standard lighting and marking options. While at Houston Lighting and Power Company as a Contract Engineer (Under contract with Henkel's &McCoy)Ken was responsible for new line design of 69 kV and 138 kV facilities, rehabilitation and uprating projects.Tasks included:Conductor sag and tension evaluation using IEEE method;Evaluation of existing wood H-Frame and single pole structures for re- conductoring and insulator uprating;Economic analysis of construction alternatives,i.e.wood, steel,or concrete poles;and Line evaluation for code compliance. Projects: Webster Substation 138 kV Tap Line Project Engineer:Designed facilities to add an additional 138 kV source to the substation. Line was designed on single wood poles.Project also included designing temporary facili- ties for relocation and construction. Wharton -S.Lane City 138 kV Rehabilitation Project Project Engineer:Evaluated wood H-Frame structures,insulators and hardware,and guying for replacement and/or bracing.Performed sag/tension analysis on conductors for clearance compliance ant higher operating temperatures. Karten -Juliff Pump 69 kV Line Project Engineer:Performed economic analysis of construction alternative for re-build of the line and uprating to 138 kV operation. In Mr.Ken Dyson's 12 years at Texas Power &Light Company his transmission experience included the design of 69 kV,138 kV and 345 kV lines.Ken's experience also included contracting of construction and environmental services,preparation of PUC line applications, and evaluation of environmental assessments.Other typical tasks included:Conductor studies for proposed lines;Line routing (with regard to PUC applications);Calculation of H-Frame bracing requirements;Buckling and deflection analysis of single wood poles;Preparation of material and construction bid packages;Conductor sag and tension analysis;Load tree calcula- tions;Lightning performance studies;Interface with government agencies and other utilities for project construction;and Beta tested EPRI tower spotting software. -47- EXPERIENCE -Ken Dyson Projects: Palestine JCT.-Palestine 138 kV Line Project Engineer:Designed 3 miles of 138 kV double-circuit line on self-supporting steel poles.Performed sag/tension analysis for reduced tension installation of 1033.5 Curlew conductor. Palestine Jct.-Alcoa 138 kV Line Project Engineer:Designed 11 miles of 138 kV circuit using primarily wood H-Frames. Calculated bracing requirements for H-Frame application.Designed one section of the line utilizing previously use single circuit steel poles.Evaluated pole loadings and design load trees for use in this line. West Cleburne 138 kV Loop Line Project Engineer:Performed preliminary design of line using double-circuit self-supporting steel poles.Prepared PUC application for Certificate of Convenience and Necessity for line. Prepared secondary line routing study.Contracted environmental services and evaluated environmental assessment of route impact. -48 - EXPERIENCE PROFILE JACK S.ANDERSON,P.E. Dryden &LaRue,Inc. Education *Boise State University,Boise,Idaho,Pre-Engineering,1975 *University of Idaho,Moscow,Idaho,1978 BSEE (power)¢Westinghouse Electric Corp.,Greentree,Pennsylvania,Technical Orientation Program 7/78- 9/78 ¢Power Engineering Courses,University of Idaho,University of Washington,Institute of Electronic and Electrical Engineering,1981-1990 *Numerous Training Seminars,including Power System Relaying,Protection and Grounding of Distribution Systems,Distribution System Design,System Protection and Voltage Con- trol,National Electrical Safety Code Reviews,PCB Regulations,Economic Design of Distribution Systems,and Load Forecasting Seminars,1978-Present. Registration Registered Electrical Engineer -Alaska EE 6894 Professional Affiliations ¢Institute of Electronic and Electrical Engineers ¢National Society of Professional Engineers Experience Mr.Anderson has spent 15 years in the electrical engineering field with emphasis in technical and management experience.During this period he has served as the Utility Manager for the City of Unalaska,Utility Engineer for the City of Seward,Manager of Engineering for Missoula Electric Cooperative,and Field Service Engineer for Westinghouse Electric DRYDEN &LaRUE,INC.Consulting Engineer Anchorage,Alaska 1990 -Present ¢Chugach Electric Association,Inc. Design Engineer for the addition of reactor switches and new yard addition. *Kodiak Electric Association,Inc. Design Engineer for 10 MVA substation with transmission supply and distribution feeders. -49- Experience -Jack Anderson *City of Seward Project Engineer for a 24-mile 115 kV transmission line and associated substation work. °City of Unalaska Project Engineer for 7 MVA substation. CITY OF SEWARD Utilities Engineer Seward,Alaska 1984 -1990 Responsible for the management support,engineering,operation and maintenance of 20 miles 115 kV transmission,24 miles 69 kV transmission,10 miles 24.9 kV distribution,100 miles 12.5 kV distribution,10.5 MW diesel generation and 2450 customer municipal electric system. Directly supervise one electrical engineer,clerical support and 5 journeyman electric line crew. Also provide management/engineering support to the water,wastewater and harbor department. CITY OF UNALASKA Electric Utility Manager Unalaska,Alaska 1983 -1984 Utility policy implementation,along with recommendations toward the updating of the policies, simple rate structure analysis,system protection and coordination,material specifications. Planning and construction supervision of upgrades and maintenance for two separate distribu- tion and generation systems,totaling 750 kW and 350 customers.Main responsibility was the construction of 7-1/2 miles of 34.5 kV underground distribution,the design and construction of two substations and a 10 megawatt diesel generation power house. MISSOULA ELECTRIC COOPERATIVE Electrical Engineer Missoula,Montana 1980 -1983 Perform the duties of Manager of Engineering and operations while the manager was on indefinite disability leave.These duties included scheduling and supervision of the operation and maintenance of 50 miles of 50 kV transmission line and 1450 miles of 12.47 and 24.9 kV distribution lines along with 15 substations. WESTINGHOUSE ELECTRIC CORPORATION Field Service Engineer Butte,Montana 1979 -1980 Provided the State of Montana Westinghouse Field Service Engineering.Projects are as follows:Transformer testing and installation,transformer and motor rewinding,substation design and construction,plant distribution system consulting,DC braking of induction motors, custom design of portable substation,synchronization of auxiliary generator sets,custom design of power relay panels,mining distribution system consulting,ground resistance testing,infrared scanning of substations and motor control centers,design of motor rewind shop test panel, mechanical alignment of M-G sets,plant maintenance consulting,start up of DC static SCR controls,underground cable testing. -50- Experience -Jack Anderson CLEARWATER POWER Assistant Staking Engineer Lewiston,Idaho 5/1977 -9/1977 Oversaw contractors work of pole replacement and right-of-way clearing.Involved with some line staking and right-of-way procurement. -51- EXPERIENCE PROFILE ALAN B.PEABODY,P.E. Dryden &LaRue,Inc. Education Massachusetts Institute of Technology,B.S.Art and Design (Architecture) Registration Registered Professional Engineer -Alaska -CE8319 -Kansas -8834 -Kentucky -12437 -Florida -39252 Professional Affiliations American Society of Civil Engineers Experience Summary Mr.Peabody's experience includes eighteen years devoted to design,project management,and inspection of high voltage transmission lines ranging from 69 kV to 500 kV.Types of con- struction include wood,tubular steel,and lattice steel towers.While employed by Dryden & LaRue,Al has been identifying and developing solutions to correct design deficiencies on transmission line projects previously constructed by the Alaska Energy Authority and preparing designs for avalanche resistance foundations. During his employment with Burns &McDonnell Engineering,Al took several projects from conception to energization.This has included:design studies to determine conductor size and structure material and type;routing studies to determine the best overall line route,as well as the final selection of PI's;supervision of surveys;conductor sag-tension design;structure spotting;structure design;foundation design;material specifications;and construction specifica- tions.His duties have also included capital cost budgeting,budgeting engineering costs,sched- uling,and supervision of design personnel on large projects.He served as resident construction manager and was responsible for managing an inspection staff of 20,reviewir.;pay estimates, reporting to the owner on progress and analyzing contractors'claims. -52- RONALD CARRINGTON,P.E. POSITION: EDUCATION: REGISTRATION: EXPERIENCE: CHIEF TRANSMISSION ENGINEER B.S.,Civil Engineering,University of Colorado at Boulder,1982 Colorado,Indiana,Wisconsin,Nebraska,Minnesota Mr.Carrington is POWER's Chief Transmission Engineer responsible for technical advancement,quality control,marketing and resource management. Mr.Carrington has extensive experience in line design,project management and coordination of 44kV to 345kV transmission line projects and 115kV through 230kV underground transmission line projects.Activities include route selection,estimating,project evaluation, scheduling,budgeting,surveying,line design,preparation of specifications,purchase of materials,contracting of services,coordination and supervision of team members and inspection of construction.He is proficient in using various computer programs such as Tower,LPILE and EPRI's TLWorkstation (ETADS,POLEDAR,FRAMER,MFAD, CUFAD).In addition,Mr.Carrington is a nationally recognized expert in the use of TLCADD line optimization and design software.Projects range in size from one structure to 100 miles and from $10,000 to $30 million.He has also been responsible for civil engineering,surveying,soil investigations,foundation design and analysis and design of all types of wood and steel transmission structures.Activities include engineering analysis and design,preparation of specifications,purchasing and contracting for materials and services, supervision of drafting,and inspection of construction.His experience includes: a ine-Moore 345kV Lin ka Publi istri k Design Manager for the design of 96 miles of 345kV transmission line.Project scope includes routing,surveying and right-of-way acquisition,structure design,preparation of construction drawings and specifications and construction management.Mr. Carrington's responsibilities include direction of the design of a new series of 345kV lattice steel towers. a ver Ai ission Line Proj lic Servi ny of ! Project Engineer for the design and installation of 33.5 miles of double-circuit 230kV transmission line.The project also included removing approximately 16 miles of existing 230kV lines.The new line consists of self-supporting,tubular,single-shaft, weathering steel poles.Mr.Carrington was responsible for all aspects of this project including preliminary design,final design,optimization studies,drawing preparation, structure spotting,specifications,procurement and construction management.Mr. Carrington used TLCADD extensively throughout the structure spotting,optimization, engineering and design of this transmission line. O Public Service Company of Colorado,Colorado Transmission Engineer responsible for line design and analysis,structure spotting, hardware selection,construction specifications,permitting,regulatory compliance and construction inspection.Mr.Carrington has used TLCADD extensively for structure spotting,line design and analysis,profile drawing generation and stringing sag calculations.: RONALD CARRINGTON,P.E.2 o in-Aul Colorado Transmission Engineer responsible for the design of 31 miles of single-and double- circuit tubular steel poles.Mr.Carrington was responsible for the development of loadtrees,specification and procurement of 300 ($2 million)self-weathering steel poles. Mr.Carrington was also responsible for the specification,design and inspection of all foundations. !M tai Transmissi ine Project,T nerati Project Engineer for 11 miles of single-and double-circuit 69kV tubular steel pole transmission line.Mr.Carrington was responsible for routing,permitting support, estimating,design.line optimization.specifications,procurement,and construction management.This project required close coordination with the BLM and regional utilities for land use and crossing permits. -B!i V Lin li i mpan lor. Colorado Mr.Carrington was the Project Engineer for a 230kV lattice steel H-frame line.His responsibilities included development of structure loading criteria and lattice steel procurement specifications.and structure analysis.During the course of construction, Mr.Carrington served as an inspector for the lattice steel tower assembly and erection. i is Proj ificPLight.0 Californi Structural Engineer for a project to provide structural design for the installation of 277 miles of fiber optic groundwire on existing transmission lines.In all,2,000 structures were investigated in the 277 miles of line.Mr.Carrington analyzed and recommended modifications to over 300 structure types using EPRI software,POLEDAR and FRAMER.Mr.Carrington made extensive use of TLCADD for line analysis,clearance checking and stringing sag calculations. Mr.Carrington was responsible for all aspects of civil engineering relating to transmission lines.Activities included surveying,geotechnical investigation,wood,steel and concrete pole analysis and design,steel pole specifications and foundation analysis and design. Washington Project Engineer for 16 miles of 115kV steel and wood pole transmission line.Mr. Carrington was responsible for routing,permitting support,surveying,transmission and distribution line design.structure design/specification,foundation design and construction specification.Vibratory caissons were designed for helicopter and conventional installations.and a pipe pile type foundation was installed in the Snohomish River. JOHN MCGREW POSITION: EDUCATION: EXPERIENCE: PROJECT MANAGER Mechanical Engineering,San Diego State University Prior to becoming a Project Manager,Mr.McGrew acquired valuable practical experience in the electrical engineering field,first as a construction supervisor and then as a transmission/distribution designer.This solid background in construction and design has proven invaluable in the performance of his present duties,which involve the day-to-day coordination and facilitation of all tasks involved in the conducting a utility project,from conceptual planning through energization of facilities. Mr.McGrew's knowledge of electrical systems,including the design and construction process,allows him to anticipate and address potential problems in those critical project areas,thus avoiding costly delays and ensuring a project's timely and successful completion. Specific project managing responsibilities include project scheduling and cost estimating; monitoring and expediting the permitting and right of way acquisition processes;design coordination and final review;interfacing with the client,contractor and other involved agencies;and budget and schedule monitoring. Some of Mr.McGrew's project experience follows: As Project Engineer for this major Alaskan intertie study,Mr.McGrew was responsible for determining the need for a new transmission line between Anchorage and the Kenai Peninsula.This project required an examination of all possible routing and cost scenarios,as well as determining the feasibility of system upgrade and expansion. ©Sutton to Glennallen 138kV Transmission Intertie Study,Alaska Mr.McGrew was the Project Manager for a portion of this project which involves a feasibility study for a 138kV Transmission Line from Sutton to Glennallen.The purpose of this study is to investigate the possibility of constructing a transmission intertie from the Railbelt utilities to Glennallen for the purpose of purchasing the relatively cheap gas fired energy in the Anchorage area. |i timat Pow | Mr.McGrew was the Lead Transmission Engineer for the design review and cost estimate for a 7MW hybrid geothermal power plant.The design review and cost estimate considered harsh climate,high labor rates,and remoteness of the area,as well as the associated transmission lines and substations. O USAF OTH-B Radar Project.C Valley Electric A iation.Alas} Mr.McGrew was the Project Engineer for this project for Copper Valley Electric Association.CVEA required assistance in preparing a proposal to provide electrical power to the United States Air Force (USAF)Over-the-Horizon Backscatter (OTH-B) Radar System.Mr.McGrew also performed conceptual design and evaluation of generation and transmission options to supply power to the USAF. JOHN MCGREW O Terror Lake Hydroelectric Tra nsmission Line Study,Kodiak Island,Alaska Project Engineer for a transmission line study to investigate damage from ice loading and unloading.Mr.McGrew oversaw office analysis and field investigations to determine the cause of the icing problem and to make recommendations to prevent further damage. it j witchi tati Mr.McGrew was the Project Engineer for the design of a 17-mile,115kV transmission line and three switching stations in central Oregon.The purpose of this project was to provide power to the new USAF radar installation.Line design services included loading studies,preliminary review,mapping,cost estimating and optimization studies,line design,structure design,spotting and staking,and construction management.Station design services included preliminary review,geotechnical investigations,surveys,layout, site preparation,foundation designation,instrumentation and switchboards,cables and conduits,and control building.A detailed environmental assessment study has been conducted to ensure compliance with all environmental considerations. =4A istributionLine,Alask Project Engineer for all phases of design for 40 miles of 14.4/24.9kV distribution line on Kodiak Island.Mr.McGrew supervised line routing,survey,design and construction management,including material procurement and contract administration through close- out.Design includes 3,000 feet of 24.9kV underground and several single-phase taps and services. 220kV T ission Line Project,Californi As Project Manager for this 44-mile transmission line in the Los Angeles area,Mr. McGrew was responsible for coordinating and supervising all aspects of design and construction,which included coordination and design standards conformance with Southern Califomia Edison (SCE)and the Los Angles Department of Water and Power (LADWP).The line parallels existing SCE and LADWP lines for much of the project route.The line predominately consists of single-pole tubular-steel structures.However, special H-frame structures are utilized at a major SCE and LADWP crossing.The line was designed to use 1590 kcmil ACSR conductor,one conductor per phase,polymer insulators,and a single overhead ground wire. Citi Utilities C Northern V tE ion Project.V ,' Mr.McGrew was Project Manager for this effort to provide design and construction management services for approximately 33 miles of new 120kV transmission line. Design features included a 1,100-foot bay crossing which required steel structures with concrete foundations,and extensive use of Bates TLCADD to optimize structure spotting for the four segments of the line. DAVID BOUTELLE POSITION: EDUCATION: EXPERIENCE: TRANSMISSION DESIGNER B.S.,Engineering,Syracuse University,1975 Mr.Boutelle has been involved in structural design of transmission and distribution power lines,project coordination and supervision,field engineering,construction supervision,and inspection.His specific responsibilities have included analysis,design and coordination of power line projects through 345kV,and preparation of drawings for conceptual design analysis and construction. Mr.Boutelle's field experience includes construction supervision,survey,and structure staking of mountain transmission and distribution lines,field crew supervision,line routing, and structure spotting.He is also experienced in control surveying and plan and profile generation,and has held responsibility for the development of design specifications and contract and bidding documents.His familiarity with NESC,NEC,G.O.and REA specifications enables him to develop accurate structure designs and system designs in conformance with applicable codes and regulations. Projects that illustrate the range and diversity of Mr.Boutelle's experience include the following: Design Engineer responsible for overall design of 40 miles of 24.9kV distribution line on Kodiak Island.Design duties included structure selection and design,electrical design, service design,plan and profile layout,material specification,and preparation of design data manual.Also supervised the efforts of designers and draftsmen and performed checking of all construction drawings.Line was designed for raptor protection and included approximately 3,000 feet of 24.9kV underground and several single-phase taps and services. o -iver- T ission Li idat Transmission Engineer/Surveyor for 96 miles of 230kV wood-pole H-frame transmission line in the central Idaho mountains featuring 16 different structure types,including an innovative A-frame design for long spans.Responsible for coordinating various aspects of the design phase.Other duties included plan and profile drawings,structure drawings, control survey,staking structures in the field,locating section comers,etc. 0 Ci an nae.:4 As a designer for this 31-mile EHV transmission line,Mr.Boutelle was responsible for the plan and profile preparation,structure spotting,structure design,and supervising a team of drafters.Mr.Boutelle also assisted with the material list,bid documents and construction documents.The steel structures for this line required special footings to minimize the impact to underground watersheds and sources of drinking water.The structures also had to be designed so that the electrical effects at the center of the right- of-way were no greater than 2kV. DAVID BOUTELLE 0 ion-Rifl n 45kV Tr in Mr.Boutelle served as Transmission Engineer for this preliminary engineering-level project to provide alternative routing schemes for a 67-mile section of this proposed 275- mile 345kV transmission line.He was responsible for plan and profile drawings showing structures along a preferred route,as well as alternative routing in visually impacted areas.These alternative routings included four scenarios for crossing the mile- wide,1,400-foot-deep San Miguel Canyon.The alternatives ranged froma 6,300-foot clear span to a visual impact mitigating alternative that minimized line visibility from the state highway in the canyon below. -h nsi rol I.Northern Vermont Transmission Design Engineer for the updating and upgrading of a 33-mile,120kV transmission line with a 46kV second circuit.The upgrade was needed to provide additional capacity and better system reliability..Mr.Boutelle was responsible for structure spotting using TLCADD optimization software,plan and profile drawings, construction drawings,structure list and material lists.The project was broken into four segments,each with different conductor combinations,including special design steel structures for an 1,100'crossing over the South Bay of Lake Memphremagog.Special considerations for pole and insulation selections were required for anticipated heavy ice loads.Also,the project was set up to accommodate construction by both the utility and a selected contractor,with construction engineering support provided. - i -5 t As Transmission Design Engineer for two miles of double-circuit 115kV transmission with 1.5 miles of 12.5kV underbuild to extend and upgrade an existing line,Mr.Boutelle was responsible for structure spotting utilizing TLCADD spotting and optimization software,plan and profile drawings,construction drawings,structure list,material lists, and structure staking.Varying ground conditions along the route prompted the design of single-pole,tubular steel structures to facilitate longer spans to span from "good"ground conditions to "good"ground conditions.Special considerations were used for material selection because of the proximity of the ocean and the potential for salt contamination. The line was designed for 230kV operation but initially energized at LI5kV. Proj iforni As Transmission Design Engineer for 27 miles of 220kV steel pole transmission line. Mr.Boutelle was responsible for structure spotting utilizing TLCADD spotting and optimization software,plan and profile drawings,construction drawings,structure list, material lists,and construction support.Project provided transmission of power from a wind generation development to sell power to Southem California Edison.Design of line met both GO-95 design criteria and LADWP requirements for a high wind design where lines paralleled LADWP lines.The project had an extremely tight schedule, requiring design to be performed while permitting and surveying tasks were not yet complete.Assumptions made during design process,later revised as information became available,permitted design to proceed with minimal increase in cost,while maintaining standards of quality and safety. GARY KUNICK POSITION: EDUCATION: EXPERIENCE: TRANSMISSION DESIGNER AA/1970/Civil Engineering Technology Mr.Kunick has more than 20 years of experience in all aspects of transmission and distribution line design and construction.His involvement ranges from project engineering to design and inspection.Mr.Kunick has set,poured,and inspected more than 10,000 transmission line foundations and tower assemblies.He has routed,surveyed,profiled,and spotted and engineered transmission lines from 57kV through S5O00kV.In addition,he has been responsible for preparing structure lists,material lists,and staking sheets.His project experience includes the following: 0 Puget Sound Power and Light Company,Whatcom No,1&2 115kVIissionUieProjects.Washingt Mr.Kunick was Project Engineer responsible for the analysis and design of approximately 24 miles of transmission line that was upgraded from 115kV to 230kV. He was responsible for performing analysis of structure types and high temperature conductors,as well as structure spotting,using POWER's computer resources including TLCADD software applications. ing-i i t Ww Wi , Mr.Kunick was Project Engineer responsible for structural analysis and design for an upgrade of 53 miles of 115kV transmission line.He performed structural analysis for the line's "wishbone”type wood poles and performed insulator swing and ground clearance calculations using TLCADD software.The entire line profile and actual structure locations were input into TLCADD,allowing items of concer to be identified on a structure by structure basis. Westford Flat 230kV Project,California Project Engineer for a 230kV transmission line for a geothermal power plant in The Geysers,California.The lattice-stee!l-structure line traversed rugged terrain,requiring 'helicopter construction for the structures and foundations.The line was designed, constructed,and energized within a four-month period,meeting the geothermal plant's production schedule." idway-k issi iforni Mr.Kunick was the transmission design engineer for this 230kV transmission line in central California.The line consists of wood-pole H-frame,tube-steel H-frame,and tube-steel single-pole structures.Use of the various structure types was required due to limited right-of-way and several SCE line crossings. |i 4 c issi Field Inspector for 31 miles of 345kV lattice tower construction for Western Area Power Administration.Throughout line construction as many as 16 inspectors were required to inspect foundation excavation,foundation concrete,foundation backfill,lattice tower assembly and erection,stringing,tree marking,line removal,and clearing and trimming. Mr.Kunick's responsibilities included verification of staking,digging,concrete inspection and testing and tower assembly. GARY KUNICK t,Ph L Californi As lead transmission engineer for this 45-mile 220kV steel pole project in Califomia, Mr.Kunick was involved in the design,spotting,structure count,structure list,structure drawings,plan &profiles,material list,and material count.Special attention was given to LADWP and SCE line crossings. Wh #:issi j hingt Mr.Kunick served as Project Engineer and Designer for five transmission lines designed for 230kV construction but operated at 115kV with 12.5kV underbuild.Responsibilities included TLCADD optimization,structure design,plans and profiles,material list and design of special tap structures. Puset P What #2.230/115kVT ission Li As Project Engineer/Designer of seven miles of 230kV design operated at 115kV,Mr. Kunick was responsible for TLCADD optimization,structure design,plan and profiles, material list,and loading for special steel pole structures. Douglas County PUD,Washington Project Engineer/Designer for nine miles of 115kV steel pole design.Responsibilities included surveying of centerline,steel pole design,structure drawings,performance drawings,plan and profile,and TLCADD spotting optimization. Zond Wind Park,220kVT ission Line.Californi Project Engineer/Designer responsible for P.I.locations and structure staking, performance drawings for steel poles,structure drawings,TLCADD optimization, material list and inspection of the project.Project involved 30 miles of design/construct of 220kV with the power being generated by more than 1,100 wind generation towers. Midstate Electric.115kW/24.9kVT ission Line.O Project Engineer/Designer for 16 miles of transmission line involving routing,survey, structure design,structure drawings,material list and TLCADD optimization of the line. Washinoton Water Power.115kV Lattice U le.Washinat Project Engineer/Designer responsible for the evaluation of an existing lattice line 16 miles in length and comparing the cost to building a new line of wood H-frame or single steel pole construction.The existing profile was optimized in TLCADD for wood and steel poles and compared to the reconfiguration cost for the lattice upgrade.The lattice upgrade option was chosen after analysis of the structure.The lattice structure option was shown to be $500,000 less in cost than any other option.To verify the structure capability,a full-scale load test was performed on an existing structure in the field.The load test was able to simulate all the load cases and exceed all loads before failing in the foundations.With the field tests completed,Washington Water Power agreed to rebuild the existing lattice structures with modifications using horizontal vee insulators and an AAC conductor. Design Report -lat PS Height Row Station No NO.Location (feb 0 @ 31690.82 1 6 32097.22 2 12 32395.08 3 16 32803.47 4 24°33146.62- 5 26 33330.75 6 40 =33050.757SO34603.74 8 65 34955.01 9 69 35204.76 10 05 492.10 1 95 054.65 12 108 1350.08 13 120 1067.2014130=2270.0015342002712.26. 16 PET]3156.99171649-3632.341817%4000.86 19 177 4300.00 20 18600)4719.40 21 194 9 4999.2722204=§432.5123209+=6065725.9824218=999.682s230«6342.9326240=801.3827247)(7067.85 Ahead (te) -24.33 Equation Line Angle Deg ™ 47 >=«645 a3 e 36 «645 -36 +3 ag 64? -12 -24 aa 36 7-13 +53 Se No.eoStruct. Type DOWORVEWONte416 Protected data BOLD/ITALIC &violations UNDERLINED Ine PONSEHHOHBHOEHHHHHHHOHTEHMHHNHHSStcucture Nane gcOa 70°SCT-HI 70*ScT-HI @0°SCT-HL 75°sct-Hl 70°ScT-HI SCDA SCDA 78°scT-HL @0°scT-H1 70°SCT-H1 acDa 80°SsCT-H1 Span ahead (fel 406.40 298.66 407.59 243.15 194.13 $28.00 542.99 $53.27 249.75 516.49 362.55 495.35 517.26 402.60 442.26 430.73 481.35 368.52 307.14 441.40 279.87 432.24 293.39 wWHd.70 343.33 459.37 266.55 6.00 wind Span tte) 123.36 Wt.Span Wt.Span We.Span Condn2 Condn}Condnl (fe) 323.59 370.49 $00.78 530.46 $05.46 363.41 349.91 265.67 $41.59 429.56 479.41 490.76 482.65 500.34 440.81 415.62 229.08 (feb 362.38 3808.25 659.48 696.6) 739.29 372.24 -208.07 103.10 636.67 450.05 $07.33 $47.24 463.19 544.99 453.22 397.07 42.15 304.91 496.70 718.54 95.09 317.74 433.56 245.313 295.69 752.49 257.43 26t.66 (fet -43.29 371.32 $15.03 $45.06 $16.39 363.04 133.467 276.60 $45.13 430,53 400.49 500.6) 400.391 509.78 440.6) 414.87 210.97 403.36 422.65 551.26 224.42 338.45 396.18 267.06 233.46 $91.02 372.62 261.69 Inal.Swing Condition 1 Min w/a -59.19 749.91 n/a Insl.Swing Condition 2 Min N/A Insl. Condition 3 Crit. Min N/A +25.49 -18.25 Max N/A 25.49 16.25 N/A M/A (fel 29.00 27.61 26.90 26.22 26.45 25.69 28.73 Swing Ground Clearance Location (fe 31936.01 32178.06 32595.98 32977.00 33296.62 33430.75 34208.75 34069.85 35070.90 234.98 672.52 918.59 1601.48 2129.94 2570.00 2862.26 3314.29 3096.94 4096.09 4601.78 4769.40 5199.27 $598.94 $825.90 6094.24 6646.00 6202.30 6.08 Cumul. Line Cost 10000 15100 20200 25400 30550 15650 45650 $6250 61400 71406 76600 61700 92000 100150 105350 110500 120500 125750 130900 138900 148900 154100 159250 169250 179250 194550 394650 204650 LHDISHSdSlL¥Od34NOISAG ATTACHMENT A SPOTTING AND PLAN &PROFILE SPECIFICATION The data that POWER requires to perform structure spotting and to develop plan and profile drawings for the project is specified below.POWER is assuming that GVEA will be responsi- ble for providing POWER the required data defined in this specification. 1.0 Profile 1.1 1.2 1.3 1.4 The profile shall have a scale of one inch equal to ten feet (1"=10')vertically and one inch equal to two hundred feet (1"=200')horizontally.There will be a mini- mum of one inch (1"),two hundred feet (200'along centerline)overlap between consecutive profiles.It's recommended that profile elevations be read along center- line at a maximum spacing of one hundred feet (100°),at every terrain break and all intersecting features. The Mapper shall provide three (3)profiles on each sheet,one (1)being the center- line profile and the other two (2)being twenty feet (20')each side of the project centerline.All owner required planimetric features,such as roads,railroads,creeks, highways,ditches,fences,power or telephone lines,etc.,shall be shown and identi- fied on both the plan and the profile.The location and height of the topmost conductor of all communication and power crossing of the project centerline shall be shown and plotted on the profile.The Mapper shall also provide electronic topographical data at 2 foot intervals from the centerline extending to 20 feet on each side.This data will be used to develop tower leg lengths after the spotting is completed.A suitable legend shall appear on the first plan and profile sheet. The Mapper shall provide the following profile data in ASCII format on five and one-quarter (5 1/4")or three and one-half (3 1/2")computer diskette so that is can be read into TLCADD for structure spotting. ¢Columns 2-10 Reference Line Stationing (without the "+) *Column 12-15 Deflection Angle Degrees (deflection angles to the "left"shallbeproceededwithan"-") Columns 16-18 Deflection Angle Minutes Columns 19-21 Deflection Angle Seconds Columns 24-30 Left Profile Elevation Columns 32-38 Center Profile Elevation Columns 40-46 Right Profile Elevation Columns 48-80 Description of Terrain (planimetric feature or PI number) The Mapper shall provide the profile data digitally in Intergraph format.Also,the Mapper shall provide one (1)paper copy set of the digital profile at the same time the digital profile datais provided on computer disk.The digital profile and papercopyprofilemustmatch. 2.0 3.0 1.5 1.6 1.7 POWER shall provide the Mapper with a sample profile drawing. POWER will be provided prohibitive zones by station to station where towers cannot be spotted. POWER will be provided specific tower locations by station for any special towers that have to be located at a specific location. Plan Compilation (Digital) 2.1 2.2 Planimetric information shall be provided digitally in Intergraph format by the Mapper.Horizontal scale will be one inch equal to two hundred feet (1"=200') horizontally. The Mapper shall include the following information:the centerline drawing with ticks at one thousand-foot (1,000')intervals;all PIs,POTs,other planimetric data required by owner. Plan &Profile Drawings 3.1 3.2 3.3 The Mapper shall combine the digital plan compilation with the digital profile data onto one (1)drawing in Intergraph format.The plan shall be located directly above the profile on each drawing. The Mapper shall provide one (1)copy set of plan and profile drawings to the Engineer at the time the digital plan and digital profile data is provided on comput- er disk. POWER shall provide a sample plan and profile drawing to the Mapper. END OF SPECIFICATION +N267780U0)lo]fo]So fo)5 2$bs MATCH LINE A -A E 816000 A™ w tas STR.*104 +o00gzz9z N +é 7]---fF/ /$38!7 - 'NELLIS zij CASA LOMA/AIR FORCE BASE S ESTATES NO.2ALASVEGASCOACHSALESlx!Z <el TR.9103 7]-P.S.M.2 ns P.S.M.PROPERTIES P.S.M.PROPERTIES 7 WASH S 0-16-09 w <|PROPERTIES Fa Ssot-EXISTING POWER LINE el s f : .a 3 3:e STR_°102 {!<"|}___)DA 8=STR.°94 STR.°95 STR.°96 | STR.°97 PI-27 NV 4 SLOAN LANE 60'R/W hy e lo .STR.*98 STR.°99 |STR.100 Y STR.101 ones 16L N 45-51-23 w a s f y il r42.5 ':x CLARK COUNTY -5 a Zo 7 $4975.56 S FLOOD CONTROL ra] >En 4l y 4,|=40°R/W <rs)"7 = -16-NELLIS ==Cis ”7-7-15916 ee FORCE Baser//,STR.#104 STR.#105 STR.106 _ 94 0-0-0 TP-69U 66.00 1861.38 51255 42 1927.50 .505.00 9 ¢i apieTA-69U1960ww51/00 96 NY ORF.Fo wey 51760.42 TP-69U 971900.93 51.00 0-0-qN442.00 1858.58 TP-6qu ds1940 =$2222.42 $1.00 :4-0-0 - 476.00 ;-69U 99p|52693.42 $1.00 0-0-0 1p0 101---1850.51 $20.41 TP-69U g-0-0 0-0-0 103 104 105 106-491.08 $3189.42 51.00 -69U TP-69U 42 0-0-0 0-0-0 0-040 106 |1920 L.B71.41 1812.34 1.00 51.00 \q2 P65 TP=591)FP Sty TP-49u482.00 53671.42 1808.52 1808.3 TESHU 51.00 51.00 51.00 510bU1863.36 4182.42 5467042 ah 00 1803.30 1804.31]1807.69 ott?511.00 1859.52 1859.31 1808.27 55276147 55860.36 56332.36 BON”56_88.00 302.94 ;1854.3)1855-31 1854.69 dy D1900LN_-$£373.36 SA3A 462.00 402 1854.17z48-49-27 FOGFy-i”ie ee aa 303.11 Lr) i 1880 =VAN A an_|Pott Bal NN -NN /1860 -]ee Oea a 1840 Pp ,--_]i eee _----_]1820 ------t||----KR |1800 L YY |N ma a - 1780 :EIALLON3120051400516005180052000$2200 52400 =52600»52800 + =«53000 «53200 «53400 ++«53600 53600 54000 54200 54400.54600 54800 55000 55200 55400 $5609 55800 56000 56200 56400 56600 REV.|ZONE REVISIONS OaTE_|BY jaPPO REFERENCE DRAWINGS ORAWN LDB {04/28 NEVADA COGENERATION ASSOC.2]uO8 NUMBER REV-|¢ A ISSUED FOR APPROVAL 04/28/92]Ruc |ruc |Tye [STRUCTURE ASSY OWGS {CHECKED |RUC}04/28/92 GLOVER BLACK MOUNTAIN 248044.01 §ISSUED FOR BIODOING 3 10_|PLAN AND PROFILE OWG V,epRovenl RIC |729%3940 cee one 69KV_TRANSMISSION LINE DRAWING NUMBER |ISSUED FOR CONSTRUCTION JAZ _|Des (OCT 12 [PLAN ANO PROFILE OwG SCALE?VERT:17=20°|malters Mego 63333 PLAN AND PROFILE 11 3AHORIZ:1°=200 = -iS TSOLDEN VALLEY ELECTRIC ASSOCIATION MC.Box 71249,Fairbanks,Alaska 99707-1249,Phone 907-452-7151 December 28,1993 Neil M.Reid R.W.Beck and Associates 2101 Fourth Avenue Seattle WA 98121-2375 Res:Request for Proposal -Healy to Fairbanks 230 kV Intertie Dear Mr.Reid: Golden Valley Electric Association,Inc.intends to contract with an environmental firm for the development of an Environmental Assessment with Scoping to meet the requirements of the National Environmental Policy Act (NEPA)in accordance with the policy and procedures of the Rural Electrification Administration (REA)per 7 CFR 1794,for the Healy to Fairbanks 230 kV Intertie.A copy of 7 CFR Part 1794 is provided as an attachment to this letter. The transmission line configuration will be mainly a X-tower design using weathering steel towers with suspension insulators and a short section of single pole design north of the Tanana River which will include provisions for one circuit of 7.2/12.5 kV three phase underbuild.A copy of the preliminary routing is enclosed for use in this proposal.The proposed transmission line has been divided into five links.It is proposed to construct the project in two link groups:Links 1,4,and 5 are proposed to be constructed in 1995 and the remaining link group consisting of Links 2 and 3 is proposed to be constructed in 1996.A small scale map has been included to delineate the various links. Healy Substation will be modified to provide an additional breaker to feed the transmission line and a new substation in the Fairbanks area will be added for the transmission line termination including a new Static Var System (SVS)or Battery Energy Storage (BES).One new substation will be added near Igloo,south of Cantwell,to include a new SVS for reactive compensation and modifications to Teeland Substation will be made for the addition of a new 100 MVA transformer and additional reactive compensationon the transformertertiary.Modification of the controls on the existing SVS is being reviewed for incorporation in this work. GOLDEN VALLEY ELECTRIC ASSOCIATION INC Neil M.Reid December 28,1993 Page 2 Request for Proposal The proposed scope of work is as follows: 1.Conduct an environmental investigation and research of available information for the alternate 230 kV transmission line routes according to the attached route map,two new substations,and modifications to two substations. 2.Participate in the public input and scoping process. 3.Prepare a Macro-Corridor Study and a Project Alternative Report for submittal to the Rural Electrification Administration per 7 CFR 1794. 4.Prepare a Draft Environmental Assessment for submittal to the Rural Electrification Administration per 7 CFR 1794. The scope of work was broken down into seven tasks which are: Project Administration Data Search and Review Macro-Corridor Study Project Alternative Report Draft Environmental Assessment Scoping Effort and Support Finalize Environmental Assessmentoooooo°oThe proposed tasks and responsibilities associated with task completion have been notated and are presented in the responsibility chart provided as an attachment to this letter.The responsibility chart is attached to illustrate specific responsibility sharing and is not intended to be a complete list of required duties. Completion date for all work and presentation of the draft EA, studies,and reports shall be June 1,1994.If alternative time frames are proposed,please address the proposed dates in yourproposal.It is anticipated that the final EA will be completed bymidtolateSeptember. A Digital Video Geographic (DVG)survey system will be used to collect data on route alternatives as an aid in the alternate comparisons and selection process.This data will be available to the selected consultant to augment other available data. Firms wishing to be considered should respond in the form of aproposalandstatementofqualificationsalongwiththeresumesofstaffavailabletosupportthework,man-hour breakdown for eachworkpacketlinkgroupsontheformprovided,cost breakdown on theformprovidedandappropriatefeeschedule,schedule to meet GOLDEN VALLEY ELECTRIC ASSOCIATION iNC. Neil M.Reid December 28,1993 Page 3 Request for Proposal proposed project schedule,firms ability to proceed with the work upon notice to proceed,sample of a similar project recently completed by the proposed project personnel,and a list of applicable local experience performed by the proposed project personnel.Project proposals will be evaluated on price and on the supplied information.Personal presentations are not necessary, however,if you have questions,don't hesitate to contact us. Proposal and information requested shall be sent to Golden Valley Electric Association,Inc.,Engineering Department,PO Box 71249, Fairbanks AK 99707-1249,and plainly marked "Proposal:Healy to Fairbanks 230 kV Transmission Line -Environmental."Letters of interest will be accepted until 5:00 p.m.,local time,January 10, 1994.The contract form will be that of the Golden Valley Purchase Order with Standard Terms and Conditions,a copy which is included in this letter. Sincerely, LB Steven Haagenson Manager of Engineering Services Enclosure:Route Map Purchase Order Terms and Conditions 7 CFR 1794 Cost Breakdown by Task and Link form Responsibility ChartMan-hour Breakdown per resource/task form DISTRIBUTION LIST FOR REQUEST FOR PROPOSAL HEALY TO FAIRBANKS 230 kV INTERTIE ENVIRONMENTAL ASSESSMENT WITH SCOPING Terra Nord Power Engineers B and B Environmental Woodward Clyde Consultants R.W.Beck and Associates ENSR Consulting and Engineering Dames and Moore CHM Hill HF138ENV.XLS ENVIRONMENTAL ASSESSMENT Cost Breakdown by Design Task and Links Project:Healy to Fairbanks 230 kV Intertie Task #Link # 1.0 PROJECT ADMINISTRATION 1-4-5 MH $ 2-3 MH $ 2.0 DATA SEARCH AND REVIEW 1-4-5 MH $ 2-3 MH $ 3.0 MACRO-CORRIDOR STUDY 1-4-5 MH $ 2-3 MH $ 4.0 PROJECT ALTERNATIVE REPORT 1-4-5 MH $ 2-3 MH $ 5.0 DRAFT ENVIRONMENTAL ASSESSMENT 1-4-5 MH $ 2-3 MH $ 6.0 SCOPING EFFORT AND SUPPORT 1-4-5 MH $ 2-3 MH $ 7.0 FINALIZE ENVIRONMENTAL ASSESSMENT 1-4-5 MH $ 2-3 MH $ 0.0 EXPENSES 1-4-5 $ 2-3 $ TOTAL LABOR AND EXPENSES i CONTINGENCY 10.00% GRAND TOTAL NTE.=====>| Page 1 HF138ENV.XLS ENVIRONMENTAL ASSESSMENT Responsibility Chart Project:Healy to Fairbanks 230 kV Intertie X =Primary Responsibility x =Minor Support RESPONSIBILITY Task #GVEA |ENV |OTHERS 1.0 PROJECT ADMINISTRATION 1.1 Project initiation meeting x X 1.2 Monthly Progress Reports X 1.3 Project Administration X 2.0 DATA SEARCH AND REVIEW 2.1 Review available Area Maps x Xx 2.2 Review available environmental studies and data 2.3 Local,State and Federal agency Coordination x X 2.4 Alternative Line Routing and PI selection X X 2.5 Field review line routing x x x 2.6 Final Route Map x x Xx 2.7 3.0 MACRO-CORRIDOR STUDY 3.1 Review existing corridor data x xX 3.2 Define corridor boundaries Xx xX 3.3 identify alternative routes within the corridor x X 3.4 Develop evaluation criteria X 3.5 Evaluate each identified link and sub-link X 3.6 Draft Macro-corridor study X 3.7 Finalize Macro-corridor study X 4.0 PROJECT ALTERNATIVE REPORT 4.1 Review existing data xX 42 Define project alternatives x Xx 43 Develop evaluation criteria X 4.4 Evaluate each identified alternative X 4.5 Draft Project Alternative Report xX 46 Finalize Project Alternative Report Xx 5.0 DRAFT ENVIRONMENTAL ASSESSMENT 5.1 Define affected environment X 5.2 _Determine if an Archeological Survey will be required X 5.3 Define Environmental Consequences X 5.4 Incorporate Alternatives xX 5.5 Produce draft for review and comments xX Page 3 HF138ENV.XLS ENVIRONMENTAL ASSESSMENT Responsibility Chart Project:Healy to Fairbanks 230 kV Intertie X =Primary Responsibility x =Minor Support RESPONSIBILITY Task #GVEA {|ENV |OTHERS 6.0 SCOPING EFFORT AND SUPPORT 6.1 Schedule public scoping meetings Xx 6.2 Conduct Scoping Meetings xX 6.3 Collect scoping meeting comments Xx 7.0 FINALIZE ENVIRONMENTAL ASSESSMENT 7.1 incorporate scoping meeting comments xX 7.2 Incorporate Archeological Survey report data X 7.3 Publish Final Environmental Assessment Xx 7.4 Submit EA to Rural Electrification Administration X 7.5 GVEA Board Resolution xX 7.6 FONSI xX Page 4 Project: Man-hour Breakdown per Resource /Task HF138ENV.XLS Healy to Fairbanks 230 kV Intertie |Unit$$$$$$ Project Manager Project Analyst Staff Clerical TOTAL COSTS PROJECT ADMINISTRATION 1-4-5 2-3 AjiDATA SEARCH AND REVIEW 1-4-5 2-3 MACRO-C 1-4-5 2-3 PROJECT 1-4-5 2-3 DRAFT ENVIRONMENTAL ASSESSMENT 1-4-5 2-3 SCOPING 1-4-5 2-3 FINALIZE ENVIRONMENTAL ASSESSMENT 1-4-5 2-3 ADORRIDOR STUDY ALTERNATIVE REPORT AiGAIS-_ EFFORTA ND SUPPORT AIAAIAA)AAAPage 5 Total MH=> geSengpoBPt.1788,Exh.B to Any Employee section and by substitut- ing the following: Cancellation as to any Employee Coverage for any Employee shall be deemed cancelled (a)immediately upon dis- covery by you,or by any of your partners or officers thereof not in collusion with such Employee,or by the Administration of any dishonest act on the part of such Employee (b)at 12:0]a.m.,standard tlme,upon the ef- fective date specified in a written notice served upon you and the Administration or sent by registered mall to you and the Ad- ministration. Crime General Provisions Form B.General Conditions: 1.Section 4 is replaced by the following:Duties in the Event af LossAfteryouortheRuralElectrification Ad- ministration of the United States of Amer- ica (the Administration)discover a loss or situation that may result in a loss of,or ices from damage to,Covered Property either you or the Administration must: a.Notify us as soon as possible. b.Submit to examination under oath at our request and give us a signed statement of answers. c.Give us a detailed,sworn proof of loss within four months. d.Cooperate with us in the investigation and settlement of any claim. Prior discovery of loss by you shall not affect the right of the Administration to notify us of loss,and to file proof of loss even though such prior discovery by you may have occurred more than four months prior to the discovery of the loss by the Ad- ministration. 2.Section 6 is replaced by the following: Legal Action Against Us:You or the Ad- ministration may not bring legal action agalnst us involving loss: a.Uniess all the terms of this insurance have been complied with.b.Until 60 days after proof of loss hasbeenfiledwithus. ec.Uniess brought within two years from the date the loss ls discovered by you or the Administration. 3.Section 16 Is replaced by the following: Territory:This insurance covers only acts committed or events occurring within the United States of America,U.S.Virgin Is- lands,Puerto Rico,Canal Zone,Guam,Mi- cronesia,or Canada. A new section 19 is added to read as fol-lows: Any action,approval or consent which by the provisions of this Policy is required to be taken or signed by the Administration shall be effective if taken or signed by the Administrator of the Administration or by his authorized representative. 7 CFR Ch.XVI (1-1-92 Edition) A new section 20 is added to read as fol- lows: Discovery by you shall be deemed to mean discovery by any officer or employee of the Insured not in collusion with the employee responsible for the loss discovered,and dis- covery by the Administration shall be deemed to mean discovery by any employee, agent or attorney of the Administration not in collusion with the employee responsibie for the loss discovered. C.General Definitions: "Employee”also includes non-salaried of- ficers and collection agents in your service. Common Policy Conditions A.Cancellation: 1.Paregraph.&la replaced by the follow-ing:We may cancel this policy by mailing ordeliveringtothefirstNamedInsuredandto the Administration written notice of cancel- lation at least: a.10 days before the effective date of can-cellation if we for payment of Premium;or b.30 days before the effective date of can- cellation if we cancel for any other reason, A new section G is added to read as fol- lows: G.Notices: 1.It is agreed that settlement of any claim under this Policy shall be made check or draft payable to you,but no settlement shall be made without prior written approv- al of the Administration.It is further agreed If you cancel this Policy,the Admin- istration may,within ten days after we re- ceive such notice from you,advise us that the cancellation notice is inoperative.In such case,coverage shall continue as if such notice of cancellation had never been sent. Notices,approvals,and requests by the pro- visions of this Policy shall be sent as fol- lows: a.To us,at our home office. b.To you,addressed to you at the city or town at which your principal office is locat- ed. ce.To the Administration,addressed to theRuralElectrificationAdministration,United States Department of Agriculture, South Bullding,Washington,DC,20250. EXHIBIT B-RURAL ELECTRIFICATION ADMINISTRATION JOINT INSURED This Endorsement applies to the CRIME GENERAL PROVISIONS FORM and all Crime Coverage forms forming part of the policy. PROVISIONS 1.Section 5.a of the the CRIME GENER- AL PROVISIONS FORM is amended by adding the following: 326 me om Lo!es OT a |a Rural Electrification Administration,USDA Payment by us will be made to the first named insured for the use and benefit of the insured sustaining the loas. 2.Section 5.b ls amended by deleting the period at the end thereof and adding the following: .except that in the case of a borrowing cor- poration from the Rural)Electrification Ad- ministration knowledge of any information relevant to this insurance shall be deemed knowledge of such information by the In- sured sustaining the loss. 3.Section 2.0 of the EMPLOYEE DISs- HONESTY COVERAGE FORM is replaced by the following: Immediately upon discovery by: CL)The Rural Electrification Administra- tion: (2)The borrowing corporation employing such "employee”;or (3)Any of the partners,officers or direc- tors of the Administration or the borrowing corporation not in collusion with the "em- ployee';of any dishonest act committed by that "employee”whether before or after be- coming employed by the borrowing corpora- tion. PART 1794-ENVIRONMENTAL POLI- CIES AND PROCEDURES FOR ELEC- TRIC AND TELEPHONE BORROW- ERS Subpert A-General Sec. 1794.1 Purpose. 1794.2 Actions requiring environmental review. 1794.3 Compliance. 1704.4 Trivial violations. 1794.8 Responsible officials. 1794.6 Metric units, 1794.7 Guidance. Subpert B-implementation of the National Environmental Policy Act 1794.10 Apply NEPA early in the planning process. 1794.11 Consideration of alternatives. 1704.12 Public involvement. 1794.13 Interagency involvement. Subpart C-Previsiens Applicable to EA or EIS Preparation 1794.20 Interagency coordination. 1794.21 Limitation on actions during the NEPA process. 1794.22 Tiering. Pr.1794 Sec. Subpart D-Classification of Proposals 1794.30 Control. 1704.31 Categorical exclusions (proposals normally requiring neither an EIS noranEA.)1704.32 Proposals normally requiring and EIS. 1794.33 Proposals normally requiring an Environmental Assessment without scoping. 1794.34 Proposals normally requiring an Environmental Assessment with scoping. 1794.35 Work plan proposals. Subpert E-Procedure for Categorical Exciusions 1794.40 General. 1794.41 Proposals with no BER. 1794.42 BER proposals. Subpert F-Precedure for Prepescis Normally Requiring an EIS 1704.50 Normal sequence. 1794.61 Preparation for scoping. 1794.52 Scoping meeting. 1794.53 Borrower's Environmental!Analy- ais. 1704.54 EIS. 1794.55 Timing of agency action. Subpert G-Precedure for Environmental Assessment Proposals Witheut Scoping 1794.60 General. 1794.61 Document requirements. 1794.62 Notice of availability.1794.63 FONSI and notice requirements.1794.64 Timing of agency action. Subpart H-Procedure fer Environmental Astosement Proposals With Scoping 1704.70 General. 1704.71 REA determination. 1794.72 Notice requirements for a FONSI determination. 1194.73 Timing of agency action forFONSIdetermination. Subpert I-Adeoption of Envirenmental Documents 1794.80 General. 1794.81 Adoption as a final EIS. 1794.82 Adoption as a draft EIS. 1194.83 Adoption of an EA.moa ea Adoption of environmental matert- 1704.85 Timing of agency action. Subpert J-Supplemental EIS 1794.90 Circulation and notices. 327 $1794.) Bec. 1794.91 Timing of agency action. Aprewptx A-PRocepurs FOR PROPOSALS WHiIcH NorMat_y Requirg an EIS Auruonity:National Environmental Policy Act of 1969 (NEPA)(42 U.S.C.4321 et seg.y;Council on Environmental Quality Regulations for Implementing the Proce- dural Provisions of NEPA (40 CFR 1500- 1508);Executive Order (EO)11988,""Fiood- plain Management”;and EO 11990,"Protec- tion of Wetlands”. Sounce:49 FR 9550,Mar.13,1984,unlesa otherwise noted. Subpart A-General $1794.1 Purpose. This part contains thé policies and procedures of the Rural Electrifica- tion Administration CREA)for imple- menting the National Environmental Policy Act (NEPA),as amended (42 U.S.C.4321 ef seg.);the Council on En- vironmental Quality (CEQ)Regula- tions for Implementing the Procedural Provisions of NEPA (40 CFR Parts 1500-1508);and certain related stat- utes,regulations and orders.Among those statutes,regulations and orders are the National Historic Preservation Act of 1966,as amended (16 U.S.C.470 et seg.);the Advisory Council on His- toric Preservation regulations on Pro- tection of Historic and Cultura!Prop- erties (36 CFR Part 800);the Endan- gered Species Act of 1973,as amended (16 U.S.C.1531 et seg);Executive Order (EO)11514,"Protection and En- hancement of Environmental Qual-ity';EO 11593,"Protection and En- hancement of the Cultural Environ- ment”;EO 11988,"Floodplain Man- agement”;EO 11990,"Protection of Wetlands”;and the Farmiand Protec- tion Policy Act (Pub.L.97-98). 81794.2 Actions requiring environmental review. The provisions of Part 1794 apply to proposed administrative actions by REA including,without limitation, loans,loan guarantees,reclassification of loan funds,len accommodations, and approvals provided pursuant to loan contracts and security instru- ments (e.g.,approvals of the use of the genera)funds). 7 CFR Ch.XVII (1-13-92 Edition) 81794.3 Compliance. The effective date of provisions con- tained in Part 1794 Is the date of pub- Neation of the final rule in the Frever- AL REcistTer.Any environmental docu- ment accepted or prepared by REA prior to the effective date may be de- veloped in accordance with the REA environmental requirements in effect at the time the document was accept- ed or prepared by REA. $1794.4 Trivial violations. It is the intent of this part that a trivial violation of its provisions will not give rig to an independent cause of action. $1794.5 Responsible officials. The agency contact points for envi- ronmental matters shall be the Assist- ant Administrator,Electric or Tele- phone (as appropriate);Rural Electri- fication Administration;U.S.Depart- ment of Agriculture;South Building, Washington,DC 20250.The Assistant Administrators,Electric and Tele- phone,are responsible for determining the proper definition of proposals and the need for the preparation and ap- proval of draft Environmental Impact Statements (EIS).Final EIS's will be issued and approved by the Adminis- trator. 91794.6 Metric unite. It is REA's policy to prepare envi- ronmental documents using.metric units with British system equivalents in parentheses.Environmental docu- ments prepared by or for an REA bor- rower (Borrower)should follow the same format. §1794.7 Guidance. For further guidance in the prepara- tion of notices and environmental doc- uments REA has prepared an REA Environmental Guide.A copy of this REA Environmental Guide is available upon request to the Assistant Adminis- trator,Electric or Assistant Adminls- trator,Telephone;Rural Electrifica- tion Administration;U.S.Department of Agriculture,Washington,DC 20250. 328 Rural Electrification Administration,USDA Subpart B-Implementation of the National Environmental Policy Act 91794.10 Apply NEPA early in the plan- ning process. The environmental review process requires early coordination with and involvement of REA.Borrowers should consult with REA at the earll- est stages of planning for any proposal which may require REA action.Since planning efforts and environmental evaluation for power supply facilities, including power plants,transmission lines,coal or other fuel development, are interrelated,these activities should take place within the same time frame. $1794.11 Consideration of alternatives. In determining what are reasonable alternatives,REA will consider a number of factors including,but not Mmited to,state of the technology, availability of resources and the time frame in which the identified need must be fulfilled. 81794.12 Public involvement. In carrying out its responsibilities under NEPA,REA shall make diligent efforts to involve the public in the en- vironmental review process through the following means: (a)REA notices required by Part 1794 shall be published in the FEepera. Recister and shall describe the nature,location and extent of the pro- posed actlon and Indicate the avail- ability and location of additional in- formation. (b)Borrower's notices,when re- quired by this part or otherwise re- quired by REA,shall consist of both a legal notice and a paid advertisement published in a timely manner in a newspaper or newspapers of general circulation in the counties in which the proposal will take place or such other places as REA determines.It shall generally describe the nature,lo- catlon and extent of the Borrower's proposal and indicate the availability and location of additional Information. If both the paid advertisement and legal notice appear in the same edi- tlon,the advertisement need not be lengthy and can refer the reader to the legal notice for a more detailed ex- §1794.12 planation.The Borrower shall consult with REA prior to issuance of Borrow- er's notices where an EIS or Environ- mental Assessment (EA)will be pre- pared. (c)The Borrower shall submit to REA,as soon as practicable after pub- lication,copies and publication dates of all Borrower's legal notices and paldadvertisementspublished.A copy of all comments received by the Borrow- er (including the Borrower's position, if any)concerning environmental as- pects of the proposal shall be provided to REA in a timely manner. (d)Public hearings or meetings may be held at reasonable times and loca- tions concerning environmental as- pects of a proposed action in all cases where,in the Assistant Administra- tor's opinion,the need for hearings or meetings is indicated in order to devel- op adequate information on the envi- ronmental implications of the pro- posed action.The following shall be required in connection with a meeting or a hearing: (1)Where an environmental docu- ment is the subject of the hearing or meeting,that document will be made available to the public at least ten (10) days in advance. (2)Any person,organization or gov- ermment body desiring to make a statement at the hearing or meeting may make such statement in writing or orally.Public hearings or meetings normally will be informa!and will gen- erally be confined to the environmen- tal aspects of the proposal. (3)REA notice shall be published at least thirty (30)days before the hear- ings or meetings.The Borrower's notice of the hearings or meetings shall be published at least ten (10) days but no more than thirty (30)days before the hearings or meetings.REA shall determine the counties in which the Borrower's notice shall be pub- lished in newspapers of general circu- lation to assure that persons most likely to be affected by the proposa) will be made aware of the hearings. The notice shall present the date, time,location and purpose of the hearing or meeting.If an environmen- tal document is the subject of the hearing or meeting,the notice shall 329 aweersagTASallFerteIfe§1794.13 inform the public where it can be ob-tained or is available for review.(e)A list of REA administrative ac-tions for which EIS's and EA's arebeingpreparedorcontemplatedwillbeavailableforpublicinspectionatREA's offices in Washington,DC. 1794.13 Interagency involvement. In carrying out Its responsibilitiesunderNEPA,REA shall,to the extentpracticable,coordinate its environmen-tal review and combine its meetingsandhearingswiththoseofotherFed-eral,state and local agencies.The Bor-rower shall inform REA of potentialinvolvementofotheragenciesintheproposalattheearliestpracticabletimetofacilitatesuchcoordination. Subpart C-Provisions Applicable toEAorEISPreparation $1794.20 Interagency coordination. (a)Whenever practicable,REA willencouragetheuseofaleadagencyinpreparationofanEISorEAsothatasingledocumentandreviewprocesswillcoverallFederalagencyactionsarisingfromtheproposalordirectlyrelatedgroupofproposals.It is thepolicyofREAtovolunteertoactasleadagencyinthepreparationofan EA or EIS when the Borrower s0 re-quests,and when REA would normallyprepareanEAorEISfortheproposal.(b)Where REA acts as a cooperatingagency,REA shall rely upon the leadagency's procedures for implementingNEPAandCEQregulationsinthepreparationandissuanceofanEAorEIS,unless the lead and cooperatingagenciesagreetoamodificationof these procedures.(1)REA shall request that the lead agency indicate that REA is a cooper-ating agency in all NEPA related no-tices published for the proposal.In ad-dition,REA shall request that the leadagencypermitREAtoreviewandcom-ment on the EA or draft and final EIS prior to issuance.(2)The Borrower shall inform REAinatimelymannerofitsInvolvementinaproposalwhereanotherFederalagencyispreparinganEISorEAtopermitREAtoadequatelyfulfillitsdutiesas&cooperating agency. 7 CFR Ch.XVII (1-1-92 Edition) (c)Where practicable and in order toeliminateduplicationanddelay,REAwillcoordinateitsNEPAprocesswith state and local environmental proce-dures.Where state or local agenciescontrolsitingofelectrictransmissionlinesorelectricgeneratingstations,REA shall consult and coordinate withthosestateandlocalagenciesindeter-mining what are the reasonable siting and route alternatives. 1794.21 Limitations on actions during the NEPA process. In determining which Borrower ac-tivities related to a proposal requiringdevelopmentofanEAorE1SmaybeapprovedpriortocompletionoftheNEPAprocess,REA must determine, among other matters that: (a)The activity will not have an ad- verse environmental impact.For ex- ample,purchase of water rights,op-tioning or transfer of land title,orcontinueduseoflandashistorically employed will not have an adverse en-vironmental impact.However,site preparation or construction at or neartheproposedsite(e.g.,rail spur)or de-velopment of a related facility (e.9.,opening a captive mine)normally willhaveanadverse'environmental impact.(b)The expenditure is "minimal.” To be minimal the expenditure: (1)Must not exceed the amount of loss which the borrower could absorb without jeopardizing the government'ssecurityinterestintheeventthepro-posed project {s not approved by theAdministrator,and (2)Must not compromise the objec- tivity of REA's environmental review.Notwithstanding other considerations, expenditures up to 10 percent of theproposedprojectcostnormallywillnotcompromiseREA's objectivity. $1794.22 Tiering. It is REA's policy to tier EIS's and. EA's where: (a)It is practicable,and (b)There will be a reduction of delay and paperwork,or where betterdecisionmakingwillbefostered. (49 FR 0550,Mar.13,1084;49 FR 10083, Mar.19,1984) 330 Rural Electrification Administration,USDA Subpart D-Classification of Proposals $1794.30 Control. For environmental review purposes, REA has Identified and set forth cate- gories of Borrower proposals.A Bor- rower or Borrowers may propose to participate with other parties in the ownership of a project where the Bor- rowers do not have sufficient control and responsibility to alter the develop- ment of the project.In such a case the proposal!will be considered a categori- cal exclusion regardless of the catego- ry into which the proposal would oth- erwise be included.Where the Borrow- ers propose to cumulatively own 5 per- cent or less of a project,the proposal will normally be considered a categort- cal exclusion.Where the Borrowers propose to cumulatively own 33%per- cent or more of a project,the proposal will be treated in its usual category. Where the Borrowers propose to cu- mulatively own more than 5 percent but less than 33%percent of a project, REA will determine whether the Bor- rowers have sufficient control and re- sponsibility to alter the development of the project.Consideration will be given to such factors as:(a)Whether construction would be completed re- gardless of REA financing assistance: (b)the stage of project planning and construction;(c)total Borrower par- ticipation;(d)participation percentage of each utility In the project;and (e) managerial arrangements and contrac- tual provisions. 91794.31 Categorical exclusions (propos- ala normally requiring neither an EIS nor an EA). (a)Borrower proposals that do not individually or cumulatively have a significant effect on the environment and do not normally involve signifi- cant unresolved conflicts concerning alternate use of available resources,do not require an EIS or EA.In order to provide for extraordinary circum- stances,such proposals may require development of a Borrower's Environ- mental Report (BER)or the equiva- lent. (b)Certain types of Borrower pro- posals do not require a BER.Proposals of this type are subject to the require- §1794.31 ments of §1794.41.Proposals within this classification are: (1)Purchase of land where use will remain unchanged. (2)Routine approvals made pursu- ant to loan and security documents (eg.,contracts for bulk commodities, fuel,goods and services,capital credit retirements,technical specifications). (3)Agreements for transmission, wheeling,interconnection with,power purchase from,or sale to other utili- tles where no associated Borrower con- struction or financing of construction {is involved. (4)Additional or substitute financ- ing assistance for proposals which have previously recelved environmen- tal review and approval from REA, provided that environmental consider- ations have not changed. (5)Rehabilitation or reconstruction of roads,railroad tracks,roadbed, bridges and other transportation fa- cilities within transportation rights-of- way or generating facility sites where there is no substantial increase in use. A description of the rehabilitation or reconstruction shall be provided to REA. (6)Primary fuel or mineral contracts where,considering all the facts and circumstances,the Borrower does not have effective control over or responsi- bility to alter the development of the specific fuel or mineral source (e.g., mine). (7)Changes or additions to existing substations or switching stations or ex- ternal changes to buildings or smal} structures requiring new physical dis- turbance or fencing of less than 0.4 hectare (0.99 acre).A description of changes and additions shal)be provid- ed to REA. (8)Internal modifications or equip- ment additions (e.g.,computer facili- ties,relocating interior walls)to small structures or bulldings. (9)Internal or minor external changes to electric generating or fuel processing facilities and related sup- port facilities where there is negligible impact on the outside environment.A description of the changes shal!be provided to REA. (10)Ordinary maintenance or re- placement of equipment or small 331 ae eee zou dé :Yt 2 ee PF ee Sl §1794.31 structures (e.g.,line support struc- tures,microwave facilities,valves). (11)The construction of telephone and communication lines and cables at existing power related facilities sites. (12)Supervisory control and data ac- quisition systems (SCADA)and energy management systems involving no new external construction. (13)Testing work (e.g.,test borings or cores,water test wells). (14)Studies and engineering under- taken to define a proposal or alterna- tives sufficiently so that environmen- tal effects can be assessed. (16)The construction of electric power lines within an existing substa- tion,switching station or electric gen- erating facility site.A description of the facilities to be constructed shall be provided to REA. (16)Contracts for certain items of equipment which are part of a propos- al for which REA ts preparing an EA or EIS,and which meet the limita- tions on actions during the NEPA process set forth in §1794.21 (e.g.,long lead time items such as turbines or bollers). (11)Internal REA administrative ac- tions (e.g.,personnel actions,procure- ment)and REA bulletins that do not concern environmental matters or sub- stantial facility design,construction or maintenance practices. (c)Certain types of Borrower pro- posals normally require Borrower sub- mission of a BER or its equivalent. Proposals of this type are subject to the requirements of §1794.42.Propos- als within this classification are: (1)The construction of electric power lines and associated facilities designed for or capable of operation at a nominal)voltage of either: (i)Less than 69 kV (ow side)or (i)Less than 230 kV Gow side)if both: (A)No more than 40 kilometers (24.85 miles)of power line are in- volved,and (B)Substations and switching sta- tions require new physical disturbance or fencing of no more than 2 hectares (4.94 acres)at any single site nor more than 4 hectares (9.88 acres)for all aites. 7 CFR Ch.XVII (1-1-92 Edition) (2)The construction of electric power lines where less than 5 kilome- ters (3.11 miles)of line are involved. (3)The construction of telephone and communication Ines,cables and facilities. (4)The construction of other small structures or buildings such as micro- wave facilities,cooperative headquar- ters,maintenance facilities,etc.,in- volving no more than 2 hectares (4.94 acres)of physical disturbance or fenc- ing. (5)Participation by a Borrower(s)in any proposed project where total Bor- rower financial participation in the underlying project will be five (5)per- cent or leas.; (6)Purchase of existing facilities or @ portion thereof where use or oper- ation will remain unchanged and which presently are in compliance with environmental laws and regula- tions. (1)Additional bulk commodity stor- age (e.9.,coal,peat,lignite,limestone, etc.)within existing generating station boundaries. (8)SCADA and energy management systems which require new external construction. (9)Reconductoring or upgrading of existing telephone or power lines where either the same or substantially equivalent support structures at the approximate existing support struc- ture locations are used. (10)Proposals designed to reduce the amount of pollutants released Into the environment (eg.,precipltators, baghouse or scrubber installation,coal washing plant and equipment)which have no other environmental !mpact outside of the existing facility site. (11)Changes or additions to existing substations or switching stations or ex- ternal changes to buildings or smal) structures requiring 0.4 hectare (0.99 acre)or more but no more than 2 hec- tares (4.94 acres)of new physically dis- turbed land or fenced property. (12)Construction of diesel electric generating facilities of less than 3 megawatts (MW)(nameplate rating) at an existing generating site.All new associated facilities and electric power lines related to the generating propos- al shall be covered in the BER. 332 Rural Electrification Administration,USDA (13)Modification of an existing hy- droelectric project or dam that will have a total installed capacity of 1.5 MW (nameplate rating)or less and which will result in no change in the normal maximum surface area or normal maximum surface elevation of an existing impoundment.All new as- sociated facilities and electric power lines related to the generating propos- al shall be covered in the BER. $1794.32 Proposals normally requiring an EIS. (a)Actions that may significantly affect the quality of the human envi- ronment require preparation of an EIS.An EIS normally will be required in connection with Borrower proposals for construction and operation of the following types of facilities: (1)New electric generating facilities of 40 MW or more (nameplate rating) other than diesel generators or com- bustion turbines.All new associated facilities and electric power lines relat- ed to the generating proposal shall be covered In the EIS. (3)A new mining operation when the Borrower or Borrowers have effec- tive control (eg.,dedicated mine or purchase of a substantial portion of the mining equipment). (b)Proposals of this type are subject to the requirements of §§1794.50 to 1794.55. $1794.33 Proposals normally requiring an Environmental Assessment without scoping. (a)REA will normally prepare an EA for all proposals which are neither categorical exclusions (§1794.31)nor are proposals normally requiring an EIS (§1794.32).For certain actions within this class,scoping and docu-ment procedures set forth =in$4 1794.50 to 1794.53 shall be followed (see §1794.34).The following are ex- amples of specific Borrower proposals which normally require an EA without scoping. (1)Construction of combustion tur- bine and diesel generating facilities of less than 40 MW (nameplate rating), except for diesel generating facilities of less than 3 MW (nameplate rating) at an existing generating site.All new associated facilities and electric power §1794.33 lines related to the subject generating proposal shall be covered in the EA. (2)Construction of any other type of new electric generating facilities of less than 5 MW (nameplate rating). All new associated facilities and elec- tric power Ines related to the subject generating proposal shall be ccvered in the EA.i (3)Modification of an existing hy- droelectric project or dam if: di)The project or dam will have a total installed capacity of more than 1.5 MW (nameplate rating);or di)The modification will result in a change in the normal]maximum sur- face area or normal maximum surface elevation of an existing Impoundment. All new associated facilities and elec- tric power lines related to the generat- ing proposal shall be covered in the EA (4)The expansion of a mining or drilling operation or a new drilling op- eration. (5)Purchase of existing facilities or a@ portion thereof which are presently in violation of Federal,state or local environmental laws or regulations. (6)The construction of electric power lines and 'related facilities de- signed for or capable of operation at a nominal voltage of 230 kV or more (low side)not covered by §1794.31 (categorical exclusions)or §1794.34qnormallyrequiringanEAwithscop-@). (1)The construction of electric power lines and related facilities de- signed for or capable of operation at a nominal voltage of 69 kV or more (low side)but less than 230 kV (low side) where: ()More than 40 kilometers (24.85 miles)of power line are involved or (ii)Substations and switching sta- tions require new physical disturbance of fencing of more than 2 hectares (4.94 acres)at any single site or more than 4 hectares (9.88 acres)for all sites. (8)Proposals designed to reduce the amount of pollutants released Into the environment which may have other environmental impacts outside of the existing facility site. (9)Issuance of REA regulations con- cerning environmental matters or sub- 333 ee ee ee ee eSus,andLaresWoeeeamerASHRey1AteSreePteeoneetoed§1794.34 stantial facility design,construction or maintenance practices. (b)Proposals of this type are subject to the requirements of §§1794.60 to 1794.64. 01794.34 Proposals normally requiring an Environmental Assessment with scop- ing. (a)There are certain actions which require the use of a scoping procedureinthedevelopmentofanEA.After the scoping process is completed and an acceptable Environmental Analysis has been submitted by the Borrower, REA will determine whether to pre- pare an EIS or finding of no signifi-cant impact (FONSI).The types of proposals falling within this category are: (i)The construction of electric power lines and related facilities de- signed for or capable of operation at a nominal voltage of 230 kV or more (ow side)where: d)More than 40 kilometers (24.85 miles)of power Hine are involved;or (il)Substations and switching sta- tions require new physical disturbance or fencing involving a total of more than 2 hectares (4.94 acres)at any single site or more than 8 hectares (19.77 acres)for all sites. (2)Construction of combustion tur- bines and diesel generators of 40 MW (nameplate rating)or more;and the construction of any other type of elec- tric generating facilities of 5 or more MW but less than 40 MW (nameplate rating).All new associated facilities and electric power lines related to the subject generating project shall be covered in any EA or EIS prepared. (b)Proposals of this type are subjecttotherequirementsof§§1794.70 to 1794.73. $1794.85 Work plan proposals. Borrowers frequently request financ- ing assistance for a number of relative- ly minor unrelated projects all of which are described in a single "work plan.”In determining the proper envi- ronmental classification of construc- tion projects contained in a work plan, REA will consider as a single proposa) all related construction Included in the work plan and any additional con- struction related thereto which,al- aq eter as bes owls tmgp a a ee ee 7 CFR Ch.XVII (1-1-92 Edition) though not included in the work plan, is reasonably foreseeable. Subpart E-Procedure for Categorical Exclusions $1794.40 General. The following procedure,which ap- plies to action classified as categorical exclusions in §1794.31 hereof,provides REA with information necessary to determine if the proposed action meets the criteria for a categorical ex- clusion.Where,because of extraordi- nary circumstances,an action may have a ajgnificant effect on the qualityofthehumanenvironment,REA may require additional environmental doc- umentation. $1794.41 Proposals with no BER. Normally the Borrower shall not submit a BER for proposals included in §1794.31(b).However,if so noted in §1794.31(b)the Borrower shall submit a description of the proposal].Such de- scription shall include,where applica- ble,a plan for erosion and sedimenta- tion control.No public notice is re- quired unless the proposal!Is located in and may affect wetlands or flood- plains. $1794.42 BER proposals. For proposals included _in§1794.31(c)the Borrower normally shall submit a BER or Sts equivalent which will assist REA in identifying extraordinary clrcumstances in which a normally excluded action may have a significant environmental effect.No public notice is required unless the proposal is located in and may affect wetlands or Noodplains.REA shall not permit construction or other activities which would have an environmental effect until it has received,reviewed and accepted an adequate BER. Subpart F-Procedure for Proposals Normally Requiring an EIS 9 1794.50 Normal sequence. Appendix A to Part 1794 (Procedure for Proposals which Normally Require an EIS)describes the norma)sequence of EIS preparation to be employed by 334 --= Rural Electrification Administration,USDA REA.For proposals normally requir- ing an EA with scoping (see §1794.34), the NEPA process shall proceed in the same manner as for proposals normal- ly requiring an EIS through the point at which the Environmental Analysis is submitted (see §1794.53).After the Environmental Analysis has been sub- mitted,REA shall make a judgment to prepare either an EIS or a finding of no significant Impact (FONSD. $1794.51 Preparation for scoping. (a)REA has developed a general ap- proach to the NEPA process,including scoping,for proposals normally requir- ing an EIS (§1794.32)and for propos- als normally requiring an EA with scoping (§1794.34).Scoping proce- dures are designed to determine the scope of issues to be addressed and to identify significant issues related to a proposed action.REA may require scoping procedures to be followed for other proposals where appropriate to achieve the purposes of NEPA. (b)As soon as practicable,REA will publish its notice of intent to prepare an EIS (see 40 CFR 1508.22).The Bor- rower shall publish,in a_timely manner,a notice similar to REA's notice.If the proposal is one which normally requires an EA with scoping ($1794.34),the notice shall indicate that:(1)REA may prepare an EA before or without necessarily prepar- ing an EIS,and (2)the decision whether or not to prepare an EIS will be based on information received from the Borrower,Federal,state and local agencies,organizations and the gener- al public during the scoping process, preparation of the Environmental Analysis,and the review period for a finding of no significant impact (if originally issued). (c)As part of the early project plan- ning the Borrower should consult with expert and interested Federal,state and local agencies to inform them of the proposed project,and to identify permits and approvals which must be obtained and administrative proce- dures which must be followed. (d)Before any scoping meetings are held REA shall require the Borrower to submit two environmental docu- ments: (1)Alternative evaluation; §1794.52 (2)Siting study (for electric genera- tion or new mines)or Macro-Corridor study (for electric transmission). (e)The Borrower {!s encouraged to hold additional public information meetings in the general location of the proposed project and any reasonable alternatives when such borrower meet- ings will make the scoping process more meaningful.A written summary of the comments made at such meet- ings should be submitted to REA as soon as practicable after the meetings. $1794.52 Scoping meeting. (a)Both REA and the Borrower shall publish a notice of the public scoping meeting which shall: (1)Provide a brief description of the nature and location of the Borrower's recommended alternative (if any)and reasonable alternatives; (2)State the intent to hold public scoping meetings,giving the date, time,location and purpose of these meetings; (3)State where copies of the scoping documents are available for public review,which shall include the Bor- rower's headquarters,REA offices in Washington,and other locations as de- termined by REA; (4)Provide the name and address of the person to whom questions and comments should be sent; (5)Set forth a thirty (30)day period after the scoping meeting(s)to enter comments Into the meeting record. (b)The REA notice will be pub- lished at least thirty (30)days prior to the meeting(s).The Borrower's notice shall be published at least ten (10) days,but not more than thirty (30) days prior to the meeting(s). (c)The scoping meeting(s)will nor- mally be held in the vicinity of the Borrower's recommended alternative and,where appropriate,the reasona- ble alternatives or such other places as REA determines will best afford an opportunity for public involvement. Any person,organization or govern- ment body desiring to make a state- ment at the meeting may make such statement in writing or orally.A record will be made of the scoping meeting. 335 iaae -pe§1794.53 (ad)As soon as practicable after the scoping meetings(s),REA,as lead agency,shall determine the significant issues to be analyzed in depth and identify and eliminate from detailed study the issues which are not signifi- cant or which have been covered by prior environmental review.REA will develop a proposed scope for further environmental study and review.A copy of this proposed scope will be sent to cooperating agencies and the Borrower,which shall be given thirty (30)days to comment on Its adequacy and emphasis.After expiration of the thirty (30)day period REA will pro- vide formal guidance to the Borrower concerning the scope of environmental study to be performed and informa- tion to be gathered. 6179453 Borrower's environmental anal- ysis. (a)After scoping procedures have been completed,REA shall require the Borrower to develop and submit an Environmental]Analysis satisfactory in form and substance to REA.The Envi- ronmental Analysis will be prepared under the guidance of the REA staff and all information set forth therein shall be subject to independent verifi- cation by REA. (b)The Environmental Analysis will normally provide a basis for prepara- tion of REA's EA or EIS and may be made an appendix to the REA docu- ment.After REA has reviewed and found an Environmental Analysis to be satisfactory,the Borrower will be required to provide REA with a suffi- clent number of copies of the Environ- mental Analysis to satisfy REA's dis- tribution plan. (c)The Environmental Analysis shall include a summary of the con- struction and operation monitoring and mitigation measures for the pro- posed project.This summary shall appear in the draft and final EIS. These measures may be revised as ap- propriate in response to comments on the draft and final EIS and other in- formation.These measures also shall be incorporated by summary or refer- ence into REA's Record of Decision. n .1 "q 'ao 'Be ee ee ee ae Ee ee eee Peer on ee ee ee 7 CFR Ch.XVII (1-1-92 Edition) $1794.54 EIS. (a)After a draft or final EIS has been prepared,REA and the Borrower shall issue a notice of availability for the document.The notice shall: (1)Provide a brief description of the nature and location of the preferred and reasonable alternatives; (2)State the avallabillty of a draft or final EIS for public review; (3)State how copies of the EIS can be obtained and where copies are available for public review which shall include the Borrower's headquarters, REA offices.in Washington,DC,se-lected libraries in the area of the pre- ferred and reasonable alternatives and such other reasonable places as REA shall select; (4)Provide the name and address of the person to whom questions and comments should be sent; (5)Set forth the time period for review and comment.This time perlod normally shall be forty-five (45)days for a draft EIS and thirty (30)days for a final EIS,measured from the date that the U.S.Environmental Protec- tion Agency's notice or the Borrower's notices are first published,whichever is later. REA and the Borrower notices for the final EIS shall also request persona, organizations or governmental bodies which wish to be notified when the Record of Decision is available to inform REA of such interest. (b)In addition to circulation re- quired by 40 CFR 1502.19,draft and final EIS's (or summaries thereof,at REA's discretion)shall be circulated to the appropriate state,regional,and metropolitan clearinghouses. (c)Where a final EIS does not re- quire that substantial changes be made in the draft EIS,REA may docu- ment required changes through errata sheets,insertion pages and revised sec- tions to be incorporated into the draft EIS.In such cases,REA will circulate such changes together with comments on the draft EIS,responses to com- ments,and other appropriate informa- tion,as its final EIS.REA will not cir- culate the draft EIS again,although the draft EIS will be provided !f re- quested within thirty (30)days of pub- 336 Rural Electrification Administration,USDA lication of notice of availability of theftna)EIS. (d)In individual situations,uponmutualagreementbetweenREAand the Borrower,the EIS may be pre-pared by an independent contractor.If REA acts as lead agency,the contrac- tor will be chosen by REA.Under thisprocedure,the Borrower normally willnotberequiredtosubmitanEnviron- mental Analysis. (49 FR 0550,Mar.13,1984;49 FR 10083,Mar.19,1984) G 1794.55 Timing of agency action. (a)Where an REA action requiresanEIS,REA shall prepare a Record ofDecision.The Record of Decision will not be prepared,and REA will not take any action or execute commit-ments before expiration of the thirty(30)day period starting with eitherEPA's notice in the FeperaL REGISTERthatthefinalEIS1savailableortheBorrower's notices of availability,whichever is later. (b)For budgetary purposes some fi-nancing assistance may be approvedconditionallywithastipulationthatnofundswillbeadvanceduntilaRecordofDecisionhasbeenprepared. Subpart G-Procedure for Environ- mental Assessment ProposalsWithoutScoping $1794.60 General. The following procedure applies toallactionsclassifiedasEnvironmentalAssessmentprojectsin§1794.33hereof.Where appropriate to carryoutthepurposesofNEPA,REA mayrequire,on a case by case basis,thatadditionalactionbetakeninconnec-tion with preparation of an EA.If at any point In the preparation of an EA,REA determines that the action willhaveasignificantimpactontheenvi- ronment,the preparation of an EISwillberequiredandtheproceduresapplicabletheretowillbefollowed. 6179461 Document requirements. For those proposals covered by§1794.33,the Borrower shal)submit aBERoritsequivalent.The BER mayserveasREA's EA if REA makes anindependentevaluationoftheenviron- §1794.63 mental issues and concurs in theBER's scope and content.The BERalsomaybemadeanAppendixtoREA's EA to provide iaformation ontheproposalandreduceunnecessarypaperwork. §1794.62 Notice of availability. The Borrower shall publish a publicnoticeofavailabilityoftheBER.(a)The Borrower's notice shall: (1)Provide a brief description of thenatureandlocationofitsrecommend-ed and reasonable alternatives;(2)State the availability of the BERforpublicreview; (3)State how copies of the BER canbeobtainedandwherecopiesareavailableforpublicreview,which shallincludetheBorrower's headquarters,REA offices in Washington,D.C.,andotherlocationsasdeterminedbyREA;(4)Provide the name and address ofthepersontowhomquestionsand comments should be sent: (5)Set forth a thirty (30)day timeperiodforreviewandcomment.(b)The Borrower's notice shall bepublishedafterREAhasdeterminedthattheBERprovidesaSatisfactorybasisforpubliccomment. (49 FR 9550,Mar.13,1984;49 FR 10083,Mar.19,1984] $1794.63 FONSI and notice requirements. (a)If REA,after reviewing the EA,finds that the proposal will not haveasignificanteffectonthehumanenvi-ronment,REA shall prepare a FONSI.After the FONSI has been made,REAshallpublishanoticeofavailabilityoftheEAandFONSI.The Borrowershallhavepublished,in a timelymanner,a similar notice. (b)Both the REA and Borrower'snoticeshall: (1)Provide a brief description of thenatureandlocationofthepreferredandreasonablealternatives: (2)State that an EA and FONSIhavebeenprepared; (3)State how copies of the EA andFONSIcanbeobtained,and wherecopiesareavailableforpublicreviewwhichshallincludetheBorrower'sheadquarters,REA offices tn Wash-ington,and other locations as deter-mined by REA; 337 §bm gg band te i, §1794.64 (4)Provide the name and address of the person to whom questions and comments should be sent. (c)REA shall not permit construc- tion or other activities which would have an environmental effect until {t has received,reviewed and accepted an adequate BER and the public notice requirements in paragraphs (a)and (b)of this section have been met. 81794.64 Timing of agency action. REA may take its final action on proposals requiring an EA without scoping (§1794.33)at any time after publication of the REA and Borrower notices that a FONSI has been made. Subpart H-Procedure for Environ- mental Assessment Proposals With Scoping 01794.70 General. For those proposals covered by §$1794.34,REA and the Borrower shall follow the procedures for scoping and the requirements for notices and docu- ments set forth in §§1794.50 through 1794.53 of Subpart F,"Procedure for Proposals Normally Requiring an EIS.” 61794.71 REA determination. After the scoping process and receipt of an acceptable Environmental]Anal- ysis,REA shall make a Judgment as to whether or not REA's action will be a major Federal action significantly af- fecting the quality of the human envi- ronment.If a significant effect Is evi- dent,REA shall continue with the procedures in §§1794.54 through 1784.55 of Subpart F,"Procedure for Proposals Normally Requiring an EIS.”If a significant effect is not evi- dent,REA shall develop and prepare an EA and FONSI. $1794.72 Notice requirements for a FONSI determination. If REA prepares a FONSI for a pro- posal covered by §1794.34,REA and, in a timely manner,the Borrower shall publish notices of availability of the EA and FONSI.The EA and FONSI shall be made available for public review and comment for at least thirty (30)days,and the REA and 7 CFR Ch.XVII (1-1-92 Edition) Borrower notices shall solicit public comments.Additional REA and Bor- rower notice requirements are includ- ed in §1794.63. $1794.73 Timing of agency action for FONSI determination. REA may take its final action at any time after expiration of the thirty (30) day period measured from the date of publication wf the REA notice in the FeperaL Recistrr.Normally REA shall walt thirty (30)days after publl- cation of the Borrower's notice before taking a final action. 'Subpart l-Adoption ofEnvironmentalDocuments €1794.80 General. Where Borrowers participate in projects for which other agencies have already prepared an EIS or EA,REA will adopt the existing EIS or EA con- sistent with the provisions of 40 CFR 1506.3. 8179481 Adoption as a final EIS. (a)If REA acted as a cooperating agency,the lead agency's EIS may be adopted as a final EIS without recircu- lation if REA has reviewed the com- ments received on the final EIS and concluded that comments and sugges- tions have been adequately considered. (b)If REA was not a cooperating agency but determines that another Federal agency's EIS is adequate it will adopt the EIS as its final EIS. (1)REA and the Borrower sha)!pub- lsh a notice stating REA's adoption of the EIS and independent determina- tion of its adequacy.The notices are governed by §§1794.12 (general)and 1794.54(a)(EIS). (2)If the adopted EIS is generally available,REA will circulate its writ- ten finding that the adopted EIS meets the standards for an adequate EIS.The adopted EIS shall be made available to interested parties upon re- quest. (3)If the adopted EIS ts not general- ly available,REA will circulated its written finding that the adopted state- ment is an adequate EIS,along with either the adopted EIS or a summary thereof in accordance with 40 CFR 338 ee een eee eevee Se eee Rural Electrification Administration,USDA 1502.19.The adopted EIS shall be cir-culated in the same manner as a finalEIS(see §1794.54(b)). €1794.82 Adoption as a draft EIS. Where REA determines that an ex-isting Federal EIS requires additionalinformationtomeetthestandardsforanadequatestatementforaproposedREAaction,REA may adopt all or aportionoftheEISasapartofItsdraftEIS.The circulation provisionsof§1794.54(b)for draft and finalEIS's apply.The general notice provi-sions (§1794.12)and notice provisionsforEIS's (§1794.54(a))apply. 1794.83 Adoption of an EA. REA may adopt a Federal!EIS or EAoraportionthereofasitsEA.REAshallmaketheEAavailableandassurethatnoticetsprovidedinthe same manner as if REA had preparedtheEA. 6 1794.84 Adoption of environmental ma- terials. REA may adopt environmental doc- uments or portions thereof preparedbyFederal,state or local agencies orotherpartiesindependentlyofthere-quirements of NEPA.REA may adoptsuchmaterialsintoitsenvironmental]documents.REA will circulate theadopteddocumentasapartofitsenvi-ronmental assessment or draft andfinalEISinthesamemannerasifpre-pared by REA. 61794.85 Timing of agency action. Where REA has adopted anotheragency's environmental documents,the timing of the REA action shall besubjecttothesamerequirementsasif §1794.91 Res had prepared the required EA or Subpart J-Supplemental EIS $1794.90 Circulation and notices. (a)A supplement to a draft or finalEISshallbeprepared,circulated andgivennoticebyREAandtheBorrowerinthesamemanner(exclusive of scop-ing)as a draft and then final EIS (see§1794.54). (b)Normally REA and the BorrowershallhavepublishednoticesofintenttoprepareasupplementtoafinalEISinthosecaseswhereaRecordofDeci-sion has already been Issued. (c)REA,at its discretion,may issueaninformationsupplementtoafinalEISwhereREAdeterminesthatthepurposesofNEPAarefurtheredbydoingsoeventhoughsuchsupplementisnotrequiredby40CFR1502.9(¢)(1).REA and the Borrower shall Publish anoticeofavailability.The notice re-quirements shall be the same as for afinalEISindicatedin§1794.54(a).Theinformationsupplementshal)be circu-lated in the same manner as a finalEIS(see §1794.54(b)).REA shall takenofinalactiononanyproposedmodi-spation arsed in the informationsupplementuntilthirty(30)days aftertheREAnoticeofavailabilityispub-lished or thirty (30)days after theBorrower's notice is published,which-ever occurs later. $1794.91 Timing of agency action. F dining of REA's action shall be sub-ect to the same requirements as appltoatypicalEIS.pry 339 SwalPt.1794,App.A 7 CFR Ch.XVII (1-1-92 Edition) Appendix A Procedure for Proposals Which Normally Require an eis |---Alternative Evasion Process --| o €o F Gie8.6 Cc.o =i Ge A °°° F Geé8Mdc0€* |Sang Study Process | Enwsonmental Analysis Process Diagram Legend On-going activity in the EIS processB.Cc,D.Discrete events in the Siting BtudyandEnvironmentalAnalysispathB,,C,Discrete events in the AlternativeEvaluationpath As the diagram Illustrates,there will betwoseparatebutinterrelatedatudyprocess-es leading to the preparation of the EIS.One process B,through H,will examine al-ternatives to bullding a generating (or trans-mission or new mining)facility.The otherprocess,B through H will examine a rangeofpotentiallyacceptablesitesforagenerat-ing (or transmission or new mining)facility.In order to facilitate long-range planningandreducedelays,a Borrower may under-take preliminary evaluations of alternativemeansofprovidingpowerandbegintheatudyofarangeofpotentiallyacceptablesitesforageneration(or transmission ornewmining)facility before demonstrating &need for the proposal.However,the obliga-tton to show a need for the proposal willstillremainbeforeREAfinancingassistance can be obtained. H. H ©sn steno prose stare WeenarteLyreSntovmeenna see cana ual spacing between points on the dia-nen ig not meant to suggest equal time in-tervals.Where two letters are the same(except for subscripts),generally the two in-dicated events should occur within the sametimeframe.For BD and B.D,,this is onlytruewheretheBorrowerinitiatessiteselec-tion at a time when there is &specific needtobefilled.For major transmissionprojects,events occurring with reference totheMacro-Corridor Study are analogous tothegenerationandminingSitingStudypro- usothe flow diagram is intended to Indicatethenormalsequenceofeventsalthoughgomevariancemaybeacceptableinindivid-val cases if good cause is demonstrated.However,in all instances REA shall assurethattherequirementsoftheNEPAandCEQregulationsarefulfilled. Discrete Events A:The Borrower presents to REA the un-derlying needs which form the basis of itaproposal.REA undertakes for electric gen-eration proposals,when necessary,the prep-aration or update of the power require- 340 Se ee nee ee Fe { re Rural Electrification Administration,USDA ments study (PRS)utilizing REA proce- dures.For electric generation and transamis- sion and mining proposals,the need for the proposal shall be presented in the draft and final EIS's (or EA,as applicable). B and B,:The Borrower consults with REA on the procedures and general param- eters for the Siting Study and on potential alternative ways to meet the need,including guidance on preparing the Alternative Eval- uation.Consultation may be initiated even if a apecific need has not been identified. BC:Work is performed on the Siting Study by the Borrower and/or consultant. This includes "macroanalysis”in which gen- eral criteria,literature search and consulta- tion are used to identify a reasonable range of potentially acceptable sites. Borrower/consultant contact Soll Conser- vation Service (8CS),U.S.Environmental Protection Agency (EPA),U.S.Fish and Wilidilfe Service (FWS),U.S.Army Corps of Engineers (COE),Federal land use agencies and state agencies for early guidance and input. As soon as practicable during this period, REA publishes its "Notice of Intent”in the PenrraL Reoister and the Borrower pub- lishes similar information in local newspa- pers of general circulation.©(See41704.51(b)). B,C,:Borrower does research and consul- tation,contacts other utilities,etc.,to deter- mine whether there are reasonable alterna- tives to a new generating (or transmission or mining facility).The Alternative Evaluation should include discussion,as appropriate,of joint projects,alternate fuels,alternate energy sources,conservation,etc.Alterna- tives eliminated from detailed study should be identified and reasons given for the elimination.The Borrower should also indl- cate which alternatives are reasonably avail- able to it if its recommended alternative is hot approved. C and C,:Borrower submits draft of Siting Study and Alternative Evaluation to REA for review.REA reviews each draft for major flaws.If such flaws are not present, REA submits both the draft Siting Study and Alternative Evaluation to potentially involved Federal]and state agencies (includ- ing,but not limited to,all agencies invited to the field investigation)for review and comment. D and D,:REA invites other Federal and state agencies to make a field investigation of potentially acceptable siting areas dis- cussed in the draft Siting Study and critique the study methodology,and point out po- tential problems with these alternative siting areas.The Borrower at this time pre- sents site and nonsite specific alternatives included in the Siting Study and Alternative Evaluation to these agencies for their com- ments.Participating agencies may critique alternative means of meeting the need and ie i]iaee Sa) Pt.1794,App.A point out potential problems with alterna- tive siting areas.The agencies set up a strat- egy for conducting the scoping process and tentatively identify the lead and cooperat- ing agencies for the EIS. DE:Federal agencies are given the oppor- tunity to comment on the potentially ac- ceptable alternatives to point out fatal flaws.During this stage the Borrower may secure land,water or other critical factors for potentially acceptable sites by option or other means (subject to the limitations in §1794.21).If REA's notice of intent and the Borrower's notice did not give the date and time of the scoping meeting,scoping meet- ing notices are published now. E and E,:Scoping meeting(s)is held to re- ceive input from the public,interested par- ties,and Federal,state and local officials and agencies.Among the topica open to dis- cussion are r ble alternatives to meet the need,potentially acceptable sites,par- ticipation projects or conservation,signifi- cant issues to be addressed in the EIS,and the need for the project. EF:Borrower submits revised Siting Study (or addenda if appropriate)to REA for review after revising it to reflect input from scoping meeting(s).REA consults with cooperating agencies on the scope of the EI8 and gives the Borrower guidance on scope of the Environmental Analysis.Bor- rower prepares the draft Environmental Analysis which includes a fatal flaw study of potentially acceptable sitea and a "mi- croanalysis”in which detalled fleld work is conducted on the Borrower's recommended site(s).The Borrower continues consultation with REA and other interested Federal, state,and local agencies,and the public,and reflects their comments in the Environmen- tal Analysis. D,F,:Borrower updates and expands,as necessary,the Alternative Evaluation on the basis of comments received from Feder- al,State and local officials and agencies, input from participants at the scoping meeting(s),the general public and new de- velopments (eg.,negotiations with other electric power utilities),REA provides guid- ance to the Borrower during this period based on cooperating agency and public input. F and F,:The Borrower submits draft En- vironmental Analysis to REA for review and comment.If the draft Environmental]Anal- ysis has no readily apparent critical flaws, REA distributes copies of the Environmen- tal Analysis to cooperating agencies for review.Borrower submita Alternative Eval- uation,which has been updated after the scoping meeting,and also Includes new al- ternatives,if any,which have developed. REA submits updated Alternative Evalua- tlon to requesting cooperating agencies.The Environmental Analysis may incorporate 341 a _f}ee an any Tew ,oa et Se Loon. Ld el ee el a Sngu cee Lee |Sy ee Lene el a ns =,eeevd'7 Pt.1794,App.A 7 CFR Ch.XVIl (1-1-92 Edition) tf :fod ends on draftaiternativeEvaluationleadingto&K:Public comment perbagieierreviewdocument.EIS.This date may be extended In certain we.FG and P,G::REA and cooperating agen--_instances.why cles independently evaluate,for accuracy,KL:REA (and cooperating agencies,as ap-bs scope and content,the information submit:propriate)review comments received on"ay ted to them.REA collates responses and draft EIS and responds,by modifying alter--reconciles them with the Borrower.REA naetives,developing alternatives not previ-CHAPTER XVIII-FARMERS HOME Cea)may begin writing the draft EIS at this ously given sufficient consideration,supple-point.menting,improving or modifying the analy-H and H.:REA Borrower submits,ss ap ses,etc.A final EIS or supplemental draft ADMI NISTRATION ' propriate,@ final revised Enviro tal EIS is prepared,as appropriate,with coop-Analysis and Alternative Evaluation 1 crating agencies'assistance.DEPARTMENT OF AGRICULTURE .M:Record of decision ts issued.REA willptandHid:REA ide pe iets the in.take no final action on any loan guarantee,formation therein before use in the EIS,¢t..sooner than 30 days after issuance ofDuringthistime,REA prepares the draft the final Federal EIS.EIS,utilizing the borrower-supplied data,MN:Implementation of mitigation meas-meansaeeOokashts-' ;dJtearnwencyexpertise,and other informe other Federale state,'and'iocal waeencies SUBCHAPTER A-GENERAL REGULATIONS ee J:REA lasues draft EIS for public review during construction and operation of the ge and comment publishing notice of availabil-project.Part PagefityInthePapraalReistea.1804 [Reserved] "A!1806 IMSUTANCE j......csesscccsesosscrscsecsscsssssssssensessessosaceccssneeeees were 345a1807Titleclearanceandloanclosing(removed and re- gy!SETved EFF.1-30-92)..........sscssecsossrrssssscsecsessersecsesees 363 a 1809 Appraisals cosseessscesoeece 373 i 1810 Interest rates,terms,conditions,and approval au-4 *CNOTILY 000...escsescsesecseccenscssccsncesssesscescerssecessasvessnsasees 382 { SUBCHAPTER B-LOANS AND GRANTS PRIMARILY FOR REAL ESTATE PURPOSESteDe"ae|1822 Rural housing loans and grants............cccccccsssssscccccenee 384 1823 Association loans and grants-community facili- ties,development,conservation,utilization..........396 SUBCHAPTER C-(RESERVED}) SUBCHAPTER D-GUARANTEED LOANS 1841 General Provisions ..............cccccsccccccccccssonsscececerensssecce we.407 1843 Farmer lOANS ..........cccccssssssssvacssscsccecccecccnscsscscececseaeee ceveees 414 1845 FmHA emergency livestock line of credit guaran- TOES.....cccccccccccsccccccecnecceecsccsscsssscsscsccccecccccesscescecceenseseeesece 415 SUBCHAPTER E-ACCOUNT SERVICING 1863 Real estate tax Servicing ..............cccccccccccscccccsccececccrseees 432 1864 (Reserved)Pr:einSenASSMaedat=Pa342 .343 311-021 O-92---12 -ereymwie GOLDEN VALLEY ELECTRIC ASSOCIATION,INC.(GVEA) Purchase Order-Terms and Conditions PRICE/QUANTITIES:The price or prices and quantities stated on the face of this purchase order shail be firm and fixed except as altered with written approvat of GVEA''s purchasing agent.The price stated shall include federal,state and local taxes uniess otherwise expressly provided. ACCEPTANCE OF ORDER:This purchase order confirms a contract between the parties on the terms of this purchase order and any other relevant document(s)as listed on its face.By acceptance of this purchase order and/or performance here- under,Seller agrees to comply fully with the terms and conditions of saie set forth on both the front and reverse sides of this document,and any supplements hereto which are incorporated by 8 referance herein.Acceptance of this purchase order must be made on its exact terms and if additional or different terms are proposed by the Seller,such response will constitute a counteroffer and no contract shall come into existence without GVEA's written consent to the counteroffer.Seiler represents that all goods supplied are free and clear from all claims and liens of any nature whatsoever.Nothing in this order or acceptance shall be construed to makeSelleranempioyeeoragentofGVEA.This purchase order together with any relevant documents or attachments to it constitutes the entire agreement between the parties.Any deviation from this agreement must be accepted in writing by GVEA. INSPECTION AND ACCEPTANCE:Final inspection of goods and services shalt be upon GVEA's premises uniess otherwise agreed in writing.Any acceptance of goods is subject to inspection within a reasonable time after receipt.Payment of the invoice does not constitute inspection or acceptance of materiais covered by the order,and GVEA reserves the right to inspect the goods before payment.if, upon inspection,any goods are found to be unsatisfactory,defective,or of inferior quality or workmanship,or fail to meet the specifications furnished or the re- Quirements stated in the purchase order,GVEA may return such goods to Seller at the Seller's sole risk and expense,including the cost for handling and transport- ation,inspection,and any other charge connected with noncompliance of the purchase order. SHIPPING:All shipments and routing shall comply with the directions on the face of this purchase order or,in the absence of specific shipping instructions,goods shail be shipped FO8 destination via the most economical means availabie.All transportation,shipping and forwarding charges must be prepaid unless other- wise indicated on the purchase order.GVEA reserves the right to refuse any and ail shipments with collect charges.Seller shail notify GVEA of shipments within sufficient time to permit GVEA to arrange for unloading,and any claim for de- murrage resulting from Seller's failure to comply shail be paid by the Seller.Selier shail bear the risk of timety delivery of shipments in route.The risk of loss shail *remain with the Seller unti!delivery of goods into GVEA's possession at desti- nation,subject to Seiler responsibility for adequate packaging. WARRANTY:The Seller warrants articles supplied on this purchase order to conform to specifications stated herein and to be fit and sufficient for the purpose manufactured,of good material and workmanship,and in the absence of other applicable express or implied warranty specifying a longer period,free from defects for a minimum period of twelve (12)months from delivery to GVEA.This warranty shail survive any inspection,delivery or acceptance of the goods or services,or payment therefore by GVEA.Seller further warrants that Seller shail comply with the requirements of all applicable federal,state and local laws,rules, ordinances and regulations,such as,but not limited to OSHA,Hazardous Materiais Transportation Act,Toxic Substances Control Act and Consumer Product Safety Act. CHANGES/CANCELLATION:GVEA may require changes to this order at any time and written modification shall be made as necessary with allowance for increased cost,date of delivery,or other matters affected by the change(s). GVEA may,at it's option,cancel any unshipped merchandise previously ordered, subject to the obligation to pay for merchandise shipped prior to cancellation.If the 'purchase order covers merchandise manufactured or fabricated to specifications of GVEA,Seller shall discontinue ali performance on the subject matter,except as otherwise directed,immediately upon receiving notice of such cancellation.In the event of such cancellation,and providing Seller is not in default,GVEA shall pay to Seller: a)The cost incurred by Seller in connection with this order prior to notice of cancellation;or b)Such other costs,including cancellation charges under subcontract,as GVEA may have approved. The tota!cancellation payment,plus previous payments,shail not exceed the total price of this order.Upon such payment,at GVEA's option,title to any materiais or uncompleted merchandise shall pass to GVEA. REMEDIES/WAIVER:Time is of the essence of this order,and in the event that pertormance or delivery is not timely,GVEA reserves the right to cancel,purchase elsewhere,and/or hold Seller accountable for resulting costs and damages in- curred.Seller shall promptly notify GVEA of any event that threatens to delay performance or delivery. Any waiver by GVEA of any breach or default shall not be deemed continuing orapplicabletootherbreachordefault. 8.THIRD PARTY CONTRACT/ASSIGNMENT:Neither this order nor any rights and 10. 11. 12. 13. 14. 15. 16. 17, obligations under it shall be assigned or contracted to third parties by Seiler without the prior written consent of GVEA.GVEA shail promptly be furnished with written notice and a signed copy of any assignment.Any claim for payment by Assignees shall be subject to those defenses and set-offs which GVEA may have against Seller.Selier shail insure that any third party contract andor assignment shall incorporate the provisions of this order by specific reference hereto. INDEMNIFICATION:Seller shall indemnify GVEA for any loss,claim,damages, liability,expense (including reasonable attorney's fees)of any cause of action whatsoever arising out of any act or omission of the Seller,its agents,employees or subcontractors.Seiler shail maintain such public liability,property damage,em- ployee liability and compensation insurance as to protect GVEA from any said risks and from any claims under any applicable workers'compensation and occu- pational disease acts. GVEA reserves the right to require that it be named as an additional insured onSeller's insurance policies,that certificates of such insurance coverage be fur- nished upon request and that such additional insurance as it deems necessary be provided. The Seller agrees to defend,at its expense,GVEA and GVEA's employees,or any others using the product of GVEA,and hoid them harmiess,with respect to any and all claims that the products or materials furnished by the Seiler under this order infringe any United States and/or foreign patent,trademark,copyright and/or other property right of third parties. BUY AMERICAN:Seiler shall adhere to the "Buy American”requirement of REA Bulletin 43-9.Any deviations from this requirement must be approved in writing by GVEA's purchasing agent. LABOR AGREEMENTS:It is understood and agreed that the Seller shail abide by GVEA's project labor agreements if work at the jobsite is required in this order. SERVICES:Seller and GVEA understand and agree that all "services”con- templated by this agreement and provided by Seller to GVEA shal!have the same complete and entire meaning as the word "goods”in application of the Uniform Commercial Code.All warranties as provided for by application of the Uniform Commercial Code,including implied warranties of merchantabililty and fitness foraparticularpurpose,shall apply to any and all services provided by Seller to GVEA as provided for in this agreement.Any and al!other warranties,whether written or oral,statutory,express or implied,provided by Seiler to GVEA shali apply to the services specified in this Agreement. FEDERAL LAWS,ORDERS AND REGULATIONS:GVEA and all subcontractors, vendors,and suppliers agree and certify that they shail comply with the re- quirement of all pertinent federal laws,orders and regulations inctuding but not limited to Executive Order 112461,as amended,and the regulations at 41 CFR 60-1 through 60-60,at 41 CFR 60-250 and 60-741 and Sections 38 USC 2012/503. CHOICE OF LAW:Any civil action arising from this purchase order shail be brought in the Fourth Judicial District for the State of Alaska.The laws of the State of Alaska shail govern the rights and the obligations of the parties under this purchase order. LOBBYING DISCLOSURE:Any contract or subcontract which exceeds $100,000 shall comply with Federal Law,which governs this contract,and requires that all contractors and any subcontractors comply with the following: No Federal appropriated funds have been paid or will be paid,by or on behaif of the undersigned,to any person for influencing or attempting to influence an officer or employee of any agency.a Member of Congress,an officer or employee of Congress,or an employee of a Member of Congress in connection with theawardingofanyFederalcontract,the making of any Federal grant,the making of any Federal loan,the entering into of any cooperative agreement,and the exten-sion,continuation or renewal,amendment or modification of any Federal contract, grant,foan or cooperative agreement. If any funds other than Federal appropriated funds have been paid or will be paid to any person for influencing or attempting to influence an officer or employee of any agency,@ Member of Congress,an officer or employee of Congress,or an em- ployee of a Member of Congress in connection with this Federal contract,grant, loan,or cooperative agreement,the undersigned shall complete and submit Stan- dard Form-LLL,"Disciosure Form to Report Lobbying,”in accordance with its instructions. By acceptance of this contract with GVEA,you are certifying that you are in compliance with this federal requirement.If you are required to compiete StandardForm-LLL,"Disclosure Form to Report Lobbying,”you must submit this form toGVEAatthetimethiscontractisenteredinto. WAIVER OF RIGHT TO FILE LIENS:Seller hereby agrees not to file any mechanics', laborers',or materiaimen's lien or other lien against any GVEA premises or any part thereof on account of any services or goods furnished under this order or anyadditionsoraddendatothisorder.Seller hereby waives the right to file any suchlien,and shall,if requested,execute a waiver of lien in recordable form in favor of GVEA and the premises.Seller shail insure that any third party contract and/orassignmentshaliincorporatetheprovisionsofthispurchaseorderbyspecific reference to these terms and conditions. SEVERABILITY:The invalidity in whole or in part of any condition of this purchaseordershailnoteffectthevalidityoftheotherconditions.The remedies reserved in these terms and conditions shall be cumulative and additional to any remedies in law or equity. meee SU en oeTe GOLDEN VALLEY ELECTRIC ASSOCIATION INC.Box 71249,Fairbanks,Alaska 99707-1249,Phone 907-452-1151 January 17,1994 Mike Kelly Intertie Participant's Group State of Alaska Alaska Industrial Development and Export Authority 480 West Tudor Road Anchorage AK 99503-6690 Recommendation of Environmental Assessment with Scoping Proposals HEALY TO FAIRBANKS TRANSMISSION INTERTIE Dear Mike: Golden Valley Electric Association,Inc.Engineering Departmentrequestedproposalsforthesupplyofenvironmentalservicesfrom seven consultants.We have completed evaluation of the submitted proposals and would like to offer a recommendation for acceptance of the Dames and Moore proposal. The attached evaluation form was created for the four proposals received to allow for a fair comparison based on experience, ability to perform,man-hour effort,and price.Of all the proposals,Dames and Moore was felt to provide the best value and realistic view of the tasks to be performed. The selection of Dames and Moore was effectively based on price as all the proposers were felt to have good qualifications, experience,and available staff.The following shows the ranking for the environmental assessment work based on price alone: Proposer Environmental Dames and Moore B &B Environmental CH2M Hill FPE/Roen Engineers BmWDHReWould you please review the evaluation forms.The Dames and Moore proposal is attached for your review.If you need additional information or would like to review any other proposals,please call me at (907)451-5647.The environmental firms are anxiously awaiting announcement of our selection and notice to proceed to allow for commencement of work on this critical path item. Sincerely, LG: Steven Haagenson,P.E. Manager of Engineering Services HF138ENE.XLS 11-Jan-94 Transmission Line Proposal Evaluation Healy to Fairbanks 230 Kv Intertie Transmission |ine Environmental Assessment Total Proposers General Local Schedule/Staffing Man-hours Projected Cost Comments Experience Experience (ability to start to per proposal of Firm By the Proposed soon and maintain Complete including 10 % Team schedule)Project Contingency Dames and Moore,Inc.good good good $52,216.00 Willing to conduct scoping meetings? $5,221.60 728 $57,437.60 B&B Environmental good good good $90,835.00 Willing to conduct scoping meetings? $9,083.50 May reduce costs if maps not needed for the Marco Corridor Study 1,338 $99.918.50 CH2M Hill good good good $121,195.00 Willing to conduct scoping meetings? $12,119.50 1,329 $133,314.50 FPE/Roen Engineers,Inc.good good good $166,705.00 Willing to conduct scoping meetings? $16,670.50 Local Fairbanks firm Easy Access 2,599 $183,375.50 numerous copies for review by GVEA,agencies and public Page 1 HF138ENE.XLS 11-Jan-94 Transmission Line Proposal Evaluation Healy to Fairbanks 230 Kv Intertie Transmission line Environmental Assessment 1.00 2.00 3.00 4.00 5.00 6.00 7.00 0.00 Admin Data Macro Proj.Draft Scoping Final Expense Man Costs per|Review _Study Alt.EA EA EA Hours Proposal Dames and Link 1-4-5 28 56 58 46 132 40 64 424 Moore,Inc.MHs &Costs $2,452 $3,324 $3,752 $3,1300 $8,270 $3,246 $4,272 $2,100 $30,546.00 Link 2-3 24 40 40 36 88 28 48 304 MHs &Costs $2,072 $2,400 $2,506 $2,412,$5,408 $2,256 $3,216 $1,400 $21,670.00 728 $52,216.00 B&B Link 1-4-5 32 48 164 134 184 46 48 656 Environmental MHs &Costs $2,080 $2,800 $11,185,$9,490 $12,400 $2,680 $2,960 $1,851 $45,446.00 Link 2-3 16 48 209 169 160 32 48 682 MHs &Costs $1,040 $2,800 $1 4,235,$11,940x $9,340 $1,990 $2,960 $1,084 $45,389.00 *1,338 $90.835.00 CH2M Hill $0.00 Link 1-2-3-4-5 149 188 141 42 597 108 104 1,329 MHs &Costs $11,960 $15,080 $11,575 $4,400 $47,520 $9,260 $7,950 $13,450 $121.195.00 1,329 $121.195.00 FPE /Roen Link 1-4-5 94 226 183 217 311 234 243 1508 Engineers,Inc.MHs &Costs $5,510 $12,660 $9,925 $11,575 $16,865 $12,870 $12,825 $15,000 $97,230.00 Link 2-3 68 164 131 156 226 170 176 1,091 MHs &Costs $4,000 $9,190 $7,105 $8,300 $12,270 $9,350 $9,260 $10,000 $69.475.00 2,599 $166,705.00 o Will evaluate only GVEA route alternatives x Will evaluate alternatives for meeting energy needs other than the line. *Includes detailed terrain,permafrost,slope,geology,vegetation maps Page 2 Proposal to Provide Environmental Services for the Healy to Fairbanks 230kV Intertie Prepared For:| Golden Valley Electric Association Inc. Box 71249 , Fairbanks,Alaska 99707-1249 |Prepared By: DAMES &MOORE,Inc. 5600 B Street,Suite 100 Anchorage,Alaska 99518 January 1994 23#DAMES &MOORE 5600 B STREET,SUITE 100,ANCHORAGE,ALASKA 99518-1641 (907)562-3366 FAX:(907)562-1297 January 10,1994 Mr.Steven Haagenson Manager of Engineering Services Golden Valley Electric Association,Inc. Post Office Box 71249 Fairbanks,AK 99707-1249 Proposal: Healy to Fairbanks 230 kV _Transmission Line Environmental Services Dear Mr.Haagenson: Dames &Moore,Inc.is pleased to provide Golden Valley Electric Association,Inc.with our proposal to provide environmental services for the Healy to Fairbanks Intertie Project. Dames &Moore's Anchorage office was established in 1970,and is currently staffed with over thirty personnel.In 1991,we expanded our Alaska presence by opening our Fairbanks office. Staffed primarily by long-term residents,our Alaska offices offer senior professionals with substantial experience in aquatic and terrestrial biology,wetland resources,land use planning, socioeconomics,public involvement programs,and environmental permitting and regulatory compliance. Dames &Moore,through our Alaska office and our other offices worldwide,has the professional depth,technical knowledge,available capacity ,and overall capability to provide the necessary environmental services to Golden Valley Electric Association in a timely,cost- effective manner.Dames &Moore has provided environmental and engineering services to Golden Valley Electric Association on eleven projects between 1972 and 1992.We look forward to renewing and continuing our relationship with Golden Valley Electric Association by providing our services to you on this project. Please feel free to contact me at 562-3366 if you have any questions or would like any additional information or clarification regarding the information we have presented in this proposal.I look forward to hearing from you in the near future. Sincerely, DAMES &"L Ock.INC. .Hayward,ManagerfrGans|Environmental Operations PROPOSAL TO PROVIDE ENVIRONMENTAL SERVICES FOR THE HEALY TO FAIRBANKS 230 kV INTERTIE FOR GOLDEN VALLEY ELECTRIC ASSOCIATION,INC. Prepared by DAMES &MOORE 5600 B Street,Suite 100 Anchorage,AK 99518 January 10,1994 TABLE OF CONTENTS Section itle 1.0 INTRODUCTION 2.1 General 2.2 Alaska Operations 2.3 Environmental Assessments and NEPA Experience 3.0 TECHNICAL CAPABILITIES AND RELEVANT PROJECT EXPERIENCE .... 3.1 Introduction 3.2 Dames &Moore Technical Capabilities 3.2.1 Environmental Assessments/Environmental Impact Statements 3.2.2 Terrestrial and Aquatic Biology 3.2.3 Social and Cultural Resources 3.2.4 Public Participation Processes 3.2.5 Permit Acquisition and Regulatory Compliance 3.2.6 Geotechnical Services 3.2.7 Project Management 3.3 Relevant Project Experience 3.3.1 Copper Valley Intertie Environmental Analysis 3.3.2 Tyee -Swan Intertie Environmental Analysis 3.3.3.Seward Transmission Line Upgrade Environmental Assessment Ce Ce ee Ce Pe) Ce | ee | er 3.3.4 Joint Military Training Exercises (JTX)Environmental Impact Statement .......20...ee ww ee ew we ee ee ee ee ee es 3.3.5 Northeast Intertie Environmental Report 4.0 TECHNICAL APPROACH 4.1 Introduction 4.2 Task 1:Project Management 4.3 Task 2:Review of Existing Environmental Studies ll ee ee) ee ©©©©©ee ew ee TABLE OF CONTENTS Section Title |4.4 Task 3:Macro-Corridor Study 5.0 Introduction...2...ee te eee 5.1 Project Manager .........cee ee ee eee 5.2 Key Technical Staff...2.ee eee 5.3 Other Dames &Moore Personnel ...............02 0000 TABLES TABLE 1 Dames &Moore's Recent NEPA Experience in Alaska APPENDICES APPENDIX A Previous Relevant Experience APPENDIX B Sample Tables of Contents APPENDIX C Curriculum Vitaes for Key Personnel iv 4.5 Task 4:Project Alternative Report ...........0..20000008 4.6 Task 5:Draft Environmental Assessment ..............-0- 4.7 Task 6:Public Scoping Meetings ..............0.0000008 4.8 Task 7:Final Environmental Assessment .............0.02- er TABLE 2 Sample Evaluation Criteria ...0......ee eee eee ee TABLE 3 Manhour Breakdown Per Resource/Task ..............0-. TABLE 4 Cost Breakdown by Design Task and Links ............... PROPOSAL TO PROVIDE ENVIRONMENTAL SERVICES FOR THE HEALY TO FAIRBANKS INTERTIE PROJECT 1.0 INTRODUCTION Dames &Moore,Inc.(Dames &Moore)is pleased to submit our proposal to Golden Valley Electric Association,Inc.to provide environmental services for the Healy to Fairbanks Intertie project.The Healy to Fairbanks Intertie is a proposed 230 kV transmission line connecting the Healy Substation to Fairbanks.This proposal addresses the preparation of the environmental documents required by the Rural Electrification Administration (REA)under 7 CFR 1794. These documents include a Macro-Corridor Study,a Project Alternative Report and an Environmental Assessment (EA). Based on the scope of work provided in the RFP,it is Dames &Moore's understanding that our services will,at a minimum,include the following: ¢Review of existing environmental studies and data. ¢Implementation of the public scoping and review procedures identified by the REA under 7 CFR 1794. e Preparation of a Macro-Corridor Study and a Project Alternative Report for submittal to the REA in accordance with 7 CFR 1794. ¢Preparation of a Draft and a Final EA for submittal to the REA in accordance with 7 CFR 1794. Our technical approach and estimated costs for the above services are based upon project-specific information provided to us by Golden Valley Electric Association and our knowledge and experience in providing similar environmental services for other transmission line projects within Alaska and elsewhere in the U.S. We have structured this proposal in a way that we feel is fully responsive to your request for proposal (RFP)letter dated December 28,1993.This proposal provides Golden Valley Electric Association with the following information: 1-1 *Section 2.0 presents a general overview of the firm with a particular emphasis on our Alaska operations. ¢Section 3.0 outlines our technical capabilities and our relevant experience related to this project both in Alaska and elsewhere in the U.S. ¢Section 4.0 defines our technical approach for providing the services discussed above as well as describing our project management approach. ¢Section 5.0 describes Dames &Moore's key personnel who will be involved with the project. e Section 6.0 presents our costs and estimated schedule for the tasks discussed in this proposal. In addition to the above sections,we have included three appendices that provide supplementary information to assist you in your evaluation of our proposal.We look forward to providing our services to you on this project. 1-2 2.0 OVERVIEW OF DAMES &MOORE 2.1 General Dames &Moore is a diversified,internationally recognized environmental and engineering consulting firm.Since our inception in 1938,we have performed over 103,000 projects for over 27,000 clients in more than 100 countries around the world.This inventory of experience stands ready to be applied to each new project we undertake.We owe our reputation in the consulting industry to a long-standing policy of working hard to provide technically sound,cost-effective professional services that are structured to meet the needs of our clients. With more than 70 U.S.offices and approximately 30 offices abroad,our clients include over 75%of the leading U.S.corporations and major firms;various federal,state and local government agencies;and,a wide range of agencies and firms in other nations.We provide our clients a full suite of environmental permitting and regulatory compliance,planning,waste management,remediation,engineering,design,and construction management services. 2.2 Alaska Operations Dames &Moore performed our first Alaskan project in 1956,a geotechnical foundation study for petroleum storage facilities at the Port of Anchorage.We have continued to provide environmental and engineering services since that time to a wide variety of Alaskan industries; as well as local,state,and federal government agencies.Our Anchorage office was established in 1970 to increase our responsiveness to our Alaskan clients.Our Anchorage office has a staff of over thirty personnel who have a wide range of environmental and engineering backgrounds and professional experience.In 1991,we expanded our Alaska presence by opening an office in Fairbanks. ) 2.3.Environmental Assessments and NEPA Experience Since the National Environmental Protection Act (NEPA)was passed in 1969,Dames &Moore has prepared numerous EAs and EISs in accordance with NEPA scoping and report guidelines. We are experienced at analyzing issues related to subsistence,wildlife and habitat values,scenic and recreational resources,wetlands and floodplain impacts,historical and cultural resources, and others.Dames &Moore personnel have extensive experience in the public scoping process required under NEPA as well as experience coordinating with local,state and federal agency representatives and the general public.Examples of Alaska NEPA projects recently completed by Dames &Moore are included in Table 1. In addition to our NEPA experience,Dames &Moore has recently prepared two environmental reports on proposed transmission line corridors in Alaska.These reports were prepared as part of the Feasibility Studies conducted on these projects.The reports were prepared in an EA format so that the information could easily be incorporated into an EA or EIS if the projects proceed to a permitting and construction phase. 2-2 RECENT ALASKA NEPA EXPERIENCE TABLE 1 Project Location Description Transmission Line Upgrade Southcentral Alaska Environmental City of Seward Assessment Main Bay Salmon Hatchery Southcentral Alaska Draft and Final EIS Prince William Sound Aquaculture Joint Military Training Exercises All of Alaska Draft and Final EIS U.S.Army Corps of Engineers Katmai Research Drilling Project National Park Service Western Alaska Draft and Final EIS U.S.Forest Service Alaska Pulp Corp. Timber Sale Analysis Area 12: Qiu Island Southeast Alaska Draft and Final EIS U.S.Forest Service Alaska Pulp Corp. Timber Sale Analysis Area 6: Corner Bay Southeast Alaska Draft and Final EIS U.S.Forest Service Alaska Pulp Corp. Timber Sale Analysis Area 3: Freshwater -Whitestone Bay Southeast Alaska Draft and Final EIS U.S.Forest Service Alaska Pulp Corp. Timber Sale Analysis Area 2: Mud Bay -Neka Bay Southeast Alaska Draft and Final EIS Ketchikan Pulp Co. Supplemental Water Supply Ketchikan Pulp Mill Southeast Alaska Environmental Assessment 2-3 Project Location Description U.S.Navy Relocatable Over-the- Horizon (ROTHR) Radar System Western Alaska Draft and Final EIS Alaska Pulp Corporation Log Transfer Facility Southeast Alaska Environmental Assessment Diamond Alaska Coal Co. Diamond Chuitna Coal Mine Southcentral Alaska Draft and Final EIS Idemitsu Alaska,Inc. Wishbone Hill Coal Mine Southcentral Alaska Draft and Final EIS U.S.Forest Service U.S.Borax Quartz Hill Road and Bulk Sampling Southeast Alaska Draft and Final EIS U.S.Army Corps of Engineers ARCO Alaska,Inc. Prudhoe Bay Oil Fild Waterflood Project Northern Alaska Draft and Final EIS ARCO Alaska,Inc.Northern Alaska Draft EIS Lisburne Oil Field Offshore Facilities Pacific Alaska LNG Co.Southcentral Alaska to Environmental Liquified Natural Gas System California Assessment Hobbs Industries,Inc. Castle Mtn.Coal Mine Southcentral Alaska Environmental Baseline and Coal Mine Permit Application Cominco Alaska,Inc. and NANA Regional Corp. Red Dog Mine Project Northwest Alaska Environmental Baseline Report Doyon Ltd./GCO Minerals Fortymile Asbestos Project Interior Alaska Environmental Baseline Report Fairbanks Gold Company Fort Knox Gold Mine Interior Alaska Environmental Baseline and Assessment Echo Bay/Coeur d'Alene JV Kensington Mine Project Southeast Alaska Environmental Baseline Report Project Location Description Echo Bay Mining Company Alaska-Juneau Gold Mine Southeast Alaska Environmental Baseline Report Yukon Pacific Corporation TransAlaska Gas Pipeline Prudhoe Bay to Valdez Environmental Baseline U.S.Dept.of Commerce Southcentral Alaska Environmental Wind Profiler Installation Assessment U.S.Dept.of Commerce Southcentral Alaska Environmental Kenai Airport 74C Assessment Radar Installation U.S.Dept.of Commerce Southcentral Alaska Environmental Doppler Radar Installation Assessment Alaska Department of Southcentral Alaska Environmental Transportation and Public Assessment Facilities Chenega Bay Airport Alaska Department of Western Alaska Environmental Transportation and Public Assessment Facilities Port Alsworth Airport - 2-5 3.0 TECHNICAL CAPABILITIES AND RELEVANT PROJECT EXPERIENCE 3.1 Introduction The routing,permitting,design,and construction of large transmission line facilities is becoming increasingly challenging as new and more stringent environmental and regulatory restrictions and requirements are being implemented.Meeting the challenges of the future will demand not only a broad awareness of key environmental issues and the technical expertise to address these issues,but also experience in incorporating public review and comment into siting and licensing processes. This section describes Dames &Moore's technical capabilities related to the proposed intertie project.As can be seen from the following pages,we offer not only technical expertise in environmental fields such as visual impact analysis,wetlands analysis,threatened and endangered species surveys,and socioeconomic and land use analysis;but we also offer experience in developing and implementing public participation plans and programs to fulfill the public scoping and review requirements required by NEPA and state regulations. In addition to the description of our technical capabilities,this section of the proposal also presents relevant project profiles describing representative Dames &Moore projects in the Healy -Fairbanks area,in other areas of Alaska,and throughout the United States.Project descriptions for each of these areas are provided in Appendix A. 3.2 Dames &Moore Technical Capabilities 3.2.1 Environmental Assessments/Environmental Impact Statements Dames &Moore is recognized as a leader in conducting interdisciplinary environmental studies for large-and small-scale projects.We have extensive experience in environmental assessments; environmental impact statements;feasibility analyses;planning studies;and site and route selection and evaluation studies. Since the passage of NEPA in 1969,Dames &Moore has completed thousands of environmental assessments for a wide variety of projects.We have prepared NEPA environmental documents on electric transmission lines,natural gas pipelines,hydroelectric projects,highway projects, off-shore oil and gas development projects,mining operations,federal administration actions, and many other large commercial and industrial developments.Dames &Moore staff are familiar with the application of NEPA and state environmental regulations,including the scoping and review procedures for EAs and EISs.Our work focuses on the planning and evaluation process leading to the identification of environmental alternatives and cost-effective mitigation measures.- 3-1 Our capabilities in environmental assessments include: Public involvement and scoping Air quality Surface and groundwater quality and quantity Marine and freshwater biology Souls and geotechnical assessments Vegetation and reclamation Terrestrial wildlife assessments Wetland mapping and classification Land use compliance evaluations Social impact assessments Visual analyses Cultural and historic resources assessments Document preparation and coordination Expert testimony 3.2.2 Terrestrial and Aquatic Biology Dames &Moore was one of the first major consulting firms to provide services in terrestrial and aquatic biology.We began assisting clients in assessing the impacts of projects on fisheries, vegetation,and wildlife in the early 1970s and continue today,providing baseline studies,impact assessments,and planning services.Our primary services consist of the following: Baseline studies and impact assessments Inventories of existing resources using photogrammetry and geographic information systems Mitigation planning and implementation Threatened and endangered species investigations Stream surveys Permit assistance and agency coordination Wildlife habitat evaluations using the U.S.Fish and Wildlife Service's HEP Revegetation and habitat restoration Wetland investigations Monitoring and permit compliance programs CERCLA assessment of natural resource damage Our work in biology entails both field and literature surveys designed to establish existing conditions relevant to the potential impacts of projects such as electric transmission lines,gas and oil pipelines,power generating facilities,mines,roadways,and commercial and industrial facilities.To assist our clients in obtaining the appropriate permits expeditiously,we focus on identifying critical concerns and developing economically feasible mitigative methods.With the approval of our clients,we also work with agency representatives to negotiate permit conditions that provide acceptable and cost-effective protection of the environment. 3-2 3.2.3 Social and Cultural Resources Dames &Moore has personnel with experience in preparing social and cultural resource analyses for electric utility projects.Areas covered by these studies include cultural and historical resources;visual and recreational resources;social,political and economic resources;and land use and land ownership.Services in this area include the following: Baseline studies and impact assessments State Historic Preservation Office and National Historic Register Database Searches Documentation of subsistence activities Surveys of recreation users Visual Analysis including viewshed analysis and visual simulation Analysis of local and state land planning regulations Analysis of Mental Health Lands/Native Land and Claims Socioeconomic impact analyses based on labor force,construction costs,etc. Mitigation planning and implementation Permit assistance and agency coordination 3.2.4 Public Participation Processes Dames &Moore has prepared and implemented public involvement programs of various levels throughout Alaska and the rest of the U.S.Public involvement programs range from scoping meetings required by federal,state or local agencies to large public information programs including monthly newsletters,regular community meetings,press releases and conflict mediation sessions.Dames &Moore has provided these services to a range of public and private clients,including the Alaska Energy Authority,the U.S.Defense Fuels Service Center, and the U.S.Army Corps of Engineers.Services provided by Dames &Moore include: NEPA Scoping Meetings Development of Public Information Programs Project newsletters and fact sheets Maintenance of large project mailing lists Media relations 3.2.5 Permit Acquisition and Regulatory Compliance Dames &Moore has extensive experience with environmental planning,permit acquisition,and regulatory compliance.We offer complete services related to: Feasibility planning Permit identification Development of permit acquisition strategy Application preparation and tracking Establishment of regulatory compliance programs 3-3 An important aspect of Dames &Moore's approach to planning and arranging for permits is devising practical and cost-effective solutions to environmental problems.We often assist our clients in working out formal or informal negotiated compromises with regulatory agencies, developing ways to mitigate environmental impacts,implementing remedial action programs,and providing expert testimony.We also provide mathematical modeling and computer-assisted data analyses such as assessments of air and water quality and evaluations of emission control alternatives. Permit acquisition and regulatory compliance services have been provided to clients such as public utilities,large and small manufacturing industries,petroleum and mining companies, public ports,commercial waste management facilities,governmental agencies,and pulp,paper, and wood preservation companies. 3.2.6 Geotechnical Services Dames &Moore's geoscientists and engineers provide a broad range of services which address the interaction of a proposed project with site specific geologic and seismic conditions.Dames &Moore geologists and engineering geologists have worked on nuclear and fossil fuel power plants,refineries and cogeneration facilities,pipeline projects,manufacturing and industrial complexes,offshore oil projection platforms,data processing and communication facilities, dams,hospitals,and hazardous and nuclear waste management facilities.This broad array of project experience gives us the depth and range of understanding to meet the needs of any project. Dames &Moore's seismic and geologic engineering services include the following: Geologic Site Assessments Geologic and Seismic Hazards Evaluations Risk Evaluation and Hazard Mitigation Planning/Design Applied Geophysical Investigations 3.2.7 Project Management Dames &Moore is experience at handling large,complex projects which involve several technical specialties.Dames &Moore's corporate accounting systems allow for up-to-date tracking of costs to allow for control of tight budgets.Local project managers are intimately involved with supervising projects and assuring that work is completed according to schedule. Dames &Moore will utilize its Job Reporting System (JRS),a proprietary computerized reporting system designed to help project managers control the scheduling,technical,manpower and financial aspects of projects.The System will report the labor,expense,and equipment charges against the project on both a weekly and a cumulative basis.Reports are transmitted to the project manager within five working days of data collection.The JRS provides the project manager with accurate and timely information to control project performance.Early detection of problem areas makes it possible to implement the necessary measures to put the project back on course.Constant monitoring of the technical,scheduling,and financial aspects of the project 3-4 keeps the project manager fully aware of progress.The JRS has been in place at Dames & Moore since the late 1970s and has been utilized successfully on past projects. Dames &Moore has established a firm-wide internal Quality Assurance and Quality Control (QA/QC)program that meets or exceeds requirements established by USEPA-003/80 "Interim Guidelines and Specifications for Preparing Quality Assurance Project Plans"for conducting environmental and engineering projects.The goal of our QA/QC program is to provide project Management with a tool to help achieve successful completion of a project.The purpose of quality assurance is not to replace established work practices,but to supplement them as necessary to provide documentation,traceability and reproducibility. 3.3.Relevant Project Experience Dames &Moore has successfully completed numerous projects encompassing a wide range of study areas for many clients in Alaska.Some examples of Dames &Moore NEPA projects in Alaska were listed in Section 2.3 of this proposal.Detailed project descriptions for relevant projects both in Alaska and elsewhere are in Appendix A.Recent transmission line projects and NEPA projects completed by Dames &Moore in Alaska are briefly described below. 3.3.1 Copper Valley Intertie Environmental Analysis Dames &Moore recently prepared an environmental analysis for the Copper Valley Intertie Feasibility Study.This study looked at two alternative corridors for a 230 kV transmission line between Sutton and Glennallen,Alaska.Both corridors were approximately 135 miles in length and passed through the Matanuska Valley Moose Range and the Nelchina Public Use Area.Six state recreation areas were also in the project area and recreation and visual impacts were identified as major public concerns regarding the proposed routes.Dames &Moore compiled baseline data on the project area,analyzed the potential impact of the project,discussed the potential for minimizing and mitigating impacts,and identified local,state and federal permitswhichcouldberequiredforconstructionandoperationoftheline.Dames &Moore also participated in agency and public meetings on the project,maintained the project mailing list, collected public input on the project,and incorporated public comments into the report. 3.3.2 Tyee -Swan Intertie Environmental Analysis Dames &Moore also prepared an environmental analysis for a proposed 115 kV transmission line connecting the Tyee Lake hydroelectric plant and the Swan Lake hydroelectric plant. Baseline data were collected and illustrated both graphically and in tabular form.Impacts were analyzed and the potential for minimizing or mitigating these impacts were addressed.Permit requirements were described and public concerns were addressed.Some of the major issues identified on this project included recreation,wildlife,and timber harvesting.This project was completed in 1992. 3.3.3 Seward Transmission Line Upgrade Environmental Assessment In 1992,Dames &Moore prepared an Environmental Assessment for the upgrade of 40 miles of transmission lines for the City of Seward.The line is located on National Forest land and 3-5 required close coordination with the U.S.Forest Service as well as other federal,state and local agencies.Issues identified in the scoping meetings included wildlife,wetlands,timber productivity,bark beetle,cultural and historical sites,visual impacts,subsistence and electromagnetic fields. 3.3.4 Joint Military Training Exercises (JTX)Environmental Impact Statement Dames &Moore is currently working on an EIS on Joint Military Training Exercises in Alaska for the Alaskan Command.This project evaluated at 67 ground sites and 8 temporary use air spaces throughout Alaska.Five of the ground sites and one air space examined within the JTX EIS are located within the study area for the Healy -Fairbanks Intertie project.An area of approximately 50 square miles was analyzed for each of the ground sites and 100 square miles were analyzed for each air space.Major issues raised during the public scoping process included wildlife,wetlands,hazardous wastes,safety of the general public,historical and archeological resources,noise,and conflicts with the natural resource values of public lands. 3.3.5 Northeast Intertie Environmental Report Dames &Moore assisted in the development of a economic feasibility study of three alternative transmission proposals as part of the Alaska Railbelt energy grid.The proposals considered were:anew line from Anchorage to the Kenai Peninsula;upgrade of the existing Anchorage - Fairbanks Intertie;and a new line from Palmer through Glennallen (Matanuska Valley)to Delta Junction,Alaska.A matrix was developed for comparative assessment of alternative plans including the following environmental indicators:air quality,water quality,fish and wildlife, land use impact and ownership,terrestrial impact,recreation resources,visual impact, community preferences,impact on community infrastructure,and timing in relation to other capital projects. 3-6 4.0 TECHNICAL APPROACH 4.1 Introduction This section of the proposal addresses our technical approach for the environmental services requested by Golden Valley Electric Association as previously outlined in Section 1.0.We have structured this section to generally follow the list of tasks identified in Section 1.0.However, we propose to combine the Macro-Corridor Study Report and the Project Alternative Report into one document.Dames &Moore has produced a combined report on previous projects and it has been well received by the REA and other agencies.A sample Table of Contents for the combined report is included in Appendix B. 4.2 Task 1:Project Management Dames &Moore's project management capabilities are described in Section 3.2.This project will be managed and primarily staffed from our Anchorage office.Additional technical staff will be provided from our Fairbanks offices and possibly other offices,as specific project needs dictate.Section 5.0 of this proposal identifies the project manager and key personnel who will participate in this project. A project initiation meeting will be held in late January or early February depending on the timing of contract award.This meeting will allow Golden Valley Electric Association's technical staff and Dames &Moore's technical staff to discuss strategies for best completing the EA process in a timely manner.It is anticipated that Dames &Moore staff will coordinate closely with Golden Valley Electric Association's staff throughout the life of the project to ensure that the project is completed on schedule,on budget,and to Golden Valley Electric Association's satisfaction. Monthly progress reports will be developed by the Dames &Moore Project Manager for Golden Valley Electric Association's review.These progress reports will give the status on all current activities,identify upcoming milestones,identify problems encountered,and explain how problems have been resolved.These progress reports will allow Dames &Moore's Project Manager to track progress against the project schedule and allow Golden Valley Electric Association's Project Manager to have oversight on project progress. 4.3 Task 2:Review of Existing Environmental Studies Dames &Moore is aware that the corridor being proposed includes a portion of the area evaluated in the Denali Pipeline Project Environmental Assessment dated November 1,1993. In addition to this EA,Dames &Moore is currently working on the JTX EIS for the Alaskan Command which includes areas within the Healy -Fairbanks Intertie Project study area.Many other environmental and geotechnical studies,including previous studies by or for Golden Valley 'Electric Association,have also looked at this area and may provide baseline data on mostresources.Dames &Moore will review all existing data and maps from previous studies as well as researching additional data available from the Alaska Department of Transportation and Public Facilities (ADOT/PF),the Alaska Department of Fish and Game (ADF&G),the Alaska 4-1 Department of Natural Resources (ADNR),the Alaska Energy Authority (AEA),the Alaska Department of Community and Regional Affairs (ADCRA),the Alaska Department of Commerce and Economic Development and other state agencies.Federal data sources include the Army Corps of Engineers (COE),the U.S.Geological Survey (USGS),the U.S.Fish and Wildlife Service (USFWS),the U.S.Department of Agriculture (USDA),the Bureau of Land Management (BLM),and other federal agencies.Local data resources include the City of Fairbanks,the Fairbanks/North Star Borough and the Denali Borough.Baseline data will be summarized and displayed graphically and/or in tabular form depending on the applicability. Dames &Moore will provide support to Golden Valley Electric Association for field review of route alternatives and development of the final route map.At this time it is assumed that the route alternatives will be limited to routes previously identified by Golden Valley Electric Association,although there may be some slight modifications to these routes based on the field review. 4.4 Task 3:Macro-Corridor Study The Macro-Corridor Study will contain an analysis of the project area in which the proposed routes are located.The project corridor will be delineated such that any possible modifications to the routes will be included within the corridor.Evaluation criteria to be used to compare the route alternatives will be developed based on the best available data for each resource.The route alternatives developed in Task 2 (or the identified segments of these routes)will be evaluated based on the identified criteria and comparisons will be summarized in tabular form. Examples of criteria used in previous corridor studies are included in Table 2.Information from the Macro-Corridor Study and the evaluation of alternatives will be included in the Project Alternative Report described further in Task 4. The baseline and impact analyses for the various resources are described in more detail in the following sections. Climate/Soils/Geology Data on the climate,soils and geology of the area will be compiled and described.Steep slopes, areas of avalanche potential and permafrost conditions will be evaluated for their impact on the identified route alternatives. Aquatic Biology Baseline data will be compiled as described in Section 4.3.A considerable amount of fisheries data exists for many of the streams identified within the project area.This body of data is contained in a project database derived from information contained in the ADF&G Catalog of Waters Important to Anadromous Fish and other ADF&G reports,and the USFWS,Cooperative Research Unit in Fairbanks.Anadromous fish streams in the study area will be identified and the fish species present in each stream will be documented.This data will be summarized in tables and graphically illustrated on maps. 4-2 TABLE 2 SAMPLE EVALUATION CRITERIA Resources Sensitivity Biological Resource Criteria Known Threatened or Endangered Special Use Area High Known Candidate Species Special Use Area Moderate/High Known Moose/Caribou Concentration Area Moderate Land Use Criteria Recreation Areas High Residential Areas High Commercial Areas Moderate Industrial Areas Low Existing Corridors (road,railroad,utility)Low Visual Resource Criteria Foreground view from parks,recreation areas High Foreground view from residences High Scenic routes/landscapes High Midground view from parks,recreation areas Moderate Midground view from residences Moderate Background view from parks,recreation areas Low Background view from residences Low Flat landscapes Low Developed areas/utility corridors -Low Note:Corridor specific criteria and sensitivity levels to be used for this project will be developed and weights assigned after consultation with Golden Valley Electric Association. 4-3 An assessment of the environmental consequences to fish habitat that could result from stream crossings on the proposed route will be performed and mitigation strategies will be recommended.Mitigation strategies could include changing the timing of construction activities and changing stream crossing locations. Wildlife and Habitat The primary goal of this task will be to document sensitive or critical areas for wildlife species, analyze the potential impacts of the project and identify mitigation strategies for addressing these impacts.Baseline data will be compiled as described in Section 4.3 and concentration areas will be indicated graphically on maps.Major resources for wildlife data include the ADF&G and the USFWS,Cooperative Research Unit in Fairbanks. An assessment of the potential impacts to wildlife and wildlife habitat that could result from the project will be performed and mitigation strategies will be recommended.Specific species of interest which are known to occur in the study area include swans,peregrine falcons and eagles. Known concentration areas for these and other species will be identified and avoided where possible.Mitigation strategies will be recommended for activities in those areas which cannot be avoided.Mitigation strategies could include scheduling construction during time periods which would help minimize impacts to wildlife or incorporating construction techniques which minimize impacts which can not be avoided. Wetlands/Vegetation Wetlands data will be gathered primarily from the USFWS National Wetlands Inventory and acreages of various types of wetlands along the alternative routes will be summarized.Upland habitats will also be delineated to verify acreage estimates of terrestrial vegetation along proposed route alignments.The effect that line construction would have on wetlands,including potential changes in value/function will be assessed.Areas where potential routes intersect wetlands or could indirectly affect wetlands will be identified and indicated on maps. An analysis of mitigation methods will also be completed at this time.Sensitive areas that should be avoided by changes in alignment of the route within the corridor will be identified. Other mitigation methods will be assessed where wetlands cannot be avoided and will consist of techniques that will maintain the functional aspect of wetlands in order to preserve as much of the pre-construction value as possible.Such mitigation measures may include manipulation of hydrologic flow,water quality control,reclamation to reestablish function,or compensation consisting primarily of wetland expansion,value enhancement,or offsite enhancement when onsite impacts cannot be mitigated. Cultural and Historical Resources Historic properties are defined as buildings,sites,structures,or objects,each of which may have historical,architectural,archaeological,cultural,and/or scientific importance.A variety oflaws,regulations,andstatutes,on both the federal and state level,seek to manage or protectsuchresources.These include the Antiquities Act of 1906;Reservoir Salvage Act of 1960;. 4-4 National Historic Preservation Act of 1966;National Environmental Policy Act of 1969; Executive Order 11593 (Protection and Enhancement of the Cultural Environment,1971);and the Archaeological and Historical Preservation Act of 1974.Specifically,Section 106 of the National Historic Preservation Act (NHPA)and its implementing procedures require federal agencies to take into account the potential effects of proposed projects on historic properties listed on or potentially eligible to the National Register of Historic Places. Dames &Moore will first assemble baseline data on the project area througha literature review and record search.This task will utilize information compiled during previous investigations of the project area,records on file at the Alaska State Office of Historic Preservation,and other available documentation.The search will be used to ascertain the presence or absence of known or suspected prehistoric or historic archaeological sites within the project corridor and immediately adjacent areas. Currently available information,collected during preparation of the Denali Pipeline Project EA, provides some indication of the density of cultural resources along the project corridor.An additional 12 sites were identified within the Healy to Fairbanks segment during a preliminary reconnaissance level aerial survey conducted in conjunction with the proposed Susitna Hydroelectric Project. Upon completion of the literature review and record search,a determination will be made of the need to conduct a survey of the entire project area or portions of the area.Surveys would likely be confined to areas which have not been subjected to previous cultural resources investigations and which have not undergone major impact through recent activities. Socioeconomic/Sociopolitical Studies Socioeconomic baseline data will be compiled including population concentrations and economic conditions in the study area.In addition,all government jurisdictions crossed or impacted by the project will be identified and described.Land status and ownership will be indicated graphically on maps and the implications of each land status will be discussed. After the baseline data has been compiled,Dames &Moore will analyze the impact of transmission line construction and operation on the socioeconomic environment of communities along the corridor and within the Golden Valley Electric Association service area.Typical positive short term socioeconomic impacts include increased employment,wages,and demand for goods and services in the construction area.Short term negative impacts often include increased noise and traffic in the vicinity of construction.Long term positive impacts may include changes in the price or reliability of electric service provided to the utility's service area, while negative impacts may include some negative aesthetic (visual)impacts. Data sources for the socioeconomic element are expected to include the U.S.Bureau of the Census,the ADCRA,the Alaska Department of Labor,the Alaska Department of Commerce and Economic Development,the ADNR,local government agencies and the University of Alaska's Institute of Social &Economic Research. 4-5 Visual and Recreational Values Baseline visual data will be compiled based on existing data such as topographical maps, photographs and videos,as well as previous studies and documented literature.Viewsheds, possible vantage points,and critical visual areas will be identified and impacts assessed. Mitigation strategies designed to minimize the visual impacts in critical areas will be identified. Electromagnetic Fields The issue of possible health impacts from electromagnetic fields (EMF)may be raised by the public during the EA scoping process.The EMF issue often is raised due to a lack of understanding about EMF by the general population.Dames &Moore is experienced at dealing with EMF concerns and has staff specialists available to address the issue in any detail required. It is our understanding that EMF is not expected to be a major issue on this project.Therefore, Dames &Moore proposes to address EMF by simply describing the field levels at various distances from the transmission line right-of-way center line and comparing these values to field levels associated with common household appliances. 4.5 Task 4:Project Alternative Report Dames &Moore proposes to prepare one report at the end of the Macro-Corridor Study to summarize the study results and propose the preferred project alternative.Conversations with REA have confirmed that this is acceptable under the REA guidelines.A sample Table of Contents for this proposed combined report in included in Appendix B.Limiting report production to one report will save valuable time in proceeding through the EA process. The Project Alternative Report will describe the project alternatives considered,the evaluation criteria that were developed and how they were applied,the impact analyses completed,and the preferred route alignment.Rankings of the routes based on evaluation results will be summarized in tabular form.A draft of this report will be provided to Golden Valley Electric Association for review and comments.Golden Valley Electric Association's comments will be addressed quickly so that the report can be sent to REA in a timely manner. 4.6 Task 5:Draft Environmental Assessment After completing the Project Alternative Report,Dames &Moore will produce a draft of the EA.The Project Description,Alternatives Analysis,Affected Environment,and Environmental Consequences sections will be completed based on the work performed in Tasks 2,3 and 4.At this point,any surveys or field work which may be required by local,state or federal agencies will be identified.It is our understanding that the only field work that Golden Valley Electric Associations anticipates to be required is a cultural resource survey of portions of the route. .Dames &Moore will coordinate with the State Historic Preservation Officer (SHPO)on the need for a cultural resource survey and the areal extent which would be subject to such a survey. Fifteen copies of the draft EA will be produced for review and comment by Golden Valley Electric Association.A sample Table of Contents for the EA is included in Appendix B. 4-6 4.7 Task 6:Public Scoping Meetings This section briefly describes the assistance that Dames &Moore will provide to Golden Valley Electric Association related to the public scoping process for the EA as required by REA under 7 CFR 1794. Dames &Moore will schedule public scoping meetings in both Fairbanks and Healy,and then provide a public notice regarding the scoping meetings for publication by both Golden Valley Electric Association and REA under the timeframes required by 7 CFR 1794.The notice will include a description of recommended project and route alternatives,as well as information on the location,date,time,and purpose of the scoping meeting and other information specified in 7 CFR 1794.It is recommended that scoping meetings be held both in Fairbanks and Healy as these are the population concentration areas along the corridor.Dames &Moore will serve as the contact agent for collecting and coordinating all public comment resulting from the public notice and the scoping meetings.A description of the scoping process will be included in the EA and comments from the scoping meetings will be incorporated into the Final EA. 4.8 Task 7:Final Environmental Assessment After receiving public comments from the scoping meeting,review comments from Golden Valley Electric Association,REA,and various interested agencies,Dames &Moore will revise the EA to address the issues and comments raised.Survey results from the archaeological survey and any other field surveys will be incorporated into the Final EA and fifteen copies will be provided to Golden Valley Electric Association. 4-7 5.0 KEY PERSONNEL 5.1 Introduction Dames &Moore has selected a team of highly qualified and experienced professionals who have a thorough understanding of the environmental needs for this project.Figure 3 illustrates the general management and organizational structure we will implement to assist Golden Valley Electric Association with this effort.The following sections provide a brief biosketch of our key personnel,with a more detailed and comprehensive resume for each of these personnel included as Appendix C to this proposal. 5.2 Project Manager Ms.Mary Cocklan-Vendl,a Senior Environmental Scientist,will serve as overall Project Manager for this effort.Ms.Cocklan-Vendl has over 12 years experience as a Senior Environmental Scientist in large,multidisciplinary projects associated with environmental regulatory compliance involving local,state,and federal agencies throughout the United States and Alaska.Her experience includes environmental assessments,environmental impact statements,oil spill contingency planning,environmental permitting and compliance,water resource planning,water quality investigations,hydrologic modeling,flood studies,and regulatory strategy studies. Most recently,Ms.Cocklan-Vendl served as the Project Manager on the Copper Valley Intertie Environmental Analysis prepared as part of the Feasibility Study for this project.Ms.Cocklan- Vendl has also prepared sections of the FERC licensing application for the Bradley Lake Hydroelectric Project and participated in the preparation of EAs for various airport facilities under the jurisdiction of the Alaska Department of Transportation &Public Facilities.She has served as Project Manager on the Red Dog Mine Reclamation Plan and several Oil Discharge Prevention and Contingency Plan projects for public and private clients. Over the last three years,Ms.Cocklan-Vendl's work has focused on developing and/or implementing comprehensive environmental permitting strategies for various projects throughout the state including a proposed port development project at Point McKenzie and the Red Dog Mine activities in northwest Alaska. 5.3.Key Technical Staff Ms.Maryellen Tuttell,AICP,will coordinate overall report preparation and public scoping activities on this project.In addition,Ms.Tuttell will serve as the Task Manager for the Human Resources Investigations for this project which includes coordinating work on Cultural and Historical Resources and developing the necessary Socioeconomic and Sociopolitical Studies. Ms.Tuttell has been working as an Environmental Planner for seven years and is certified through the American Institute of Certified Planners (AICP).Her specialties include permitting, public involvement,land use planning and socioeconomic analysis.Ms.Tuttell has provided these services for many large multidisciplinary projects including utility corridor assessments, 5-1 transportation corridor assessments,mine reclamation planning,hazardous waste site evaluations, and oil spill remediation projects. Most recently,Ms.Tuttell coordinated the preparation of an environmental analysis for the Copper Valley Intertie Project,a 135-mile transmission line corridor from Sutton,Alaska to Glennallen,Alaska.She also prepared the land status/land use and community impacts sections of this report.She maintains a 100-plus name mailing list for the project and prepared meeting summaries for public meetings held during the study period. Ms.Tuttell's work experience in Florida focused on siting and licensing of electric transmission lines and power generating facilities under Florida's Transmission Line Siting Act and Power Plant Siting Act.These regulations required detailed environmental,engineering,economic and sociological analyses to be performed and documented prior to state approval of electric utility projects.Ms.Tuttell worked on transmission line projects throughout the state and was responsible for coordinating with federal,state and local agencies as well as for implementing public participation programs associated with these projects. Mr.David E.Erikson,a Senior Ecologist in Dames &Moore's Anchorage office,will be responsible for the analysis of wildlife and habitat,wetlands/vegetation,and aquatic biology,as well as Task Manager for all of the natural resource investigations.Since joining Dames & Moore in 1977,Mr.Erikson has managed a wide variety of field projects in coastal and interior Alaska.He was a principal investigator for multidisciplinary shoreline recovery studies during the Exxon Valdez Oil Spill Natural Resource Damage Assessment (NRDA)and served as Chief Scientist for colonial seabird studies in the Gulf of Alaska following the spill.Mr.Erikson has recently provided expert witness testimony on behalf of Exxon as part of their ongoing litigation process associated with the spill.Prior to his employment with Dames and Moore,he worked for the Alaska Department of Fish and Game and the U.S.Fish and Wildlife Service.He is a member of the Association of Field Omithologists,the Wilsons Ornithological Society, American Ornithologist Union,and the Coopers Ornithological Society. Mr.Gregory J.Gault will serve as Task Manager and Principal Investigator for all Visual and Recreation investigations.Mr.Gault has extensive experience in transmission line projects throughout the United States and Alaska.Mr.Gault recently prepared visual and recreational resource assessments and impact analyses for the Copper Valley Intertie project in southcentral Alaska and the Tyee -Swan Intertie project in southeast Alaska.In addition,Mr.Gault conducted visual resource,wilderness,and recreation studies for the Katmai Research Drilling Project EIS in Katmai National Park and Preserve. 5.4 Other Dames &Moore Personnel In addition to the key personnel identified above,Dames &Moore has Anchorage and Fairbanks based staff with extensive experience in preparing environmental baseline reports and impact analyses.Dames &Moore also routinely draws support for specific specialties from our large pool of environmental staff located in other offices.This management approach provides Dames &Moore with the flexibility to staff projects with the most qualified personnel to fulfill a project's unique or specialized technical requirements,as well as to provide additional staffing 5-2 needs to meet stringent time and scheduling demands.Resumes for technical support staff specifically identified for this project are included in Appendix C. 5-3 6.0 ESTIMATED COSTS AND SCHEDULE 6.1 Introduction This section presents our estimated costs and schedule for the scope of services requested in order to conduct the environmental services necessary for this project as previously outlined in this proposal. 6.2 Cost Information Dames &Moore has prepared a cost estimate based on the scope of work and technical approach outlined previously in this proposal.Dames &Moore estimates the total project cost to not exceed $54,740.Estimates for labor costs and total project costs are listed on Tables 3 and 4 based on the tables provided in Golden Valley Electric Association's RFP. These cost estimates are based on the understanding that no field work will be performed other than a site visit with Golden Valley Electric Association.It is our understanding that the Draft EA will identify any field surveys which would be required to complete the Final EA,but that these field studies are not under the scope of this project and would be awarded under a separate contract. If you have any questions concerning our assumptions,or the basis for determining our costs, please call us and we will be glad to discuss them with you. 6.3 Schedule Dames &Moore will be able to initiate work on this project immediately upon negotiating a contract with Golden Valley Electric Association for our services on this project.If Dames & Moore receives Notice to Proceed by February 1,we would anticipate completing the tasks according to the following schedule: Task Description Completion Date Task 2:Review of Existing Environmental Studies March 1,1994 Task 3:Macro-Corridor Study April 15,1994 Task 4:Project Alternative Report May 1,1994 Task 5:Draft EA June 1,1994 Task 6:Public Scoping July 31,1994 Task 7:Final EA 4 weeks after receipt of all comments Conversations with REA indicate that it usually takes 12 months between receipt of a Draft EA and their acceptance of a Final EA.The schedule listed above is subject to change based upon 'review timeframes required by Golden Valley Electric Association and the REA,and the time requirements associated with cultural resource field surveys or other field surveys required for completion of the Final EA. Project: Man-hour Breakdown per Resource /Task TABLE 3 MANHOUR BREAKDOWN PER RESOURCE/TASK Healy to Fairbanks 230 kV Intertie Unit $$95.00 $82.50 $49.50 $43.00 TOTAL Project Project Staff Clerical!COSTS Manager Analysts I | PROJECT ADMINISTRATION 1-4-5 24 4 $2,452 2-3 20 4 $2,072 DATA SEARCH AND REVIEW 1-4-5 4 12 36 4 $3,324 2-3 4 8 24 4 $2,400 MACRO-CORRIDOR STUDY 1-4-5 6 20 24 8 $3,752 2-3 4 12 16 8 $2,506 PROJECT ALTERNATIVE REPORT 1-4-5 8 16 16 6 $3,130 2-3 6 12 12 6 $2,412 DRAFT ENVIRONMENTAL ASSESSMENT 1-4-5 12 40 60 20 $8,270 2-3 8 24 40 16 $5,408 SCOPING EFFORT AND SUPPORT 1-4-5 2 36 2 $3,246 2-3 2 24 2 $2,256 FINALIZE ENVIRONMENTAL ASSESSMENT 1-4-5 8 24 24 8 $4,272 2-3 8 16 16 8 $3,216 SUM 116 244 268 100 $46,264 NOTE:Billing rates used are average rates for specified labor categories. TABLE 4 COST BREAKDOWN BY DESIGN TASK AND LINK ENVIRONMENTAL ASSESSMENT Cost Breakdown by Design Task and Links Project:Healy to Fairbanks 230 kV Intertie Task #Link # 1.0 PROJECT ADMINISTRATION 1-4-5 28 MH $2,452 2-3 24 MH $2,072 2.0 DATA SEARCH AND REVIEW 1-4-5 56 MH . $3,324 2-3 40 MH $2,400 3.0 MACRO-CORRIDORSTUDY 1-4-5 58 MH $3,752 2-3 _40 MH $2,506 4.0 PROJECT ALTERNATIVE REPORT 1-4-5 46 MH $3,130 2-3 36 MH $2,412 5.0 DRAFT ENVIRONMENTAL ASSESSMENT 1-4-5 132.MH $8,270 2-3 _88 MH $5,408 6.0 SCOPING EFFORT AND SUPPORT 1-4-5 40 MH $3,246 2-3 28 MH $2,256 7.0 FINALIZE ENVIRONMENTAL ASSESSMENT 1-4-5 64 MH $4,272 2-3 48 MH $3,216 0.0 EXPENSES 1-4-5 2,100 $2,100 2-3 1,400 $1,400 TOTAL LABOR AND EXPENSES [49,764 | CONTINGENCY 10.00%4,976 jGRANDTOTALN.T.E. ==s==>if 54,740 APPENDIX A PREVIOUS RELEVANT EXPERIENCE PROJECT:Copper Valley Intertie Environmental Report LOCATION:Sutton to Glennallen,Alaska CLIENT:Alaska Electric Authority/R.W.Beck PROJECT DESCRIPTION:Dames &Moore was responsible for preparing an environmental analysis on a proposed 135 mile 230kV transmission line intertie from Sutton to Glennallen, Alaska.The environmental report included baseline information and an analysis of impacts on wetlands,upland vegetation,aquatic environments,wildlife,recreation,visual characteristics, socioeconomics and land use.Baseline information was summarized numerically and graphically on maps where appropriate.Impact analyses included recommendations for minimizing impacts and/or mitigating for unavoidable impacts.Dames &Moore also participated in agency and public meetings in the project and maintained the project mailing list and public comment files. A summary of public comment and the public participation process was included in the report. PROJECT:Environmental Assessment for Transmission Line Upgrade LOCATION:Seward,Alaska CLIENT:City of Seward PROJECT DESCRIPTION:Dames &Moore prepared an environmental assessment (EA)for the upgrade of 69kV transmission line to a new 115kV transmission line.The EA updated a 1984 EA prepared by EBASCO Services by addressing issues and concerns that were not included in the original EA.The upgraded transmission line connected the City of Seward substation to the Chugach Electric Association's Daves Creek substation.The upgrade crossed U.S.Forest Service lands and therefore required a special use permit authorization from the Forest Service.Dames &Moore performed all phases of the project including scoping,and addressed issues of wetlands,wildlife,fisheries,threatened and endangered species,raptors, electromagnetic field effects,visual impacts,timber values,socioeconomics,cultural resources, spruce bark beetle infestations,and access roads.Environmental impacts were evaluated by comparisons between four route alternatives. *** PROJECT:Railbelt Intertie Energy Transmission Feasibility Study LOCATION:Interior/Southcentral Alaska CLIENT:Alaska Power Authority PROJECT DESCRIPTION:Dames &Moore's task was to assist in the development of a economic feasibility study of three alternative transmission proposals that would be part of the Alaska Railbelt energy grid.The three transmission proposals considered were:A new line from Anchorage to the Kenai Peninsula;upgrade of the existing Anchorage -Fairbanks Intertie; and a new line from Palmer through Glennallen (Matanuska Valley)to Delta Junction,Alaska. A matrix was developed for comparative assessment for alternative plans including the following environmental indicators:air quality,water quality,fish and wildlife,land use impact and ownership,terrestrial impact,recreation resources,visual impact,community preferences, impact on community infra-structure,and timing in relation to other capital projects. Additionally,the study was extended to included a natural gas pipeline from Cook Inlet to Fairbanks and coal-fired power plants in the Railbelt.Dames &Moore prepared written reports for incorporation into the Environmental Assessments and Right-of-Way analysis. *** PROJECT:Bradley Lake Hydroelectric Project LOCATION:Kachemak Bay,Southcentral Alaska CLIENT:Bechtel Civil &Minerals,Inc. PROJECT DESCRIPTION:Dames &Moore provided a variety of environmental services to Bechtel during construction of the Bradley Lake Hydroelectric Project near Homer in southcentral Alaska.Services included: @ Environmental planning and permitting. ®@ Review of project designs relative to environmental considerations. @ Preparation and administration of an employee orientation and environmental training program. @ Preparation of an employee environmental handbook -a 52 page pocket-size manual describing environmental background and project rules. @ On-site environmental surveillance and construction quality control. ©A multi-year monitoring study of fish use in the Bradley River,both during and after construction. A-2 PROJECT:Joint Military Training Exercises -EIS LOCATION:Alaska,Statewide CLIENT:U.S.Army Corps of Engineers PROJECT DESCRIPTION:Dames &Moore prepared a programmatic Environmental Impact Statement (EIS)for the Corps of Engineers,Alaska District,for Joint Military Training (JTX) exercises at sites throughout Alaska,over multiple years.The document is to be used as the basis for planning and environmental compliance of future JTX's.Seventy-two ground sites and 31 airspace areas were studied.Six of the ground site and one airspace were within,or adjacent to the proposed Healy to Fairbanks transmission line corridor.The major concerns addressed were effects on wildlife and fisheries,habitat,water quality,hazardous substances and toxic materials,noise,socioeconomics,cultural and subsistence issues. PROJECT:New Parks Highway Bypass -EIS LOCATION:Wasilla,Alaska CLIENT:Bomhoff &Associates,Inc. PROJECT DESCRIPTION:Dames &Moore prepared the Environmental Impact Statement (EIS)for the proposed Parks Highway Bypass,a highway bypass around downtown Wasilla, Alaska,north of Anchorage.The bypass is intended to alleviate the projected traffic congestion in this fast-growing community. The project included considerable public involvement and focused on socioeconomic issues such as the loss of revenue to highway-dependent businesses and disruption of community cohesion; biological issues such as impacts on migratory and resident bird species,terrestrial mammals, wetlands,anadromous fish streams,sport and subsistence hunting and fishing,and sensitive habitats;air quality issues;noise;and anthropology and archaeology. *** OTHER RELEVANT ALASKA PROJECTS A-4 PROJECT:Susitna Hydroelectric Project Large Mammal Mitigation Plans LOCATION:Upper Susitna River,Alaska CLIENT:Harza Ebasco Susitna Joint Venture PROJECT DESCRIPTION:Technical review of Susitna Hydroelectric Project position papers and mitigation plans for caribou,moose,Dall sheep,black bear and brown bear.Developed expert testimony for the Alaska Power Authority during the Federal Energy Regulatory Commission's (FERC's)environmental review process. PROJECT:Susitna Hydroelectric Project Resource Users Survey LOCATION:Upper Susitna River,Alaska CLIENT:Institute of Social and Economic Research PROJECT DESCRIPTION:This project involved a survey of over 4,000 households in the railbelt in an effort to identify recreational use in the Susitna Basin.It is one of the largest surveys ever conducted in Alaska and the first comprehensive survey of resource use since 1978. The survey results were used by the Alaska Power Authority in planning for development of the proposed Susitna Hydroelectric Project.The interview process targeted urban,small town and rural users in a region which included the Municipality of Anchorage,the Fairbanks North Star and Matanuska-Susitna Boroughs,and settlements along highways connecting Fairbanks,Tok, Glennallen,Palmer and Anchorage.Telephone or face-to-face interviews recorded household participation in resource activities including hunting,fishing,trapping,backpacking, photography,camping,berry picking and use of all-terrain vehicles.Details of the survey included methods of access,time spent in the area,perceived benefits of the activity,costs incurred and perceived benefits of residence location. *** PROJECT:Knik Arm Crossing Project Environmental Studies LOCATION:Anchorage and Matanuska-Susitna Boroughs CLIENT:DeLeuw,Cather and Company PROJECT DESCRIPTION:As part of a consulting team providing location,design and permitting services for the proposed Knik Arm Crossing Project,Dames &Moore was responsible for environmental studies and environmental impact assessment.Environmental stu- dies for this bridge and highway project included: A-5 Juvenile salmon studies within Knik Arm. @ Fish resources within streams to be crossed by the proposed highway corridors. @ Terrestrial habitat evaluation within highway corridors. ©Archaeological resources of the project area. e Air quality modeling and impact assessment. In addition to the specific studies,Dames &Moore provided analysis of environmental considerations as part of the EIS for the project. *** PROJECT:Determine the Influence of a Thermal Discharge on the Biota of the Nenana River Using Physical-Chemical Techniques LOCATION:Healy,Alaska CLIENT:Golden Valley Electric Association,Inc. PROJECT DESCRIPTION:This project was undertaken to evaluate the effects of the thermal discharge from Golden Valley Electric Association's coal-fired steam electric power plant on aquatic life in the Nenana River near Healy,Alaska. A literature survey and discussions with personnel from EPA,the National Marine Fishery Service,and the Alaska Department of Fish and Game (Division of Commercial Fisheries, Anchorage;and Division of Sport Fish,Fairbanks)prior to initiation of field work indicated there were no data to document the species of fish or other aquatic organisms that inhabited the Nenana River near Healy.' Since no biological data are available for comparison,and since winter sampling of aquatic organisms would be extremely difficult and timeconsuming,Dames &Moore measured certain physical-chemical water quality parameters and inferred the biological status of the river from the data.Advantages of this approach were: ®More physical-chemical data than biological data could be collected over a wider stretch of river during each field trip. ©Physical-chemical sampling techniques and analytical methods are more precise than biological techniques and methods. ©Limits of physical-chemical parameters in unpolluted freshwater streams are relatively well documented for interior Alaska streams,which provided bases for comparison. @ State and federal regulatory agencies have set specific limits on a number of physical- chemical parameters,which could be compared to the data from the Nenana River. PROJECT:Fort Knox Gold Mine LOCATION:Fairbanks,Alaska CLIENT:Monte Cristo Mining PROJECT DESCRIPTION:Dames &Moore conducted field studies and literature surveys to develop a database on water quality,air quality,surface water hydrology,ground-water hydrology,wetland values,wildlife and fisheries to support the preparation of environmental permit applications and impact assessments for the proposed Fort Knox Gold Mine. *** PROJECT:Wetlands Application Review LOCATION:Fairbanks,Alaska CLIENT:C.Bettisworth &Co. PROJECT DESCRIPTION:Assess wetlands mitigation requirements for a wetland fill for construction of new housing on Eielson Air Force Base,Alaska.Dames &Moore provided recommendations for enhancement of overwintering fish habitat,revegetation and specifications for artificial nesting islands for waterfowl. PROJECT:Diamond Chuitna EIS LOCATION:Beluga Region,Alaska CLIENT:Diamond Alaska Coal Company PROJECT DESCRIPTION:Dames &Moore was employed as the third party contractor for preparation of an EIS for a 12 million ton per year coal mine in the Beluga region of upper Cook Inlet,Alaska.The project consists of an open pit coal mine and associated coal transportation and port facilities,service facilities,and housing accommodations.This is a remote site with no existing links to the Alaska highway system.The EIS was triggered by -applications to the Environmental Protection Agency (EPA)for National Pollution Discharge A-7 Elimination System (NPDES)permits to discharge pollutants from the mine,port,and housing facilities.These facilities were determined to be new sources under Section 306 of the Clean Water Act and subject to NEPA. PROJECT:Detailed Environmental Analysis,Proposed Liquefied Natural Gas (LNG) Project and Associated Pipeline Routings LOCATION:Cook Inlet Area,Alaska CLIENT:Pacific Alaska LNG Company PROJECT DESCRIPTION:As part of the FERC application,Dames &Moore prepared a detailed pipeline routing study and environmental analysis for the Pacific Alaska liquefied natural gas project,including examination of an alternative pipeline route from Kenai to Fairbanks along the rail belt. The work entailed:a description of the existing environment that covered pipeline routes,site analysis,and shipping routes;environmental impacts of the proposed LNG facility;possible mitigating measures;unavoidable impacts;short and long term effects;alternatives;and permits and compliance required. An alternative pipeline routing selection study was completed for linking gas fields on the west side of Cook Inlet with an LNG facility at Nikiski on the east side of the Inlet.Possible routings crossed important wetlands including the Susitna tidal marsh and upstream emergent wetland habitats important for migratory shorebirds and waterfowl.These habitats,their fauna, vegetation,soils,and hydrology were mapped by air photo interpretation and field recon- naissance.Attention was also given to other sensitive wildlife areas such as salmon and sport fish spawning streams and moose calving areas.Optimum pipeline routings were selected on the basis of our biological,geologic,and hydrologic data analysis. These routing data not only supported the permitting process,they were valuable in developing design parameters and selecting construction techniques. *** A-8 OTHER TRANSMISSION LINE PROJECT EXPERIENCE IN THE U.S. Dames &Moore SELECTED UTILITY PROJECT EXPERIENCE NEPA Federal Document |State/Local Expert Project Name Location Nature Voltage Agency Prepared Permits Testimony Alchesay Pumped Storage Arizona Siting S00kV FS Project -Phase I Alexander Project Arizona Siting,Permitting 230kV Yes Yes Ambrosia to Coronado*N Mexico,Siting,Permitting 230kV REA,BER Yes Arizona FS Antioch Hlinois Siting,Permitting 115kV Yes Yes Archer to Stegall*Wyoming,Assessment,Permitting 115kV Western EA Nebraska Arizona Interconnection N Mexico,Siting,Permitting,345kV BLM,PA,EIS Yes Yes Project*Arizona Cultural/Biological FS Monitoring & Assessment,COMP Austrop to McNeil Texas Siting,Permitting 345kV Yes Yes BA to Norton N Mexico Visual Assessment 345kV BLM EA Barstow to Victorville-Adelanto California Feasibility,Siting 500kV BLM BiCEP California Cultural,Socioeconomic 230kV FERC EXH E Assessment Bickerdike to Chevron Kaybob Canada Siting,Permitting 138kV Yes Yes Bickerdike to Cold Creek Canada Siting,Permitting 138kV Yes Yes Bitterroot Project*Montana Siting,Permitting 69/12kV BPA EA Blue River to Summit*Colorado Siting,Licensing 115kV Western EIS Yes Canmore to Lake Louise*Canada Siting,Permitting 138kV Park Service Charlie Creek to Belfield*North Dakota Siting,Permitting 345kV Western EIS Chevion Crossing to Flat Top Arizona Siting,Permitting S500kV FS ER Yes Yes Hill Cholla to Pinnacle Peak*Arizona Permitting,Rehabilitation |345kV FS CE Yes Cholla to Saguaro Arizona Siting,Permitting SOO0kV FS ER Yes Yes Colstrip to Hot Springs Montana Visual Assessment 500kV BPA,EIS FS, BLM A-10 Selected Utility Project Experience Dames &Moore Page 2 of 7 NEPA Federal Document State/Local Expert Project Name Location Nature Voltage Agency Prepared Permits Testimony Comanche to Pardee California Cultural Assessment 115kV FERC EXH V Conrad to Shelby*Montana Siting,Permitting 230kV Western EA Yes Consolidated Application for Arizona Siting,Permitting S00kV FS ER Yes Yes Amendments to Cases 10 and 16 Corlett to Skyline*Wyoming Siting,Permitting 115kV Western EA Cornville to Quail Springs*Arizona Siting,Permitting 69kV FS EA Coronado Station Transmission Arizona Siting,Permitting 500kV BOR,ER Yes Yes System FS Coronado Generating Station -Arizona Feasibility 500kV Unit Four Deer Valley to Alexander Arizona Siting,Permitting 230kV Yes Yes Devers to Mirage*California Land Use,Visual,220kV BLM EA Yes Yes Cultural and Socioeconomic Assessment Devers to Palo Verde #2*Arizona,Land Use,Visual,S500kV BLM SDEIS Yes California Socioeconomic Assessment,CEC Application Dineh Power Project N Mexico,Feasibility 500kV Arizona East Side Transmission Project Colorado Siting,Permitting 230kV Yes Yes EI Sol to White Tanks Arizona Siting,Permitting 230kV BLM Yes Yes Etiwanda to Padua California Visual Assessment 230kV Fence Lake Suidy N Mexico,Feasibility 500kV Arizona Flagstaff Facility Siting*Arizona Siting,Permitting 69kV FS Yes Fort Peck to Havre*Montana Siting,Permitting 230kV Western EIS Yes Yes Fort Peck to Wolf Point*Montana Siting,Permitting 115kV Western EA 230kV Fox Valley linois Siting,Permitting 345kV Yes L15kV A-11 Selected Utility Project Experience Dames &Moore Page 3 of 7 NEPA Federal Document State/Local Expert Project Name Location Nature Voltage Agency Prepared Permits Testimony Geotherma!Public Power Line California Siting,Permitting 230kV BLM EA Yes Yes Project* Gila Bend to Yuma Arizona Feasibility,Siting 230kV Glen Canyon -Navajo Project Arizona Siting,Permitting SO0kV EA Yes Great Basin Intertie Project Nevada,Feasibility 500kV Oregon,Utah, Idaho Great Falls to Conrad*Montana Siting,Permitting 230kV Western EIS Yes Gulf Robb to Gulf Pembina Canada Siting,Permitting 138kV Yes Haydento Blue River Colorado Land Use,Visual 230kV REA EA Yes Assessment Intermountain Power Project Utah,Nevada,Feasibility,Assessment,500kV Yes California Biological Clearance Lake Zurick Arizona Siting,Permitting 115kV Yes Yes Lamoureux Canada Siting,Permitting 240kV Yes Yes Liberty to Gila Bend Arizona Siting,Permitting 230kV BLM ER Yes Yes Maalaea-Lahaina and Naalae Hawaii Siting,Permitting 69kV Yes Project Malin to Alturas California,Cultural Assessment 230kV BPA EIS Oregon Mandan Transmission Project South Dakota Visual Assessment S$00kV Yes Yes Mead/McCullough to California,Feasibility,Siting,S00kV BLM EIS Yes Yes Victorville/Adelanto*Nevada Permitting McGuireville*Arizona Siting,Permitting 69kV FS EA Mead to Phoenix*Arizona,Feasibility,Siting,500kV Western,EIS Yes Yes Nevada Permitting BLM Metro Northwest Arizona Feasibility,Siting 69kV Missoula to Hamilton Montana Siting,Permitting 161kV Yes Yes Missoula to Philipsburg Montana Siting,Permitting 69/230kV |FS Yes Muddy Creek Wyoming Permitting FERC ER Muggins Mountain Re-Route*Arizona Siting,Permitting S500kV BLM EA Yes Yes A-12 Selected Utility Project Experience Dames &Moore Page 4 of 7 NEPA Federal Document State/Local Expert Project Name Location Nature Voltage Agency Prepared Permits Testimony Navajo South Project N Mexico,Feasibility 500kV Nevada, Arizona Navajo Transmission Project*N Mexico,Feasibility/Siting 500kV Western, Arizona,BIA Utah,Nevada New Denver Airport*Colorado Siting,Permitting 230kV FAA EA Yes Yes New Mexico,Arizona,and N Mexico,Feasibility S00kV Southern California Arizona, Transmission Project California NMGS Out-of-State N Mexico,Feasibility,Siting 500kV BLM Transmission *Arizona, Nevada,Utah, California Nevada to Arizona*Arizona,Permitting 500kV Western EA Nevada Newman to Port-of-Entry N Mexico,Siting,Permitting 345kV BLM EIS Yes Texas North Valley Route California Siting,Permitting S500kV BLM ER Northern Arizona Regional Arizona,N Feasibility 345kV Western Overview Mexico 500kV Norton to Tesuque N Mexico Siting,Visual,Land Use 115kV BIA EA Oak Creek to Comville*Arizona Siting,Permitting 69kV FS EA Ole Project N Mexico Permitting 345kV FS/BIA Yes Yes Palo Verde Nuclear Generating Arizona Siting,Permitting 500kV NRC ER Yes Yes Station Transmission System #1 Patriot to Gwynneville Indiana Siting 345kV Yes Pauline to Mark Moore Nebraska Siting 345kV Yes Potrero #7 California Cultural,Visual,Permits 230kV Yes Pinnacle Peak to Lone Peak to Arizona Assessment,Permitting 230kV Yes Yes Paradise Valley PVNGS to Kyrene Arizona Siting,Permitting 500kV BLM ER Yes Yes Queen Valley to Dinosaur Arizona Siting,Permitting 230kV FS Yes A-13 Selected Utility Project Experience Dames &Moore Page 5 of 7 NEPA Federal Document State/Local Expert Project Name Location Nature Voltage Agency Prepared Permits Testimony Rifle to San Juan*Colorado,N Feasibility,Siting,345kV REA,Yes Yes Mexico Permitting FS, BLM Sacree Substation to #36 Canada Visual,Simulations 138kV Substation Santa Cruz Transmission Arizona Permitting 115kV Fs,PEA Yes Yes Project*BLM Santa Rosa to Gila Bend*Arizona Siting,Permitting 230kV BLM EA Yes Yes Scottsdale Facility Siting Arizona Siting,Permitting 69kV FS Silver King to Hayden Arizona Siting,Permitting 230kV BOR,ER FS Silver King to Queen Valley Arizona Siting,Permitting 500kV BOR,ER Yes Yes 230kV FS 115kV Southern Arizona Transmission Arizona,Siting,Permitting S500kV BLM EIS/ER Yes Project California Southwest Intertie Project*Idaho,Siting,Permitting S00kV BLM EIS Yes Yes Nevada,Utah Southwest Powerlink (aka Arizona,Siting,Permitting,S00kV BLM EIS Yes Yes APS/SDG&E Interconnection California Cultural Assessment and 230kV Project)*Monitoring 161kV 69kV Southwest Project*Colorado Visual Assessment 345kV REA EA Springerville to Deming New Mexico,Visual Assessment,345kV BLM, Arizona Public Involvement Fs SPS to QP Group*Texas,New Siting,Permitting 345kV BLM,EIS Mexico,DOE, Mexico DOD SRP Fossil Fuel Siting Study Arizona Feasibility S00kV Sundance to South Entwistle Canada Siting,Permitting 240kV Yes Yes Selected Utility Project Experience Dames &Moore Page 6 of 7 NEPA Federal Document State/Local Expert Project Name Location Nature Voltage Agency Prepared Permits Testimoay Sundesert Nuclear Project Transmission System Plant Site to Devers and Miguel California Feasibility,Siting,SO0kV NRC,Yes Permitting BLM Devers to Rainbow California Feasibility,Siting,S00kV NRC,Yes Permitting BLM Miguel to Los Caches to California Siting,Permitting 230kV NRC,Yes Mission Tap BLM Plant Site to Devers to California Feasibility,Siting 500kV Victorville to Lugo Devers to Valley to Baldy California Siting 500kV to Mira Loma Tower-Picadilly-Front Range Colorado Siting,Permitting 230kV Yes Project West Lake Hills Circuit 912 Texas Siting,Permitting 138kV Yes Yes Western States Intertie Project Idaho,Feasibility,Siting 500kV Nevada,Utah, Oregon, Arizona White Pine Power Project*Nevada Feasibility,Siting,500kV BLM EIS Yes Yes Permitting White Tanks to West Phoenix Arizona Siting,Permitting 230kV BLM Yes Yes Willow Lake to Bald Mountain*Arizona Siting 69kV FS Wood River to Ketchum*Idaho Siting,Permitting 138kV FS,EIS Yes BLM A-15 Selected Utility Project Experience Dames &Moore Page 7 of 7 Abbreviations Used BER -Borrower's Environmental Report EIS -Environmental Lmpact Statement (NEPA) BIA -Bureau of Indian Affairs ER -Environmental Report (NEPA) BLM -Bureau of Land Management ERCB -Energy Resource Conservation Board BOR -Bureau of Reclamation EXH E_-Exhibit E BPA -Bonneville Power Administration EXH V_-Exhibit V CE -Categorical Exclusion FERC -Federal Energy Regulatory Commission CEC -Certificate of Environmental Compatibility FS -U.S.Forest Service COMP _-Construction,Operations &Maintenance Plan NRC -Nuclear Regulatory Commission DoD Department of Defense PA -Plan Amendment DOE -Department of Energy PEA -Preliminary Environmental Assessment EA -Environmental Assessment (NEPA)REA -Rural Electrification Administration EIA -Environmental Impact Assessment SDEIS -_-Supplemental Draft EIS ER -Environmental Impact Report Western -Western Area Power Administration -Third Party Consulting Assignment A-16 APPENDIX B SAMPLE TABLES OF CONTENTS Section 1.0 2.0 3.0 HEALY TO FAIRBANKS INTERTIE MACRO-CORRIDOR ANALYSIS AND PROJECT ALTERNATIVE REPORT TABLE OF CONTENTS PROJECT DESCRIPTION AND NEED Sd Cr PS i1.1.Project Description 1.2 Purpose and Need i i Se i a a ALTERNATIVES EVALUATION ............0.000 cee ee ee eee ete eee teen 2.1 No Action Alternative ..........0.0...cee ee ee ee ee eee ee eee nna 2.2 Other Alternatives Considered2.3 Preferred Alternative ey i i i i i ALTERNATIVE ROUTE IDENTIFICATION PROCESS AND MACRO-CORRIDOR ANALYSIS 3.1 Study Area Delineation...0...ee ee eens 3.2.Macro-Corridor Analysis 3.3.Environmental Baseline...2...ee ee eee eee3.4 Opportunities and Constraints...0...ee eee eee ees 3.5.Evaluation Criteria and Process 3.6 Alternative Route Comparison 3.7 Preferred Route Cr ee ee } CY APPENDICES APPENDIX A Summary of Previous Studies on the Healy to Fairbanks Intertie APPENDIX B Baseline and Impact Assessments for Environmental Resources HEALY TO FAIRBANKS INTERTIE ENVIRONMENTAL ASSESSMENT TABLE OF CONTENTS Section 1.0 SUMMARY OF ENVIRONMENTAL ASSESSMENT 2.0 PROJECT DESCRIPTION AND NEED ..........0.00 cece eee eee eee ee ee eee 2.1 Project Description 2.2 Purpose and Need ed Sd 3.0 ALTERNATIVES EVALUATION 3.1 No Action Alternative 2.2...0.ee ee tee ee eee ene 3.2 Other Alternatives Considered 3.3.Preferred Alternative Cr | i Y 4.0 AFFECTED ENVIRONMENT 4.1 Introduction...2...ee ee ete eee ee eee 4.2 Climate/Soils/Geology 4.3 Aquatic Biology ...2...ee ne tee eens 4.4 Wildlife and Habitat 4.5 Wetlands/Vegetation 2.2.....ce eee teens4.6 Cultural and Historical Resources ...0.2....ec ee ee eee ees 4.7 Socioeconomic/Sociopolitical Resources 4.8 Visual and Recreational Resources ee ee 2 ed CS 2 i i 5.0 ENVIRONMENTAL CONSEQUENCES 3.1 Introduction...ee ee ee eee ee eens 5.2 Aquatic Biology ..2....eeeeeeeeeeeeee 5.3 Wildlife and Habitat 5.4 Wetlands/Vegetation 2.2...2.....ee ee ee tee ne eens 5.5 Cultural and Historical Resources ..2...0.cee ee ee ee ee eens 5.6 |Socioeconomic/Sociopolitical Resources 5.7.Visual and Recreational Resources 5.8 Electromagnetic Fields Ce ey SS Oe i i i i 2 Cr i CS 6.0 SUMMARY OF PERMITTING REQUIREMENTS APPENDIX C CURRICULUM VITAES FOR KEY PERSONNEL Curriculum Vitae Title Expertise Experience with Firm Dames &Moore MARY COCKLAN-VENDL Senior Environmental Scientist Environmental Regulations/Permitting/Compliance Hydrology/Marine Environmental Investigations Environmental Impact Assessments Oil Spill Contingency Planning/Oil Pollution Control Ms.Cocklan-Vendl has twelve years experience in the environmental field with private consulting firms as well as local,state and federal agencies.Her experience includes regulatory permitting and compliance,regulatory strategy studies,water resource planning,water quality investigations,hydrologic modeling,oil spill analyses,and flood studies.She joined Dames & Moore in 1988. e Developed a permitting strategy associated with spill response and remediation efforts at Indian Booster Station near Anchorage,Alaska.This strategy included coordination with the State of Alaska Office of Management and Budget,Division of Coordination (DGC)to obtain a consistency determination with the Alaska Coastal Zone Management Program and subsequent permits from Alaska Department of Environmental Conservation (ADEC)for a wastewater discharge permit;Alaska Department of Natural Resources (ADNR),Division of Water for a temporary water use permit;and ADNR,State Parks for a Park Use Permit. ¢Evaluated environmental permitting requirements and develop a permitting strategy for a potential port development project.The permitting strategy is developed to satisfy National Environmental Policy Act (NEPA)requirements for an Environmental Impact Statement (EIS)with concurrent application for DGC consistency and applicable project construction and operating permits. *Assessed potential environmental permitting requirements for a proposed feed preparation unit in central Alaska.This assessment identified applicable NEPA and permitting requirements,evaluated the existing environmental information pertinent to the project with identification of environmental data gaps,and estimated a schedule for meeting environmental regulatory requirements and obtaining project permits. ©Prepared a Reclamation Plan for Red Dog Mine in northwest Alaska to meet ADNR, Division of Mining regulations.Development of the reclamation plan included coordination primarily with ADNR and ADEC to identify specific environmental issues to be addressed in the reclamation plan. ®Conducted an environmental analysis for the Copper Valley Intertie Project Feasibility Study.A preliminary scoping meeting was conducted with applicable State and Federal agencies (ADEC,Alaska Department of Fish &Game (ADF&G),ADNR,State Historic Preservation Office (SHPO),U.S.Army Corps of Engineers (COE),U.S.Fish &Wildlife Service (USFWS),and U.S.Environmental Protection Agency (EPA))to identify issues of concern.In addition,public participation meetings were held to identify public concerns MARY COCKLAN-VENDL,page -2- Past Experience Academic Background Dames &Moore along the proposed intertie route.The analysis was conducted in a manner which could be converted into an Environmental Assessment (EA)for NEPA purposes should the proposed intertie become a viable project and an EA was required. Conducted an environmental permitting case study of Red Dog Mine for U.S.Bureau of Mines to assess regulatory incentives and disincentives to metal mine development in Alaska. Preparation of oil spill contingency plans for Alaska North Slope onshore and offshore drilling activities for BP Exploration (Alaska),Inc.These plans covered area-wide production and development facilities as well as individual onshore and offshore drilling facilities.Assessed environmental compliance with ADEC spill prevention and response regulatory requirements during drilling operations.Conducted workshops and participated in North Slope drills related to environmental response and compliance associated with oil and hazardous materials spills. Conducted environmental audits of offshore drilling and production facilities in the Gulf of Mexico to assess compliance with applicable environmental regulations. Independent Consultant,Houston,Texas (1988). Participated in conducting oil spill response training for British Petroleum. Staff Environmental Scientist,Woodward-Clyde Consultants,Anchorage,Alaska (1983-1984). Preparation of a generic oil spill contingency planning document that was adopted by five major oil companies for use in meeting state and federal regulatory requirements for offshore Alaska Exploration. Designed and conducted a comprehensive and cost-effective water quality monitoring program to assess possible leakage from a north slope drill site mud pit. Evaluation and documentation of water source,waste disposal,and flooding and erosion hazards for 56 rural communities in the Yukon-Kuskokwim region of Alaska. Compilation of physical,geologic,and oceanographic information for use in environmental reports for Alaskan offshore drilling. Preparation of the water quality section for a FERC license application for a 90-megawatt Bradley Lake Hydroelectric Project in southcentral Alaska. Independent Consultant,Anchorage,Alaska (1981-1983) Provided drafting services for Husky Oil in updating numerous well logs. Drafted a series of area maps for use in the Anchorage Area Atlas. Post-Graduate Studies,Environmental Engineering,University of Texas M.S.,Environmental Science,Northern Ilinois University B.S.,Environmental Science,Northern Ilinois University A.S.,Physical Science,College of Lake County Curriculum Vitae MARYELLEN TUTTELL Title Environmental Planner Expertise Environmental Permitting and Regulatory Compliance Land Use Planning Socioeconomics Public Involvement Experience with Firm Responsible for land use and socioeconomic impact analyses for environmental impact statements on large projects including utility corridors.Has recently served as task manager and overall coordinator on large multidisciplinary studies and reports.Provides permitting for a variety of projects and planning services including mine reclamation plans and oil discharge prevention and contingency plans.Experienced in developing and implementing public involvement programs. Joined Dames &Moore in 1993. Project Environmental Planner Dames &Moore Coordinated preparation of an environmental analysis for a 135-mile transmission line corridor from Sutton,Alaska to Glennallen,Alaska.Prepared socioeconomic and land use sections of the feasibility study associated with the project.Prepared meeting summaries for public meetings held throughout the project study area and maintained a 100-plus name project mailing list. Task Manager for permitting and public involvement activities for the Indian Fuel Spill Cleanup project located in Chugach State Park.Permitting agencies included the Alaska Department of Environmental Conservation,the Alaska Department of Natural Resources Division of Water and Division of State Parks,the Alaska Department of Fish &Wildlife, the Municipality of Anchorage and the Department of Governmental Coordination.Other groups included in project review included the Cook Inlet Regional Citizens Advisory Council and the Indian Task Force,made up of local citizens.Permitting activities included preparation of permit applications,response to questions from agencies and the public, negotiations with agency personnel on permit conditions,and coordination with agency personnel on monitoring and reporting requirements throughout the permit life.Public involvement activities included task force meetings,preparation of project newsletters, maintenance of project mailing lists and one-to-one coordination with media representatives and members of the community. Task Manager for preparation of Oil Discharge Prevention and Contingency Plans (ODPCPs)for six remote Air Force sites throughout Alaska.Includes coordination with the Alaska Department of Environmental Conservation,the Alaska Department of Governmental Coordination,the U.S.Coast Guard,and the U.S.Environmental Protection Agency. Task Manager and Principal Investigator for land use,subsistence,agency coordination and public involvement activities associated with a hazardous waste assessment on a former military site in Northway,Alaska. MARYELLEN TUTTELL,page -2- Past Experience Dames &Moore Preparing a mine reclamation plan in accordance with Mining Reclamation Regulations,11 AAC 97,for a zinc and lead mine in the northwest Alaska.The project includes coordination and negotiations with the Alaska Department of Natural Resources,Division of Mining. Provided review of topsoil salvaging and revegetation decisions for a Surface Coal Mining Permit Application for the Alaska Department of Natural Resources,Division of Mining. Tasks included preparing a chronology of decisions and summarizing the bases for these decisions,as well as identifying conflicting decisions made by the Division of Mining. Finalized ODPCPs for fuel storage facilities in Barrow,Wainwright and Fairbanks,Alaska, as well as for an offshore exploratory well in the Beaufort Sea,Alaska. A total of six years of experience in socioeconomic analysis,public involvement and planning, both in the public and private sectors.Experience includes environmental impact analysis, socioeconomic impact analysis,fiscal impact analysis,permitting,water resource planning,land use planning,and public involvement program development and implementation. Associate Transportation Planner,Municipality of Anchorage,Department of Community Planning and Development,Transportation Division,Anchorage,Alaska (1992-1993) Developed and implemented public involvement programs for various transportation projects including a revision of the Municipality's Official Streets and Highways Plan and the Long Range Transportation Plan for Eagle River.These programs included such aspects as citizen forums,open houses,project newsletters,and media contacts. Developed comprehensive public involvement program for the Anchorage Metropolitan Area Transportation Study (AMATS).This program was designed to incorporate public input into the transportation planning process on an on-going basis.Program components included an annual report and transportation survey,development of an AMATs mission statement,a transportation information hotline,monitoring the media,and use of existing clubs and organizations for increasing public awareness of transportation issues. Responsible for air quality issues related to transportation projects,including analysis of an oxygenated fuel program and other alternatives proposed for reducing carbon monoxide emissions in Anchorage.Included coordination with representatives of the Municipality's Department of Health &Human Services,the Alaska Department of Environmental Conservation,and the U.S.Environmental Protection Agency. Senior Planner,Moore/Bowers,Tampa,Florida (1990-1992) Prepared enviornmental licenses applications for electric utility projects under Florida licensing regulations. Provided socioeconomic and land use analysis on electric power plants for environmental licensing applications throughout Florida. Provided socioeconomic and land use analysis for various corridor projects throughout Florida,including transmission line corridors,natural gas pipelines,and roadway corridors. MARYELLEN TUTTELL,page -3- Academic Background Professional Affiliations Dames &Moore ¢Participated in implementation of major public involvement programs designed for controversial electric transmission line projects and transportation corridor projects throughout Florida. Water Shortage Coordinator/Water Use Planner,Southwest Florida Water Management District, Brooksville,Florida (1988-1990) ©Represented the Water Management District in meetings with local law enforcement and local utility officials. ¢Represented the Water Management District in statewide water shortage meetings with other water management agencies. ©Made presentations to various professional and civic organizations on water use in southwest Florida,the need for water use restrictions,and what the restrictions meant to them. e Coordinated collection and analysis of water supply and water demand data. *Developed and implemented water shortage policies during extended drought. ¢Developed and implemented public education and information programs regarding water shortage policies. ©Provided analysis of water use trends and population trends in Water Use Caution Areas. Resource Economist,Reynolds,Smith and Hills,Inc.,Tampa,Florida (1987-1988) e Provided socioeconomic and fiscal impact analyses of large development projects. e Prepared utility elements of local government comprehensive plans. M.S.(1987)and B.S.(1983),Food and Resource Economics,University of Florida, Gainesville,Florida American Institute of Certified Planners (AICP) American Planning Association (APA) Curriculum Vitae TITLE EXPERTISE EXPERIENCE WITH FIRM Dames &Moore DAVID E.ERIKSON Senior Environmental Scientist Over 20 years experience in wildlife ecology,terrestrial habitat evaluation and wetlands delineation,impact analysis of resource development projects in Alaska Mr.Erikson has participated in a wide range of environmental studies for resource development projects since he joining Dames &Moore in 1977. Environmental Compliance Officer for Bradley Lake Dam and Hydroelectric Project, Homer,Alaska.Also conducted a multi-year study on the effects on the dam on downstream fish populations in the Bradley River. Wetlands delineation,agency coordination and permiting for Makushin Geothermal Electric Generation Project,Unalaska,AK. Field Investigator for fisheries studies and weland delineations on the three proposed dam project in the Bristol Bay region including the Tazinina River,Newhalen River and the Lake Elva Hydroelectric Projects,Bristol Bay,Alaska. Field Investigator for surveys of for nest sites of the endangered peregrine falcon on the Fortymile River and the Kivalina and Wulik Rivers in western Alaska. Field Investigator for baseline terrestrial wildlife studies and habitat surveys of proposed tailings dam sites for the AJ and Kensington Gold Mine Projects,Juneau,Alaska. Chief Scientist and Field Investigator for effects studies on intertidal communities and marine birds populations,and subsistence resources in the Gulf of Alaska and Prince William Sound following the Exxon Valdez oil spill Field Investigator for wildlife studies which including aerial surveys for fall and winter moose distribution for the Wishbone Hill Coal Mine Project,Palmer,Alaska. Principal Investigator for terrestrial habitat analysis for the Diamond Chuitna Coal Mine Project EIS. Principal Investigator for baseline terrestrial bird studies and marine mammal surveys for the Red Dog Lead/Zinc Mine,Northwest Alaska,for Cominco American,Inc. Principal Investigator for habitat evaluation and impact analysis for the Prudhoe Bay Waterflood EIS. Field Investigator for baseline environmental studies of the proposed asbestos mine in the Forty Mile River drainage which included overwintering studies on Arctic grayling. DAVID E.ERIKSON,page -2- PAST EXPERIENCE PROFESSIONAL AFFILIATIONS ACADEMIC BACKGROUND SELECTED PUBLICATIONS Dames &Moore ¢Principal Investigator for terrestrial habitat analysis for the Diamond Chuitna coal mine project environmental impact statement. ¢Principal Investigator for baseline wildlife biology and habitat studies for the Red Dog lead/zinc mine in northwest Alaska. e Alaska Department of Fish &Game,1976-1977.Project Leader.Marine bird studies in Lower Cook Inlet involving extensive aerial seabird and waterfowl surveys and Bald Eagle nest surveys. ¢U.S.Fish &Wildlife Service,Ecological Services,1973-75.Fishery Biologist.Worked on several freshwater and marine fishery projects in Southeast Alaska. e Alaska Department of Fish &Game,1973.Fishery biologist.Commercial fisheries research projects,King Salmon,AK. e Alaska Department of Fish &Game,1970-1972.Fishery technician.Crew leader -fish counting field camps.King Salmon,AK. Cooper's Ornithological Society American Ornithological Union Wilson's Ornithological Society Association of Field Ornithologists 1966-1967,University of Alaska,Fairbanks,Alaska 1967-1971,University of Nevada,Reno,B.S.in Wildlife Biology 1971-1972,University of Nevada,Reno,M.S.in Biology Erikson,D.E.,1977.Distribution,abundance,migration andbreeding locations of marine birds in lower Cook Inlet,Alaska.Alaska Department of Fish &Game,Environmental Studies of Kachemak Bay and lower Cook Inlet,Vol.VII,182 pp. Hemming,J.E.and D.E.Erikson,1979.Birds of Port Valdez.Dames &Moore.Prepared for Alaska Petrochemical Company. Hemming,J.E.and D.E.Erikson,1979.The Birds of the Island Flats Area,Valdez,Alaska. Dames &Moore.Prepared for the City of Valdez. Houghton,J.,D.E.Erikson,W.Blaylock,and J.Christofferson,1982.Environmental Analysis of the St.George Harbor Project,Zapadni Bay,Pribilof Islands,Alaska.Prepared for Alaska Department of Transportation and Public Facilities by Dames &Moore,Anchorage, Alaska. Erikson,D.E.and L.Hetinger,1983.Environmental Baseline Studies,Red Dog Project; Terrestrial Biology.Prepared for Cominco Alaska,Inc.by Dames &Moore,Anchorage, Alaska. Erikson,D.E.,1983.Environmental Baseline Studies,Red Dog Project;Fall 1983 Bird Survey. Prepared for Cominco Alaska,Inc.by Dames &Moore,Anchorage,Alaska. DAVID E.ERIKSON,page -3- Erikson,D.E.,1983.Environmental Baseline Studies,Red Dog Project;Waterfowl and Shorebird Breeding Survey.Prepared for Cominco Alaska,Inc.by Dames &Moore, Anchorage,Alaska. Dames &Moore Curriculum Vitae Title Expertise Experience With Firm Dames &Moore GREGORY J.GAULT Environmental Planner/Project Manager Visual Analysis and Assessment Recreation Analysis and Planning NEPA Project Management Since joining Dames &Moore in February 1987,Mr.Gault has diverse experience providing project coordination,NEPA compliance,and environmental planning services for high-voltage transmission facilities,pipeline,highway,rehabilitation,and recreation projects in the westem United States and Alaska. Visual Resource and Recreation Planning Analysis Principal Investigator for visual resources and recreation on a 138kV transmission line feasibility study for the Alaska Power Authority.Conducted agency contacts,field reconnaissance,site photography,and coordinated with project engineers to determine alternative routes through the Talkeetna Range. Principal Investigator for visual resources on the City of Seward EA,a 115kV transmission line upgrade project,on the Chugach National Forest in Alaska.Conducted field reconnaissance and verification of visual resource inventory,developed and implemented of resource analysis and impact assessment methodologies,and prepared of NEPA documentation. Principal Investigator for visual and recreation resources on the Tyee-Swan Lake Intertie, a transmission line feasibility study project for the Alaska Energy Corporation,on the Ketchikan Area of the Tongass National Forest.Reviewed existing visual and recreation resource inventories,conducted preliminary assessment of potential routing corridors,and documented opportunities and constraints for transmission line routing. Resource Manager for visual resources for Navajo Transmission Project EIS/PA,a 5OOkV transmission line project (ongoing).A multi-jurisdictional project that includes three BLM districts,two National Forests,and several National Monuments and National Recreation Areas.Responsible for agency contacts,field inventory and data collection,development and application of visual analysis and impact assessment methodologies using Arc/Info GIS, and site photography.Coordinated the preparation of visual simulations,and prepared EIS documentation and supporting technical reports. Principal Investigator for visual resources and land use for Southwest Intertie Project EIS/PA,a 500kV transmission line project.A multi-jurisdictional project that includes six BLM districts,two National Forests,Hagerman Fossil Beds National Monument,and the Great Basin National Park.Responsible for field inventory and data collection,development and application of visual analysis and impact assessment methodologies using GIS,conducted GREGORY J.GAULT, Dames &Moore page -2- field video documentation and site photography,coordinated the preparation of photo-simulations,and prepared EIS documentation and supporting technical reports. Principal Investigator for visual resource and lands use for the Austrop-McNeil 345kV transmission line routing study for the City of Austin,Electric Utility Department. Developed and applied of the visual inventory and analysis methodology for urban utility planning.Prepared resource inventory maps and presentation maps,conducted field review and site photography,conducted viusal analysis,and prepared report documentation for an environmental assessment. Principal Investigator for visual,recreation,and Jand use resources for the Questar Mainline No.41 Project EIS,a major gas pipeline reroute through the Manti-La Sal National Forest and lands administered by the Moab District of the BLM in Utah.Conducted data collection for inventory,prepared opportunity and constraint mapping,developed analysis and impact assessment/mitigation planning methodologies. Principal Investigator for visual,recreation,and land use resources on a major gas pipeline reroute through the Manti-La Sal National Forest in Utah.The EIS was completed as a third-party contract with Questar Pipeline Company,Coastal States Energy Company,and the USDA Forest Service.Conducted data collection for inventory,developed analysis and impact assessment/mitigation planning methodologies for visual resources.Evaluated the potential impacts to existing and proposed recreation facilities. Principal Investigator for visual resources and land use on fiber-optic cable projects for US Sprint,US WEST,MCI,and AT&T in several western states.Conducted field inventory, field video documentation,agency contacts,data collection and analysis,impact assessment and mitigation planning,and document preparation for environmental assessments (EAs). EAs were prepared each of these projects under third party contracts with the several districts of the BLM and Forest Service. Resource Manager/ID Team member for visual and recreation resources on the Eight Fathom Bight Timber Sale EIS for the Chatham Area of the Tongass National Forest. Coordinated update and refinement of GIS inventory layers;field verification;video _simulations of alternatives as viewed from marine-based photo points;development andimplementationofresourceanalysis,impact assessment/mitigation planning methodologies; and preparation of technical resource report supporting EIS documentation. Principal Investigator for visual resource,wilderness,and recreation studies for the Katmai Research Drilling Project EIS,a scientific endeavor to learn more about the volcanism that created the Valley of Ten Thousand Smokes in Katmai National Park and Preserve,Alaska. The project is proposed in an area that is designated wilderness.Conducted literature review,data collection,and field inventory including site photography and video documentation of project area.Developed impact assessement methodology based on "Limits of Acceptable Change"planning process to determine potential project effects on wildemess values.Prepared EIS documentation and supporting technical reports. Resource Manager for visual resources,recreation,and roadless/wilderness studies on the Wasache-Cache and Ashley National Forests Oil and Gas Leasing EIS.Assisting Forest Service in preparing the technical resource reports and EIS to identify federal lands available for leasing of potential oil and gas.Responsible for field inventory,data collection and application of visual analysis and impact assessment methodologies and documentation. GREGORY J.GAULT,page -3- Past Experience Dames &Moore Project Management/Coordination Project Coordinator on the Missoula-Philipsburg Transmission Upgrade Project for Montana Power Company.Coordinated the data collection,inventory,and analysis of environmental resource data for the regional study analysis;guided the development and implementation of the impact assessment/mitigation planning process on GIS for the corridor analysis;and coordinated the preparation of technical reports and Certificate of Environmental Compatibility and Public Need.This multi-jurisdictional project affected lands administered by the Butte District of the BLM,the Deerlodge and Lolo National Forests,and the State of Montana. Project Coordinator on the Wood River to Ketchum 138kV transmission line project for Idaho Power Company.Coordinated extensively with the Sawtooth National Forest and Shoshone District of the BLM,co-lead agencies.Also coordinated the data collection, inventory,and analysis of environmental resource data for the regional study analysis;the detailed corridor analysis;and the preparation of technical reports and the Draft EIS. Resource manager for the land use,recreation,and visual resource studies. Assistant Project Manager on the Southwest Intertie Project EIS/PA,a 500kV transmission line in Idaho,Utah and Nevada.Responsible for coordination of resource studies,data management,and document preparation.Coordinated the development and application of GIS computer models designed to automate impact assessment and mitigation planning process for linear projects.In addition,served as principal investigator for visual resources and land use. Project Coordinator on the preparation of Construction,Operation,and Maintenance Plans in New Mexico for the Gila National Forest and Plans of Development for the Las Cruces and Socorro Districts of the BLM as part of the Arizona Interconnection Project EIS/Plan Amendment. Site Reclamation and Rehabilitation NERCO DeLamar Silver Mine Wetlands Rehabilitation -assisted the preparation of a wetlands mitigation plan for the planned loss of wetland areas for the proposed Stone Cabin Mine development in southwestern Idaho.The plan,part of the application for a permit under Section 404 of the Clean Water Act,proposed to rehabilitate a reach of Jordan Creek, which had been mined for gold nearly 100 years ago. US WEST Fiber-optic Line Rehabilitation Project -Coordinated the preparation of plans for the recountouring,rehabilitation,and revegetation of areas disturbed by the installation of fiber-optic cable from Dewey to Flagstaff,Arizona through visually sensitive areas of the Coconino and Prescott National Forests. Prior to joining Dames &Moore,Mr.Gault was involved in a variety of projects which included: ®Planner/designer with major developer in Austin,Texas.Responsible for conceptual land use plans,regional development mapping,and streetscape and entrance designs for several multi-use developments. GREGORY J.GAULT,page -4- Academic Background BS,Landscape Architecture,Texas A&M University,College Station,Texas Publications Co-author of "Electrifying the Impact Assessment Process",presented at the 1991 National Association of Environmental Professionals NEPA Symposium in Baltimore, Maryland and published in The Environmental Professional,Volume 14 pp.50-59. 1992., Dames &Moore Curriculum Vitae Title Expertise Experience With Firm Dames &Moore GARY L.HAYWARD Principal Environmental Compliance/Permitting Environmental Impact Assessments Siting/Planning Analyses Senior Project Manager and Principal Investigator,1980-Present Project Director for an Environmental Assessment (EA)and environmental permitting strategies for siting a Drug Enforcement Agency training facility at Quantico Marine CorpsBase,Quantico,Virginia. Management of a large multidisciplinary Environmental Impact Statement (EIS)to address impacts resulting from the addition of major activities and an Environmental Assessment (EA)for the deactivation of the SR-71 high altitude reconnaissance program at Beale Air Force Base,California. Managed the preparation of an Environmental Assessment (EA)for the construction and operation of a "Relocatable-Over-the-Horizon-Radar"facility on Amchitka Island in the Aleutian Archipelago,Alaska,for the U.S.Navy. Management of environmental studies and permitting support activities for an overall site evaluation program for extension of the National Air and Space Museum to either Dulles or BWI airports. Management of the preparation of a multidisciplinary EIR for a wastewater pipeline and assessment of impacts of land application of wastewater at several public recreational areas for the Los Angeles Department of Water and Power. Management and preparation of a multidisciplinary Environmental Impact Report (EIR)for a 100-acre expansion to Master's College,Los Angeles. Management of the multidisciplinary state EIR for a permanent fire station in the vicinity of Gaviota,California,on behalf of Santa Barbara County. Management of the preparation of a multidisciplinary state EIR for shipyard modernization facilities in Los Angeles Harbor for Todd Pacific Shipyards. Management of the preparation of a multidisciplinary SEIR for the siting of a permanent elementary school along the Santa Barbara County coastline for the Vista Del Mar School. Management of a project to identify suitable sites for combustion fly ash placement within a defined radius of the source power plant in a highly-developed urban area.This study also GARY L.HAYWARD,page -2- Academic Background Publications and Presentations Dames &Moore satisfied the U.S.Army Corps of Engineers requirement for an Alternatives Analysis in conjunction with a Clean Water Act Section 404 permit application. Management of environmental studies and permitting support activities for a 2,400-acre site development in Charles County,Maryland,adjacent to the Potomac River. Management of environmental studies to assess the potential for construction of a proposed marina in Charles County,Maryland. Developed environmental assessment of environmental effects of proposed construction and operation of oil platforms and associated pipelines in Santa Barbara Channel. Preparation of an Environmental Analysis for liquefied natural gas facilities at Kenai, Alaska,for Phillips and Marathon. Technical consultation to Vulcan Materials relating to regulatory compliance/permitting services for a new 350-acre meta-basalt quarry in Stafford County,Virginia. Assessment of the environmental effects of and assistance in acquisition of environmental permits for construction of a large groin to stabilize dynamic coastline in Santa Monica Bay. M.S.,Marine Science,University of South Florida,1979 B.S.,Geology,New England College,1973 A list of Mr.Hayward's publications and presentations is available upon request. Curriculum Vitae TITLE EXPERTISE EXPERIENCE WITH FIRM Dames &Moore DOUGLAS S.WASHBURN,P.E. Senior Geotechincal Engineer Geotechnical and Arctic Engineering Geophysical Investigations and Interpretation Environmental,Ground Water,and Geologic Investigations Mr.Washburn has over thirteen years of geoscience experience in the South,West,and in Alaska including six years of geotechnical and cold regions engineering experience in Alaska. His responsibilities have included cost estimates,proposals,research,planning,field work, laboratory work,analysis,interpretation,reporting,project management,and client relations with private,native,commercial,military,and government agencies.Since joining Dames & Moore in July of 1989,Mr.Washburn has worked on the following projects. Echo Bay Mines,Kensington Mine,Alaska -Field Manager and Principal Investigator on a geotechnical and geological site investigation of a tailings dam and pond,and for water supply and diversion dams near Juneau.The project consisted of drilling 1,700 feet of glacial till and bedrock,installing ground water monitoring wells,and performing on-site hydrogeologic tests. Cambior Alaska,Inc.,Valdez Creek Mine,Alaska -Senior Review Engineer for the design and construction of an 8,000 foot long stream diversion and dike system.The diversion was used to intercept and route the stream flow to the edge of the floodplain where gravels up to 200 feet thick were placer mined.Key elements of the work included a geotechnical investigation;hydraulic and slope stability analyses;the design of the channel and a large- diameter,multiple culvert,haul road crossing;and the preparation of construction drawings and specifications. Cook Inlet Region,Inc.,Anchorage,Alaska -Project Manager and Principal Investigator on a sand and gravel resource assessment.The project consisted of aerial photographic interpretation,reconnaissance glacial land form mapping and sampling,electromagnetic resistivity surveying,test pit excavating,laboratory testing,and land use,zoning,and quarry development considerations on a total of 785 acres. BP Exploration,Inc.,Prudhoe Bay,Alaska -Project Manager and Senior Geotechnical Engineer on a geotechnical investigation along the Endicott Causeway.The project consisted of drilling,sampling,installing thermistor wells,laboratory testing,and recommending design criteria for a large diameter,deep pile foundation system in permafrost. Arctic Slope Consulting Group,Kalskag,Alaska -Project Manager and Principal Investigator on a geophysical and geotechnical investigation along a proposed access road and quarry site in a remote location near Kalskag on the lower Kuskokwim River.The project involved test pit logging and sampling,and a refraction seismic survey utilizing explosives along the 2.5 mile long road,at the quarry site,and at an alternative quarry site. The data was interpreted and recommendations were made concerning the depth,character, DOUGLAS S.WASHBURN,P.E.,page 2- PAST EXPERIENCE Dames &Moore and some estimated engineering properties of the various soil horizons;the depth to water table;the extent of discontinuous permafrost;and the depth,character,rippability,and some estimated engineering properties of the bedrock. City of Dillingham,Alaska -Project Manager and Principal Investigator on a sewer outfall model study.The project involved the hydrology and hydraulics of mixing primary effluent in the intertidal zone.Assistance was also provided to the client for geotechnical expert testimony. U.S.Forest Service,Ushk Bay,Alaska -Senior Geologist and Geotechnical Engineer for the soils and geologic portions of an environmental impact statement (EIS)for the logging of a remote,43,000 acre site in the Tongass National Forest on Chichagof Island in Southeast Alaska.Responsible for conducting aerial photographic interpretation,geologic and geotechnical field reconnaissance,soil sampling,geomorphological slope stability evaluations,mass wasting hazards identification and mitigation recommendations,field checking problem areas for the logging engineers and timber cruisers,utilizing and upgrading a geographic information system database,completing the soils and geology portions of the design unit cards and road design cards,and for writing the soils and geology portion of the Resource Inventory Report of the EIS.Assistance was also provided to the hydrologists concerning field observations of stream channel morphology,stream bank stability and sensitivity,and erosion potential and steam turbidity,and assisting with the assessment of the impacts to the watersheds and fisheries from mass wasting and erosion. Field work was supported by boats and helicopter,and conducted from a barge camp. Security Pacific Bank,Country Lane Estates,Anchorage,Alaska -Senior Geotechnical Engineer on a geotechnical investigation and evaluation of a failed community septic leachfield for a 44 unit housing development.Nine boreholes were drilled and nine test pits were excavated in order to assess the soils in the area of the failed system and to evaluate alternative sites for a replacement drain field.In-situ soil percolation tests and soils laboratory index tests were performed.Alternative onsite wastewater disposal systems and locations were evaluated. Slana Energy,Inc.,Gakona,Alaska -Senior Engineer on a design and construction quality control and assurance program of an actively refrigerated,supercooled subgrade permafrost and passively refrigerated gravel pad foundation system fora power plant.The project included preparation of design drawings and technical specifications for construction. Cominco,Red Dog Mine,Alaska -Project Civil Engineer responsible for the on-site earthworks construction monitoring of the cutoff trench,wall,and HDPE liner for Stage IV of the approximately 2,500 feet long tailings dam. Engineering Geophysicist and Geotechnical Engineer,Cold Regions Consulting Engineers, Anchorage,Alaska Responsible for engineering,geological,and geophysical data acquisition,interpretation,and reporting of geotechnical site investigations;for assisting project engineers with foundation designs;for field and laboratory testing of soils and construction materials;and for surveying. Projects included the following. U.S.Coast Guard Base Ketchikan Upper Base Facilities subsoils site investigation and foundation designs recommendations (1986)for the club/dining and infirmary buildings;Fort DOUGLAS S.WASHBURN,P.E.,page 3- ACADEMIC BACKGROUND PROFESSIONAL AFFILIATIONS REGISTRATIONS SELECTED PUBLICATIONS Dames &Moore Wainwright (Fairbanks)Housing Project subsoils site investigation,foundation designs recommendations,and construction quality control for 400 townhouse units;Pilot Point septic;Saint Paul seismic survey;Caines Head seismic survey;Central Junior High School retaining wall and playing field;Northwood Elementary School addition;McGrath radio antenna;APU fountain;Elmendorf incinerator;Eklutna Water Treatment Facility tent and pond;USCG Base Ketchikan floating breakwater;Bonnie Lake Diamond Resort;USCG Air Base Sitka hangar extension;Davis Park bicycle path;Abbott Loop Terrace WID;and Elmendorf Arcturus School addition. University of Alaska,Anchorage M.Civil Engineering,Arctic and Geotechnical (1992) B.Sc.Civil Engineering (1987) North Carolina State University,Raleigh Completed M.Sc.Applied Geophysics course work with a mathematics minor and thesis field work for "The Geophysical Investigation of the New Bem,NC,Gravity Low”.(1979-1981) B.A.Geology (1979) B.Sc.Physics (1978) B.Sc.Applied Mathematics (1978) American Society of Civil Engineers Association of Engineering Geologists Environmental and Engineering Geophysical Society Liaison Committee Member Geophysical Society of Alaska Society of Exploration Geophysicists State of Alaska Professional Engineer (1992) Washburn,D.S.,1992.Refraction Seismic Survey of Some Thick Till in Southeast Alaska: Proceedings of the 1992 Symposium on the Application of Geophysics to Engineering and Environmental Problems,Chicago,April 26-29,Society of Engineering and Mineral Exploration Geophysicists,p223-242. Foster,M.L.,D.S.Washbum,and D.S.Foote,1991.OTH-Backscatter Power Plant Foundation Design for Warm,Ice-Rich Permafrost Soils:Proceedings of the International Arctic Technology Conference,Anchorage,Alaska,May 29-31,Society of Petroleum Engineers,p471-480. Nelson,W.G.,and D.S.Washbum,1989.Snow Control on Floating Ice Sheets:Proceedings of the Fifth International Conference on Cold Regions Engineering,St.Paul,MN,ASCE,p161- 169. Washburn,D.S.,and A.Phukan,1988.Discontinuous Permafrost Mapping using the EM-31: Proceedings of the Fifth International Conference on Permafrost,Frondheim,Norway. Curriculum Vitae Title Expertise Experience with Firm Dames &Moore DR.STEPHEN S.SHANER Project Environmental Scientist Aquatic Biology,Ecology,and Toxicology Hazardous Waste,Risk Assessments NEPA Processes and Project Management Water Quality Criteria and Standards Development Effluent and Receiving Water Quality Monitoring Statistical Analysis and Experimental Design Dr.Stephen Shaner has 18 years experience as a professional aquatic biologist and environmental scientist,with six years of teaching and research in universities,and 12 years of environmental work in research laboratories,water quality regulatory agencies,and environmental consulting firms.His experience includes project management,Environmental Impact Statement and Assessment preparation (NEPA processes);risk assessments for spills and groundwater contamination;permit writing,monitoring,and reporting;water quality surveys of biota and for toxic substances;ecological risk assessments;contamination,cleanup,and mitigation assessments;water quality criteria and site specific criteria development;and chemical and biological testing of water and sediments for pollutants. Technical writer and editor for an EIS for a port facility in Puerto Caldera,Chile.Chief field scientist for the environmental baseline survey,and supervised the collection of water,sediment, toxicity testing of sediments,and organism tissue samples,as well as general physico-chemical parameters.Also responsible for major portions of data analysis,interpretation,and reporting. Project Manager of an Environmental Assessment for a transmission line upgrade for the City of Seward,including visual assessments,recreational impacts,and impacts to fish,wildlife, water quality,and timber harvesting,as well as EMF health effects. Project manager of a risk assessment for a spill at an oil production facility in Cook inlet, Alaska,and principal technical preparer for the ecological risk assessment portion.The risk assessment included fate and transport modelling in groundwater,environmental exposure and toxicity assessments,and recommendations for remediation. STEPHEN S.SHANER,page -2- Past Experience Dames &Moore For the National Park Service,performed environmental assessments for hazardous substances at mining claims in Denali National Park.The Project included evaluation and mapping of all hazardous waste sites at a variety of remote sites within the park. Project manager of an Environmental Impact Statement preparation for joint military training exercises throughout Alaska,including effects of hazardous and toxic substances on fish, wildlife,and humans,and measures required for mitigation. Prepared water quality sections of the Katmai Scientific drilling Environmental Impact Statement for the national park Service. Prepared various portions of the Main Bay Hatchery Environmental Imapct Statement for the U.S.Forest Service. Oil spill response planning for North Slope and Cook Inlet oil production facilities,and analyses of north slope spills,causes,and effects (for British Petroleum Exploration). *Co-principal investigator in the design of a water and sediment toxicity testing plan for the Exxon Valdez oil spill. ¢Designed a site specific criteria development program for a consortium of Bay area dischargers.Criteria development was for heavy metals (Cu,Ni,Pb,Zn,Ag)in ambient waters of San Francisco Bay,California. ¢For the municipality of Anchorage,Alaska,conducted and prepared an annual monitoring report of marine biological surveys for fish,invertebrates,benthic infauna,kelp,water quality,and toxic pollutants. ¢Adjunct lecturer in Biology at the University of Alaska,Anchorage,teaching an upper division course in marine biology. ¢Fora consortium of boatyards in the commercial Basin of San Diego,designed a sampling program and analyzed data for an assessment of heavy metal contamination in water, sediments,and biota. ¢Conducted surveys and prepared discharge monitoring reports for marine sewage outfalls in Anchorage (Alaska),and San Diego,San Elijo,and Escondido (California). *Manager of NPDES toxicity testing and toxicity identification evaluation programs at Kinnetic Laboratories,Inc. STEPHEN S.SHANER,page -3- Dames &Moore For the State Water Resources Control Board,Sacramento,California,assisted in development of methods for setting ambient water quality criteria for the State of California. Also assisted in development of water quality criteria for boron,molybdenum,and manganese,and was the principal author of the State Criteria document on selenium (biocaccumulative effects)for the protection of fish,wildlife,and human health. For the California Regional Water Quality Control Board,Sacramento,California,designed and managed an ambient water toxicity testing program,which included use of acute and chronic toxicity testing for assessing water quality impacts of agriculture drainage into various portions of Central Valley rivers.Prepared a manual on guidelines for sampling and analysis of water,sediments,and wastes,and advised the engineering staff on biological effects and toxicity testing,as well as waste discharge and NPDES permit requirements for toxicity. At the University of California,Davis.analyzed and assessed the accumulation of heavy metals in the tissues of the freshwater clamCorbicula fluminea in the San Francisco Bay-estuary. Prepared a report for the Electric Power Research Institute on biological processes in fish compensation (primarily striped bass biology,physiology,and ecology).This report was used for the development of a quantitative mechanistic model for predicting power plant impacts on striped bass populations. Assistant professor of biology at the University College of Bahrain,teaching courses in Marine Biology,Invertebrate Biology,Advanced Invertebrate Zoology,Underwater Research Techniques,and team taught a course in genetics.Conducted research on near shore fauna in the waters of Bahrain. Reviewed research proposals for the government of Bahrain,and made recommendations for improving the experimental designs of proposals submitted to the government for funding.The projects reviewed were concerned with (1)development of an oyster fishery, (2)stock assessment of a commercially important fish species,and (3)the toxic effects of oil refinery discharge on a local fish species. Lecturer in Zoology at the University of California,Davis,teaching an upper division course in Invertebrate Zoology. Manageda project (funded by the U.S.Environmental Protection Agency)at the UniversityofCalifornia,Davis,to develop a methodology for determining the toxicity of heavy metals to invertebrates in sediments.Supervised the work of seven technicians and was responsible for project design,implementation,data analysis,and final written and oral reports,as well as publication. STEPHEN S.SHANER,page -4- ©Lecturer in Biology at San Francisco State University,teaching general Zoology to zoology majors. 'Academic Ph.D.,Biological Ecology,University of California at Davis,1981 Background B.A.,Biological Sciences,San Francisco State University,1975 Professional Ecological Society of America Affiliations American Society of Limnology and Oceanography Languages English,Russian,Spanish Dames &Moore Curriculum Vitae TITLE EXPERTISE EXPERIENCE WITH FIRM PAST EXPERIENCE Dames &Moore ALISON L.SMITH Environmental Planner Permitting and Project Review Coordination Facilitating Project Review/Building Consensus Positions Environmental Planning Environmental Regulatory Analysis Implementation of the Alaska Coastal Management Program Ms.Smith has seven years experience in the environmental field.She has three years of permitting experience with a major State of Alaska permitting oriented agency.She joined Dames &Moore in 1993. Prepared permitting packet for state and local level permitting related to a federal pipeline fuel spill remediation project. Prepared Storm Water Pollution Prevention Plans for major Air Force bases in Alaska. Involved in establishing permitting requirements and carrying out permitting for new geothermal electrical generation plant.Major permit issues include wetlands,stream crossings,and air and water quality.Develop consensus between State of Alaska Departments of Environmental Conservation,Natural Resources,Fish and Game,the local Coastal Management District and Federal agencies such as the U.S.Army Corps of Engineers and the Environmental Protection Agency,and the client regarding meeting regulatory requirements. Project Review Coordinator,State of Alaska,Division of Governmental Coordination (1988- 1991);Liasion to State Pipeline Coordinator's Office (1990-1991). Managed inter-governmental review of proposed projects within the coastal zone for consistency with the Alaska Coastal Management Program (ACMP).Coordination resulted in project consensus among state resource agencies,affected coastal districts and the applicant.Reviewed comments,identified conflicts and project issues and mediated resolution among parties. Managed complex project reviews related to common carrier pipeline projects.Facilitated pre-application meetings between agencies and applicants to ensure a common understanding of informational and procedural requirements and allow for open discussion of proposed projects and develop scope of review. Environmental/Regulatory Specialist,NORTEC,A Division of ERT (1987-1988) Prepared oil spill contingency plan and assisted Amerada Hess with associated plan of operations for obtaining permit to operate on the North Slope,Alaska. ALISON L.SMITH,page -2- ACADEMIC BACKGROUND Dames &Moore ©Developed oil spill contingency plan and assisted with associated plan of operations for obtaining permit for Union Pacific Resources to operate in Cook Inlet,Alaska. Land Planner,Calista Corporation,(1981-1983) e Comparative analysis of land conveyance documents.Researched and mapped [and status. Managed leases and sales of subsurface resources.Developed land management policies. Advised village land planners.Reviewed and gave comments on major State of Alaska Land Management Plan affecting Calista lands. M.S.,Resource Policy and Planning,Minor,Environmental Planning,Cornell University,1985 B.S.,Political Economics of Natural Resources,University of California,Berkeley,1980 Curriculum Vitae Title Expertise Experience with Firm Dames &Moore MICHAEL L.FITZGERALD Environmental Scientist Environmental Impact Assessment Terrestrial/Aquatic Environments Responsible environmental report preparation,biological studies,project permitting,organizing project logistics,and communicating with various resource agencies regarding technical and project support issues.His recent activities include: Assisted with the preparation of the 1993 Environmental Analysis for the Copper Valley Intertie Feasibility Study.The project examined an 135 mile transmission line corridor from Sutton to Glennallen,Alaska.The report evaluated the affected environment and potential impacts to,approximately 260 miles of route alternative.Duties included identification of fish and wildlife habitats,recreation areas,participation in community scoping meetings,and project impacts analysis. Assisted with the preparation of a programmatic Environmental Impact Statement for Joint Military Training Exercises (JTX)in Alaska for the Alaska Command and the Army Corps of Engineers.The EIS covers 67 ground sites and 8 air space throughout Alaska.The report evaluates potential environmental impacts and identifies environmentally sensitive areas for use in future exercise planning and environmental compliance.Duties included botanical and anadromous fish investigations,land status investigations,project mapping, impact analysis and report preparation. Assisted in the preparation of a Feasibility Study for the proposed Tyee Swan 115kV transmission line in southeastern Alaska.The study looked at the feasibility of connecting the Swan Lake hydroelectric plant with the Tyee Lake hydroelectric plant to supplement supplies to the Swan Lake -Ketchikan service area.The distance between the lakes is approximately 60 miles.Duties included literature searches and identifying important sport fisheries. Assisted with the preparation of the Environmental Impact Statement for the Katmai National Park and Preserve Research Drilling Project for the National Park Service (NPS).The project proposed to conduct research drilling in the Park and Preserve to learn about volcanism.The project was proposed within a federally designated National Wilderness Area.Duties included terrestrial and aquatic ecology investigations,impact analysis,and report preparations. Assisted with the preparation of the Draft Environmental Impact Statement for the expansion of the Main Bay Hatchery in Prince William Sound.The client,Prince William Sound Aquaculture Corporation (PWSAC)proposed expansion of the existing hatchery and increased production of sockeye salmon.The hatchery is in a U.S.Forest Service Wilderness Study Area.Duties included identification of fish and wildlife habitats, recreation areas,and impacts analysis. MICHAEL L.FITZGERALD,page -2- Academic Background Dames &Moore Participated in a 1993 study of the Kenai Lake system that involved the sampling of salmon fry,resident fish species and zooplankton from Skilak Lake and the lower Kenai River. Duties included setting traps and nets,using trawl and bongo nets,rod and reel sampling, and collecting sockeye salmon otoliths. Assisting in the stream monitoring program of Indian Creek in relation to the U.S.Defense Fuels pipeline oil spill at the Indian Booster Station,Alaska.Program includes use of lipophilic bags for continuous water quality monitoring. Conducted oceanographic sampling for Alyeska Seafoods,Inc.to monitor dissolved oxygen levels and other biological parameters at and around the facility effluent outfall pipe in Dutch Harbor,Alaska.The monitoring was performed using a Seabird CTD and was in connection to NPDES permitting for the processing facility. Conducted pink salmon egg and milt collections at a Prince William Sound hatchery and at an Afognak Island hatchery for use in hydrocarbon toxicity tests at Battelle MSL.Work included organizing project logistics,acquiring necessary collection and transport permits, and transporting live gametes to Battelle MSL in Washington. Conducted stream sediment sampling at numerous Prince William Sound anadromous streams.The study was conducted in relation to the Exxon Valdez oil spill and in conjunction with other research projects.The study included helicopter-supported remote stream surveys and was intended to determine the effects of petroleum hydrocarbons on pink salmon ecology. Participated in a seabased bottomfish study in the Gulf of Alaska off Yakataga,Alaska.The study was designed to determine background concentrations of petroleum hydrocarbons in commercial bottomfish.Duties included biological sampling of bottomfish livers and bile, and report preparation. Participated in a 1992 Exxon Valdez Oil Spill Reconnaissance Survey.The survey was conducted in relation to the Exxon Valdez oil spill and included the revisitation of over 150 oil spill study sites.Duties included locating study sites via GPS coordinates and visual identification,removal of study markers,and photographic documentation of the site.The project included sites in Prince William Sound,the Gulf of Alaska,and Cook Inlet. Participated in the 1990-91 Prince William Sound (PWS)Salmon Study.The study conducted in relation to the Exxon Valdez oil spill,was intended to determine the effects of petroleum hydrocarbons on pink salmon development in PWS.Duties included in-stream egg and milt collections,and otolith sampling of pink salmon from more than 15 streams in oiled and un-oiled areas.The entire project was helicopter supported. Principle investigator of fish and wildlife resources,area wetlands and vegetation,and threatened and endangered species for numerous Oil Discharge Prevention and Contingency Plans (ODPCPs)throughout Alaska.Clients have included the U.S.Air Force,Unocal, Tesoro,Eskimos Inc.,and Saupe Enterprises.Duties included site visits,literature and database searches,State and Federal agency consultations,and development of environmental protection strategies. B.A.,Environmental Studies,University of California at Santa Barbara,1988 B.A.,Environmental Economics,University of California at Santa Barbara,1987 Curriculum Vitae TITLE EXPERTISE EXPERIENCE WITH FIRM Dames &Moore GREGORY REUB Senior Fisheries Biologist Project Management Fisheries Biology Aquatic Ecology Water/Sediment Quality Environmental Monitoring and Impact Assessment Mr.Reub has extensive experience related to environmental assessment of fisheries resources in the Pacific Northwest with special emphasis on the ecology and management of salmon species.He has over 16 years of experience in fisheries data collection,data analysis,and final formulation of written reports concerning the interaction of human activities and the aquatic environment.He presently serves as Manager of Aquatic Services for Dames &Moore in the Pacific Northwest. e Fisheries Task Manager for the Washington Department of Transportation SR 5 Toutle Park Road to SR 12 West Environmental Impact Statement (EIS),Lakemont Boulevard Southeast extension project EIS,Foothills at Issaquah development EIS,Sammamish Cove development EIS,CRSS Cogeneration Project,and Westinghouse Satsop Cogeneration Project. ¢Project Manager for Marine Environmental Studies in Caldera Bay,Chile,as part of the Candeleria Copper Mine Project,Port Facilities.These studies include an alternative selection study,design,execution and analysis and reporting of water quality,sediment quality and biological resources.The project involves baseline and monitoring studies. ¢Interdisciplinary Team Leader for fish and wildlife and Fisheries Principal Investigator for the Eight Fathom Bay and Ushk Bay Timber Sale EISs in southeast Alaska.Collected fisheries,aquatic habitat,and water quality data and analyzed and summarized data to . describe the affected environmental and potential impacts/mitigation for different timber harvest scenarios.Authored the Resources Inventory Report,Fish and Watershed Consequenses Report and the aquatics sections for the Environmental Impact Statement. ©Principal Investigator for the fisheries task on the Cedar River Resource Inventory and Management Plans Project for the Seattle Cedar River Municipal Watershed.Working with other disciplines such as hydrologists,wildlife biologists,and timber/transportation specialists,a Geographic Information System database is being developed to improve management decisions for this watershed. e Fisheries Principal Investigator for the Tyee-Swan Lake Transmission Line Feasibility Study in southeast Alaska. *Principal Investigator for the freshwater biology portion of the Transmountain Pipeline Project EFSEC Application.Evaluated environmental concerns for over 140 freshwater GREGORY REUB,page -2- OTHER EXPERIENCE Dames &Moore streams and rivers along a 150-mile crude oil pipeline route in the Puget Sound Area, Washington. Project Manager for the long-term Water Quality Certification Monitoring Project as part of the Strategic Homeporting Program for the Naval Station at Everett,Washington.The long-term plan involves water quality,sediment quality and biological monitoring at a planned major US Navy Port. Project Manager for the 1990-1991 Exxon Valdez Oil Spill Biological Programs for herring, crustacean and bottom fish studies.Also participated in the salmon studies as coordinator and advisor. Assistant Program Manager for the 1989 Exxon Valdez Oil Spill Biological Program. Responsibilities include budgetary and technical oversight of approximately 50 biological subcontractors and several in-house scientists. Fisberies Task Leader for the Boeing Powder Mill Creek fish habitat enhancement, engineered stream and wetlands. Fisheries Task Manager for the Manenggon Hills Development Project in Guam. Responsible for evaluating impacts to fisheries resources on a 1,300-acre development including construction and operation of a reservoir. Senior Associate Biologist,Envirosphere Company Responsible for water quality,fish and invertebrate distribution,and abundance and fish overwintering programs for Endicott Environmental Monitoring Program near Prudhoe Bay, Alaska.Responsible for field and laboratory methods and data processing to determine impacts from solid fill causeway in the marine environment.Responsible for data analysis and preparation of water quality and fisheries chapters for final report series. Served as liaison between state and federal regulatory agencies,set net fishermen,and developers building a gravel extraction and solid fill dock facility in upper Cook Inlet. Duties included securing necessary permits,documenting predicted impacts,and developing mitigation measures. Fisheries Biologist,Trihey and Associates,Anchorage,Alaska Evaluated the response of chum salmon spawning habitat to predicted changes in flow regimes for the Susitna Hydroelectric Project.Coordinated the Instream Flow Relationships Report for the project. Developed an euphotic (light penetration)surface area response model to predict changes in primary production. GREGORY REUB,page -3- ACADEMIC BACKGROUND AFFILIATIONS Dames &Moore Staff Scientist,Woodward-Clyde Consultants Participated in four instream flow studies for Pacific Gas and Electric Company on the Pit River,Crane Valley,Tule River,and Modelumne River projects in California.Supervised water quality and fish data collection and analysis in support of the Exhibit E reports to the Federal Energy Regulatory Commission (FERC)and hydroelectric project relicensing. Served as Field Team Leader and assisted in database management,analysis and report preparation for the Waterflood Environmental Monitoring Program and the Lisburne Development Environmental studies in the Prudhoe Bay area of the Beaufort Sea. Participated in or directed the field collection,laboratory analysis,and data evaluation for a large complex biological sampling program as part of the Cerrejon Coal Project Environmental Studies in Colombia,South America.Led the technical efforts dealing with the diversion of a major river in the area of the proposed mining facilities and assisted in marine studies for development of a deep water port. Conducted field sampling,analyzed results,co-authored the report for instream flow studies and prepared the fisheries section of the FERC Exhibit E in support of the Bradley Lake Hydroelectric Project in Alaska.Served as field supervisor for the feasibility and licensing studies for the proposed Chakachamna Lake Hydroelectric Project in Alaska.Responsible for the collection and analysis of habitat suitability data for nine species of salmonids and baseline water quality data. Aquatic Biologist,Peace Corps,Colombia,South America Served as Technical Advisor and Investigator for the aquaculture program in S.E.N.A.,the Colombian agency responsible for dissemination of technical information in Colombia,South America.Designed and executed several investigations to improve yield in local farm fish ponds. Junior Chemist,Stearns-Rogers,Inc. Collected and prepared data for transmittal to process engineers for re-evaluation and adjustment of process conditions for a coal gasification plant.Analysis of solid,liquid,and gas samples using standard instrumental and chemical methods. M.A.1990,San Francisco State University,Ecology and Systematic Biology B.S.,South Dakota State University,1977,Wildlife and Fisheries Science, Minor Chemistry South Dakota School of Mines and Technology,1974,Biology Amercian Fisheries Society Certified P.A.D.I.Diver GREGORY REUB,page -4- PUBLICATIONS AND TECHNICAL REPORTS Dames &Moore Reub,G.S.1991.The influence of groundwater upwelling in the selection of spawning locations by chum salmon (Onchorhynchus keta)in the Susitna River,Alaska.M.A.Thesis, San Francisco State University,San Francisco.89 pp. Dames &Moore Consultants.1990.Aquatic Resources Report for Manenggon Hills Development,Report for Meyama Guam,Inc.Agana,Guam.57 pp. Glass,D.R.and G.S.Reub.1990.Growth and Long Term Trends in Age Structure of Arctic Cisco and Broad Whitefish in the Prudhoe Bay Area of the central Beaufort Sea.Chapter 10 IN:Endicott Environmental Monitoring Program,Report to Army Corp.of Engineers,Alaska District,Anchorage,Alaska. Reub,G.S.,D.R.Glass,and J.W.Johannessen.1989.Habitat Use and Abundance of Overwintering Fish.Chapter 1.In:Endicott Environmental Monitoring Program.Report to Army Corps of Engineers,Alaska,District,Anchorage,AK. Reub,G.S.,J.Durst,and D.Glass.1989,Fish Distribution and Abundance.Chapter 1.In: Endicott Environmental Monitoring Program.Report to rmy Corps of Engineers,Alaska District,Anchorage,AK. Reub,G.S.,E.W.Trihey,and R.C.Wilkinson.1985.Preliminary analysis of the influence of discharge and turbidity on the surface area of the euphotic zone in the middle Susitna River. E.Woody Trihey and Associates,Anchorage,AK.Technical memorandum.25 p.(Presented at the American Fisheries Society Meeting -Alaska Chapter 1985.) Alaska Power Authority.1984.Application for major project,Bradley Lake,before the Federal Energy Regulatory Commission,Exhibit E,Chapter 33 (Fish,Wildlife and Botanical . Resources).Bradley Lake Project.1 volume. Woodward-Clyde Consultants.1983.Bradley River Instream Flow Studies.Report for Alaska Power Authority.139 p. Woodward-Clyde Consultants.1982.Aquatic Biology Technical Report for Cerrejon Coal Project.Report for Intercor,Branquilla,Colombia.So.Amer.276 p. Reub,G.1980.Supplemental feed for warm water fishes made from agriculture sub-products. (in Spanish)S.E.N.A.,Peace Corps. Reub.G.1980.The construction and use of a simple solar dryer in the preservation of Tilapia spp (in Spanish).Inderena. Reub,G.,and K.Bright.1980.The cultivation of Tilapia rendalli confined in cages (In Spanish).S.E.N.A.,Peace Corps. Bright,K.and G.Reub.1980.Preliminary Trial of the Polyculture of Nicuro (Pimelodus clarius)and Tilapia rendalli (in Spanish).S.E.N.A.,Peace Corps. Curriculum Vitae DAVID MICHAEL BJERKLIE TITLE Hydrologist/Geohydrologist EXPERTISE Ground-Water Hydraulics\Quality Surface-Water Hydraulics\Quality EXPERIENCE WITH FIRM Mr.Bjerklie has over ten years of experience in the field of hydrology and hydrogeology and has managed and participated in numerous water resource investigations.His work has included all aspects of both surface water and ground-water studies as part of environmental assessments, impact studies,hazardous waste studies,water supply investigations,construction dewatering evaluations,wetland investigations and hydrologic and hydrogeologic characterizations.His experience encompasses field work,data analysis,reporting,regulatory concerns,and client and agency contact. Dames &Moore Evaluated water supply and low flow conditions for a pulp mill near Ketchikan,Alaska. Statistical probabilities were developed to estimate low flow recurrence intervals for the surface water supply used at the mill,and recommendations were made for increasing storage and managing the resource. Technical lead and Task Manager for water resource portions of a comprehensive environmental resource inventory and investigation as part of the EFSEC permit application for the proposed Trans Mountain Oil Pipeline.Investigations included surface water, groundwater and marine resources throughout the Puget Sound region,from Port Angeles to Bellingham,Washington. Task manager for water resource sections of environmental impact statements,environmental assessments and permit applications.Work included estimation of erosion and sediment transport,ground-water assessment,drainage requirements,flooding potential,ground water/surface water interaction,water balance studies,statistical evaluations of hydrologic and climatologic data,qualitative assessment of water quality impacts from proposed projects using water quality and runoff models,and evaluation of water quality impacts from surface runoff and site development.This work has also included review and assessment of pertinent federal,state,and local regulations and permits.Projects have been conducted for the Navy,the Forest Service,and for private development in diverse locations including Amchitka Island,Fairbanks,Chuitna and Ketchikan,Alaska;Puget Sound area,Washington; and Clackamas,Oregon,and have been conducted for private industry and developers, Oregon Department of Transportation,and the U.S.Navy. Evaluated hypothetical spread of the herbicide Picloram by flooding and runoff in the vicinity of small irrigation ponds fed by a creek near Baker,Oregon.The work was conducted in response to a lawsuit by a local farmer who alleged that picloram contaminated irrigation water flooded his fields.Work preparation included possible expert testimony. Evaluated hydrogeology and contaminant transport of an alluvial aquifer beneath a Superfund site near Portland,Oregon where battery recycling operations had previously occurred. DAVID M.BJERKLIE,page -2- Dames &Moore Contaminants of interest were lead (and other metals)and high acidity.Transport mechanisms and ground-water budget were evaluated. Managed the water resource portions of an expanded site investigation (ESI)designed to evaluate the extent of pesticide contaminants in a landfill near Oroville,Washington,both areally and with depth,and to evaluate potential contaminant transport mechanisms and pathways.Pathways evaluated included transport in porous media (soil and fill)and in underlying fractured bedrock.Study techniques included the use of slug tests,and ground- water tracer to evaluate flow conditions in both saturated and unsaturated conditions.The study also included an evaluation of the effectiveness of on-site drainage system to route surface and shallow subsurface water away from the contaminated site. Managed field program and reports of a PCP contaminated site in Dawson Creek,British Columbia.Field work included soil sampling,monitoring well installation and ground-water sampling.Data analysis focused on contaminant transport mechanisms within low permeability clay and shale deposits and characterization of artesian ground water beneath the site.Of special concern was possible rupture of shale overlying the artesian zone during excavation of contaminated soils. Evaluated hydrogeologic conditions at a proposed landfill expansion near Great Falls, Montana.Included estimating percolation,evapotranspiration,peak flows,and runoff volume,and overall water balance. Conducted field investigations and data analyses for evaluation of the water supply,both surface and ground water,at a fish hatchery near Port Angeles,Washington. Managed field program,analysis and reporting,and client and regulatory interaction for hydrogeologic characterization and development and installation of ground-water monitoring systems at two landfills,one in East Wenatchee,Washington,and one in Great Falls, Montana.Work included borehole siting,contractor supervision and borehole logging during drilling of deep test borings,installation of monitoring wells,hydrogeologic characterization,permeability testing,data analysis and preparation of reports. Managed and conducted water budget investigations and hydrogeologic assessment of the causes for water level declines in a lake near Silverdale,Washington.Work included evaluation of existing data and development of possible causes of lake level decline based on analysis of the data base.This work included presentation of findings at public hearings, and participation in public discussion of water management options. , Evaluated hydrologic and soil conditions related to the maintenance of wetlands as part of detailed wetland delineations,enhancement of wetlands and wetland hydrology studies. Developed simple statistical methods for estimating mean annual discharge for small ungaged watersheds as part of wetland classification criteria. Developed hydrologic baseline information for a proposed hard rock gold mine near Fairbanks,Alaska.Work included evaluation of hydrologic and geohydrologic regimes collection of baseline surface and ground-water quality and quantity information and evaluation of hydrologic data needs concerning potential permitting and other regulatory requirements. DAVID M.BJERKLIE,page -3- PAST EXPERIENCE ACADEMIC BACKGROUND Dames &Moore ¢Evaluated closure plans for a landfill in Port Angeles,Washington.Included an evaluation of infiltration and runoff characteristics of cap material,expected performance of an onsite infiltration pond,potential quantity of leachate generation based on a water balance, adequacy and compliance of the closure and monitoring plans. Research Assistant,University of Alaska (1983-1986) ©Conducted studies of the impact of placer mining and subsequent increased sedimentation on stream hydrology.Developed a statistical technique to predict monthly hydrographs from glacierized basins. Hydrologic Consultant,Alaska (1983-1986)Arctic Hydrologic Consultants,R and M Engineers). ¢Work included evaluation and design of drainage and sediment pond structures for coal mining facilities. e Evaluation of drainage and sediment control features for a coal mining application. ®Hydrologic field work and data analysis to determine the potential impact of a large hydroelectric project on the ground-water and surface-water contributions to salmon spawning areas. Hydrologist,U.S.Geological Survey,Alaska (1986) *Supervised the installation of numerous ground-water level monitoring wells including site location,logging,and leveling the casings to mean sea level. Hydrologist,Bureau of Land Management,Alaska (1982) ©Conducted water resource evaluations for several river basins. Hydrologist/Planner,Androscoggin Valley Regional Planning Commission,Maine (1981) ®Conducted water resource evaluations concerning ground-water and surface-water supply. ¢Conducted evaluations of ground-water and surface-water contamination from landfills and other land uses for numerous small communities. Research Assistant,University of New Hampshire (1978-1980) ¢Conducted field sampling and lab analysis for organic and inorganic constituents in ground water as well as water quality analysis. e Evaluated the use of dissolved organic carbon and specific conductance as indicators of the impacts of a municipal landfill on ground-water quality. M.S.,Civil Engineering,University of Alaska (1987) M.S.,Hydrology,University of New Hampshire (1980) B.S.,Marine Biology,University of Maine (1977) DAVID M.BJERKLIE,page -4- PROFESSIONAL AFFILIATIONS Engineer-in-Training,Alaska,1985 Sigma Xi,academic fraternity,1980 Dames &Moore SW GOLDEN VALLEY ELECTRIC ASSOCIATION INC.Box 71249,Fairbanks,Alaska 99707-1249,Phone 907-452-1151 December 23,1993 Tim J.Crago Nortech Surveys #1 820 28th Street NE Calgary Alberta CANADA T2A 6Kl Re:Request for Proposal -Healy to Fairbanks 230 kV Intertie Dear Mr.Crago: Golden Valley Electric Association,Inc.intends to contract with a survey firm to provide plan and profile along the proposed route of the Healy to Fairbanks 230 kV transmission intertie. The transmission line configuration will be mainly a X-tower design using weathering steel towers with suspension insulators and a short section of single pole design north of the Tanana River which will include provisions for one circuit of 7.2/12.5 kV three phase underbuild.A copy of the preliminary routing is enclosed for use in this proposal.The proposed transmission line has been divided into five links.It is proposed to construct the project in two link groups:Links 1,4,and 5 are proposed to be constructed in 1995 and the remaining link group consisting of Links 2 and 3 is proposed to be constructed in 1996.A small scale map has been included to delineate the various links. The proposed Scope of Work is as follows: 1.Provide all material,labor,equipment,computations,and supervision required to conduct an aerial DVG survey and profile of the three route alternatives to aid in comparison and selection of the final route and provide information for design. 2.Tie into existing cadastral and/or private survey monumentation along the route adequate to produce right-of-way maps for permit and easement acquisition. 3.Set sufficient control panels on monuments that can be used for structure locations during construction phase. 4.Produce plan/profile sheet for line design use at a scale of 1"=200'horizontal and 1"=10'vertical. 5.Locate all improvements within 200'of centerline and show on plans. GOLDEN VALLEY ELECTRIC ASSOCIATION INC. Tim J.Crago December 23,1993 Page 2 Request for Proposal 6.The data should be able to down load to the TLCAD program. Proposals for design have been requested and the use of TLCAD will not be verified until the award of the design contract. The proposed project routes are shown on the enclosed map.The routes have been highlighted and are approximate due to the large scaling factor.Final alignment of the alternative routes will be provided after acceptance of the proposal and issuance of the notice-to-proceed.Upon completion of the design,construction surveying will be conducted under another contract for the location of centerline,clearing limits,and pole and anchor locations. Completion date for all DVG work and presentation of the plan and profile sheets is proposed to be April 1,1994.If alternative time frames are proposed,please address the proposed dates in your proposal.It is anticipated that the final environmental clearance and transmission line design will be completed by December 1994. Firms wishing to be considered should respond in the form of a proposal and statement of qualifications,along with the resumes of staff available to support the work,man-hour breakdown for each work packet link groups on the form provided,cost breakdown on the form provided and appropriate fee schedule,schedule to meet proposed project schedule,firms ability to proceed with the work upon notice to proceed,sample of a similar project recently completed by the proposed project personnel,and a list of applicable local experience performed by the proposed project personnel.Project proposals will be evaluated on price and on the supplied information.Personal presentations are not necessary, however,if you have questions,don't hesitate to contact us. Proposal and information requested shall be sent to Golden ValleyElectricAssociation,Inc.,Engineering Department,PO Box 71249, Fairbanks AK 99707-1249,and plainly marked "Proposal:Healy to Fairbanks 230 kV Transmission Line =DVG."Proposals should be submitted by 5:00 p.m.,local time,January 10,1994.The contractformwillbethatoftheGoldenValleyPurchaseOrderwithStandard Terms and Conditions,a copy which is included in this letter. Sincerely, Steven Haagenson Manager of Engineering Services Enclosure:Route Maps Purchase Order Terms and Conditions GOLDEN VALLEY ELECTRIC ASSOCIATION,INC.(GVEA) Purchase Order-Terms and Conditions PRICE/QUANTITIES:The price or prices and quantities stated on the face of ths purchase order shail be firm and fixed except as sitered with written spprovei of GVEA's purchesing agent.The price stated shail inciude federal.state and local taxes unless Otherwise expressty provided. ACCEPTANCE OF ORDER:This purchase order confirms 8 contract between the parties on the terms of this purchase order and any other relevant documentis)as listed on its face.By acceptance of this purchase order and/or performance here-under,Seiler agrees to comply fully with the terms and conditions of sale set forthonboththefrontandreversesidesofthisdocument.and eny supplements hereto which are incorporated by a reference herein.Acceptance of this purchase order must be made on its exact terms and if sdditionai or different terms are proposed by the Seller,such response will constitute @ counteroffer end no contract shail come into existence without GVEA's written consent to the counteroffer.Seiler represents that ail goods supplied are free and ciear from ail claims and liens of anynaturewhatsoever.Nothing in this order or ecceptance shall be construed to makeSeileranempioyeeoragentofGVEA.This purchase order together with any televant documents or attachments to it constitutes the entire agreement between the parties.Any deviation from this agreement must be accepted in writing by GVEA. INSPECTION ANO ACCEPTANCE:Final inspection of goods and services shall be upon GVEA's premises uniess otherwise agreed in writing.Any acceptance of goods is subject to inspection within eo reasonable time after receipt.Payment oftheinvoicedoesnotconstituteorceofmateriaiscoveredby the order,and GVEA reserves the right to inspect the goods before payment.if, UPON Inspection,any goods are found to be unsatisfactory,defective.or of inferiorQualityofworkmanship,or fail to meet the specifications furnished of the re- quirements stated in the purchase order,GVEA may return such goods to Seller at the Seller's sole risk and expense,including the cost for handling and transport- ation,inspection,end any other charge connected with noncompliance of the purchase order. SHIPPING:All shipments and routing shail comply with the directions on the face of this purchase order or,in the absence of specific shipping instructions,goods shail be shipped FOS destination vie the most economical means avaiiabie.All transportation.shipping and forwarding charges must be prepaid uniess other- wise indicated on the purchase order.GVEA reserves the right to refuse eny end all shipments with collect charges.Seller shail notify GVEA of shipments within sufficient time to permit GVEA to arrange far untoading,and any claim for de- murrage resulting from Seiier's failure to comply shall be paid By the Seiler.Seilershallbeartheriskoftimelydeliveryofshipmentsinroute.The risk of joss snail remain with the Seiler until delivery of goods into GVEA's possession at desti- nation,sudject to Seller responsibility for adequate packaging. WARRANTY:The Seller warrants articles supplied on this purchese order to conform to specifications stated herein and to be fit and sufficient for the purpose manufactured,of good materiel and workmanship,and in the absence of other apolicadle express of implied warranty specifying a longer period.free fromdefectsforaminimumperiodoftweive(12)months from delivery to GVEA.This warranty shall survive eny inspection,delivery or ptance of the goods or services,or payment therefore by GVEA.Seiler further warrants that Seiler shall comply with the requirements of all applicable federsi,state and local \aws,rules. ordinances and reguiations,such as,but not limited to OSHA,Hazardous MaterialspansportationAct,Toxic Substances Controi Act and Consumer Product Satetyct. CHANGES/CANCELLATION:GVEA may require changes to this order at any time and written modification shall be made asr y¥with ail for increased cost,date of delivery.of other matters affected by the changes}. GVEA may.at it's option.cance!eny unshipped merchandise previously ordered, subject to the obligation to pay for merchandse pped prior to car 1 tfine purcnase order covers merchandise manufactured or fabricated to specifications of GVEA,Seller shall discontinue ail performance on the subject matter,except as otherwise directed,immediately upon receiving notice of such cancellation.In the se of such cancelistion,and providing Seller is not in default,GVEA snail pay toeiler: a)©The cost incurred by Seller in connection with this order prior to notice of cancellation;or b)Such other costs,inciuding cancellation charges under subcontract,as GVEA may have spproved. The total cancelistion payment.plus previous payments,shalt not exceed the total orice of this order.Upon such payment,at GVEA's option,title to any materisis oruncompletedmerchandiseshailpasstoGVEA. REMEDIES WAIVER:Time is of the essence of this order,and in the event thatpertormanceordelivery1snottimely,GVEA reserves the right to cancel,purcnase eisewnere,andor hold Seller accountable for resuiting costs and damages in-curred Setler shall promptly notify GVEA of any event that threatens to delay pertormance or delivery. Any waiver by GVEA of any breach or default shail not be deemed continuing oracolicabietootherBreachordefault. 10. Wt. 42. 13. 14, 15. 16. 17. THIRD PARTY CONTRACT/ASSIGNMENT:Neither this order nor any rights and obiigations under it shell be sasigned or contrected to third parties dy SeilerwithouttheprnorwrittenconsentofGVEA.GVEA snail promptly be furnisned with written notice and &signed copy Of sny assignment.Any ciaim for payment by Assignees shall be subject to those defenses and set-offs which GVEA may nave against Seller.Selier shail insure that any third party contract andor assignmentsnailincorporatetheprovisionsofthisorderbyspecificreferencenereto. INDEMMIFICATION:Selier shail indemnity GVEA for any loss,claim.damages. liability,expense (inctuding reasonable attorney's fees)of any cause of ection whatsoever arising out of any act or omission of the Seller.its agents.employees or subcontractors.Seiler shail maintain such pudlic Lanility,property damage.em- ployee liability and compensation insurance as to protect GVEA from any said risks and from any claims under any appiicabie workers'compensation and occu- pational disease scts. GVEA reserves the right to require that it be named as an additional insured on Seller's insurance that certifi of such insurance coverage be tur- nuished upon request and that such additional insurance as it deems necessary be provided. The Seller agrees to defend,at its expense,GVEA and GVEA's empiovees.or any others using the product of GVEA,and hoid them harmiess.with respect to any andallclaimsthattheproductsormateriaisfurnishedbytheSeilerunderthisorder infringe any United States and/or foreign patent,trademark,copyright and or otner Property right of third partes. BUY AMERICAN:Seller shail adhere to the "Buy American”requirement of REA Bulletin 43-9.Any deviations from this requirement must be spproved in writing DyGVEA's purchasing agent. LASOR AGREEMENTS:It is understood and agreed that the Seller shall abide by GVEA's project labor agreements if work at the jobsite is required in this order. SERVICES:Seiler and GVEA understand and agree that all "services”con- templated by this agreement end provided Dy Seiler to GVEA snail have the same complete end entire meaning as the word "goods”in application of the Uniform Commercial Code.All warranties as provided for by application of the Uniform Commercial Code,including implied warranties of merchantabililty and fitness for a particular purpose,shail apply to any and ail services provided by Seiler to GVEA as provided for in this egreement.Any and all other warranties,whether wntien or oral,statutory,express or implied,provided by Seiler to GVEA shall apply to the services specified in this Agreement. FEDERAL LAWS,ORDERS ANDO REGULATIONS:GVEA and ail sudcontractors. vendors,and suppliers agree and cerufy that they shali comply with the re- quirement of all pertinent federal laws.orders and reguiations including but not limited to Executive Order 112461,as amended,and the regulations at 41 CFR 60-1 through 60-60,at 41 CFR 60-250 and 60-741 and Sections 38 USC 2012503. CHOICE OF LAW:Any civil action srising from this purchase order shail be brought in tne Fourth Judicial Oistriet for the State of Alaska.The laws of the State of Alaska shail govern the rights end the obligations of the parties under this purchase order. LOBBYING DISCLOSURE:Any contract of subcontract which exceeds $100,000 shall comply with Federal Law.which governs this contract.and requires that all contractors and any sudcontractors comply with the following: No Federal appropriated funds have been paid or will be paid.by or on behaif of the undersigned,to any person for influencing or attempting to influence an officer oremployeeofanyagency,a Member of Congress,an officer or employee of Congress,or an employee of a Member of Congress in connection with theawardingofanyFeders!contract,the making of any Federal grant.the making ofanyFederaljoan,the entenng into of any cooperative agreement,and the exten-SION,Continuation oF renewal,amendment or modification of any Federal contract. grant.loan or cooperative egreement. It any funds other than Federal appropriated funds heve been paid or will be paid to any person for influencing or attempting to influence an officer or employee of anyagency.s Member of Congress,an officer or employes of Congress.or an em-ployee of a Member of Congress in connection with this Federal contract.grant.loan,of cooperative agreement.the undersigned shail complete and submit Stan- dara Form-LiL."Disciosure Form to Report Lobbying.”in accordance with its instructions. By scceptance of this contract with GVEA,you are certifying that you are incompliencewiththisfederalrequirement.If you ere required to complete StandardForm-LLL."Disciosure Form to Report Lobbying.”you must submit this farm to GVEA at the time this contract is entered into. WAIVER OF RIGHT TO FALE LIENS:Seller hereby agrees not to file any mechanics. laborers',of materisimen's hen or other lien against any GVEA premises or any part thereof on account of any services or goods furnished under this order or anyadditionsoraddendatothisorder.Seiler hereby waives the night to file any suchhen.and snail,if requested.execute @ waiver of lien in recordabie form in favor of GVEA and the premises.Seller shail insure that any third party contract andorassignmentshailincorporatetheprovisionsofthispurchaseorderbyspecific reference to these terms and conditions. SEVERABILITY:The invalidity in whole or in part of any condition of this purchase Order snati not effect the validity of the other conditions.The remedies reserved in these terms and conditions shall be cumulative and additional to any remedies in law or equity. me we Gv GOLDEN VALLEY ELECTRIC ASSOCIATION INC.Box 71249,Fairbanks,Alaska 99707-1249,Phone 907-452-1151 TELECOPY TRANSMITTAL DATE:January 4,1994 TELECOPIER NUMBER:(403)248-5196 PLEASE DELIVER TO:__Eldon Edey COMPANY:Nortech Surveys TELEPHONE NUMBER:(403)248-5000 FROM:Greq Wyman NUMBER:(907)_451-5629 PAGES TO FOLLOW:7 (Including This Page) kkkkkkkkkkkkkkekkkkkkkkkkkeeeRRRRRKKKKRKKKKKKKEKKKKKKKKKK IF YOU DO NOT RECEIVE ALL OF THIS TRANSMITTAL,PLEASE CALL: GREG WYMAN,452-1151,EXTENSION 629 kkhkkkkekkekkhkkkkkekkekkkekkekekeckeRRKKKKKKKKKRKRKKKKKKKKKKKKKKKRRR SPECIAL INSTRUCTIONS:__Route maps are not very legible,copied off "Fairbanks"1:250000 USGS Quad Map PLEASE REPLY TO:ENGINEERING TELECOPIER (907)451-5638 OR (907) 452-1151,EXTENSION 629. GY GOLDEN VALLEY ELECTRIC ASSOCIATION INC.Box 71249,Fairbanks,Alaska 99707-1249,Phone 907-452-1151 January 14,1994 Mike Kelly Intertie Participant's Group State of Alaska Alaska Industrial Development and Export Authority 480 West Tudor Road Anchorage AK 99503-6690 Recommendation of Digital Video Geographic (DVG)Proposal HEALY TO FAIRBANKS TRANSMISSION INTERTIE Dear Mike: Golden Valley Electric Association,Inc.Engineering Department requested a proposal for the supply of DVG services from Nortech Surveys (Canada)Inc.We have evaluated the Nortech proposal and would like to offer a recommendation for acceptance of this proposal. The Nortech proposal is attached for your review.Only one proposal was requested as Nortech is the only company which has this new technology. Your review and approval would be much appreciated.If you have any questions or require additional information,please call me at (907)451-5647. Sincerely, Steven Haagenson,P.E. Manager of Engineering Services SH:mmf Enclosures 7 Nortech Surveys (CANADA)INC. PROPOSAL:HEALY TO FAIRBANKS 230 KV Transmission Line -DVG Submitted To: GOLDEN VALLEY ELECTRIC ASSOCIATION,INC. Engineering Department P.O.Box 71249 Fairbanks,Alaska USA 99707-1249 Submitted By: NORTECH SURVEYS (CANADA)INC. #1,820 -28th Street N.E. Calgary,Alberta CANADA T2A 6K1 Tel:(403)248-5000 Fax:(403)248-5196 TABLE OF CONTENTS STATEMENT OF QUALIFICATIONS ..0.2...2...0.00.eee eee ee eee Page 1 SIMILAR DVG/LASER PROFILING PROJECTS ..........2.00.eee ees Page 2 PROJECT PERSONNEL AND APPLICABLE EXPERIENCE .............Page 4 SIMILAR LOCAL PROJECT SAMPLES .............2.0020 eee eee Page 12 SCHEDULE AND ABILITY TO PROCEED ..........0...0.050 ee uuee Page 13 FEE SCHEDULE ...2...ee ee ee ee et ee Page 14 ADDITIONAL DIGITAL VIDEO GEOGRAPHIC (DVG™) SURVEY SYSTEM INFORMATION ..........0.02 eee eee eee renee Page 15 LIST OF APPENDICES: APPENDIX A -SAMPLE PLAN AND PROFILE SHEETS APPENDIX B -SAMPLE PLAN/PROFILE SHEET GENERATED THROUGH AUTOCAD APPENDIX C -A SAMPLE PROFILE SURVEY REFERENCE PLAN APPENDIX D -JUNEAU T.V.NEWS BROADCAST VIDEO APPENDIX E -DVG BROCHURE APPENDIX F -DVG PAPER PRESENTATION APPENDIX G -NORTECH SURVEYS COMPANY PROFILE STATEMENT OF QUALIFICATIONS Of particular importance to the Healy to Fairbanks 230 KV intertie project is Nortech's extensive Global Positioning System (GPS)experience;both technically and operationally.Nortech has been heavily involved with satellite based GPS since 1978 when the first commercially available GPS receiver (STI 5010)was delivered to the Nortech lab in Calgary.Nortech's reputation as a pioneer and leader in geodetic technology also includes the development,design and production of the Norstar 1000 GPS/Navstar receiver now manufactured and distributed as the NovAtel GPS card on a worldwide basis. Nortech has developed into a fully integrated surveying and navigation company whose market position has been achieved by successfully adapting and implementing new technology to surveying applications.To this end,an innovative approach to application-specific mapping and data collection using an integrated airborne Digital Video Geographic (DVG™)survey system was developed by Nortech. The current DVG™system evolved from earlier airborne systems used for aerial laser profiling. The first system,developed in 1984,employed a Ferranti inertial navigation system (INS)to provide positioning and orientation information.An on-board laser ranging system provided near continuous vertical ranges to the ground.Vertical ranges were obtained by reflecting the laser pulse off a mirror which is vertically stabilized using the INS roll and pitch data.The system was subsequently augmented with a downward looking video camera for reconnaissance purposes.The capability to annotate position,time and other information onto the video in real- time was included,permitting correlation of the annotated video with the ground profile.In 1987 the system was modified to use differential GPS for positioning in place of the INS.The use of GPS simplified the logistics and lowered overall costs since landing every four minutes for INS zero velocity updates were no longer required.The video recording,however,was strictly used for reconnaissance purposes. Design of the current DVG™system began in 1989.The system employs differential GPS for positioning and a vertical gyroscope for roll and pitch orientation information.A smaller laser profiler was used which enabled the use of a gyro stabilized platform rather than the previous mirror technology.The laser and video camera head are mounted on the platform providing coincident vertical ranges and video images.The correlation of position and range information with the vertical video is done using accurate GPS time coding of all data.This data collection scheme allows for digitization,coordination and measurement directly from the video images. The DVG™system can be applied at various stages within the power generation and distribution industry.Initially,for planning purposes,feasibility studies may be undertaken with emphasis on route assessments and environmental impact studies for new line design and route selection. Proposal:Healy to Fairbanks 230 KV Transmission Line -DVG Page 1 The DVG™system has proven to be a very valuable asset on a multitude of similar linear projects which supports the statement of qualifications as the world leader in remote sensing using integrated GPS position and time,video imagery,and laser profiling into a single unified real-time data acquisition process. SIMILAR DVG/LASER PROFILING PROJECTS The DVG system has been used on identical and similar projects recently completed in the United States and Canada.Nortech provided both laser profiling and imaging data for reconnaissance and feasability studies,route selection,transmission line plan and profile generation,on line attribute digitization and preliminary design.A listing of both identical and similar project follow: H.W.LOCHNER,INC.-ALASKA -1993 Nortech's DVG system provided both laser profiling and imaging data for the accurate assessments of the feasibility,routing and costs of three alternative highway routes to connect Juneau and the continental highway system.The complete project provided DVG digital information for nearly 250 miles of potential new roadway. TRANSALTA UTILITIES -ALBERTA -1993 An environmentally sensitive DVG/laser profiling project was recently completed in Banff National Parks for TransAlta Utilities Corporation.Both laser profiling information and DVG imagery were used for both route selection and transmission line plan and profile generation. TOPOGRAFIA Y PROYECTOS -MEXICO -1993 DVG laser profiling and video imagery were combined to provide topographic information to Telephonos de Mexico (TELMEX)for the precise routing and laying of fibre optic telephone cables. MAPINDO -INDONESIA -1992 Nortech's DVG system was used for forest inventory data base verification in Indonesia.Data provided included tree heights,types and other qualitative data. Proposal:Healy to Fairbanks 230 KV Transmission Line -DVG Page 2 MINCONSULT -MALAYSIA -1992 Nortech's laser profiling was used to provide detailed topographic data for the design of a major highway in central Malaysia. CANADIAN HYDROGRAPHIC SERVICE -BRITISH COLUMBIA -1992 Nortech's DVG system was used to survey and map approximately 70 KM of coastline with the primary emphasis being on determining all coastal structures including wharves,piers,and physical coastline. ALBERTA POWER -ALBERTA-1991 Nortech provided route profiling for 120 KM of new transmission line in North Central Alberta including precise airborne coordination of all PI's along the route. ALBERTA POWER -ALBERTA-1989 A 150 KM transmission line addition required laser profiles and video information to assist in right-of-way measurements. POWER ENGINEERS,INC.-MONTANA,USA -1989 Laser profile and video were utilized on an existing transmission line to update old survey records and for positioning over 500 structures using video imagery. IGN INTERNATIONAL -GABON,AFRICA -1988 Approximately 6500 KM of profile data using Airborne Laser positioned by GPS for control of spot imagery. CHEVRON -PAPUA NEW GUINEA-1987 Approximately 150 KM of route were profiled for the purpose of pipeline design and planning. Twenty-five hours flying time. Proposal:Healy to Fairbanks 230 KV Transmission Line -DVG Page 3 DEPARTMENT OF TRANSMIGRATION -INDONESIA -1986 -87 Over 60,000 Hectares were mapped at 1:10,000 scale in two areas in central and southern Kalimantan.All data processing and mapping was done on-site.Over 500 hours flying time. KENNEDY AND DONKIN -PAPUA NEW GUINEA-1985 Approximately 550 KM of transmission line were flown in central PNG.In the more rugged mountains areas,three parallel lines were profiled in order to determine side slope. ALBERTA POWER LIMITED -ALBERTA,CANADA -1985 300 KM of proposed transmission line were profiled in central Alberta.Three parallel lines were flown and the final digital profiles were output directly into Alberta Power's line design software package. PROJECT PERSONNEL AND APPLICABLE EXPERIENCE The following adended resumes include the personnel that will be available to support the Healy to Fairbanks 230 KV intertie project.All staff members represented by the adended resumes are directly involved in DVG data acquisition,processing,system support,and development of both software and hardware platforms.All personnel assigned to the project have worked on similar transmission line projects.Resumes for the personnel listed below follow: .Joseph Pilieci,P.Eng.,Douglas Hunter Operations Manager Senior Electronics Technologist Barry Kaser 'Roland Jackman Senior Project Manager Senior Electronics Technologist .John Carter .Glenn Skelton Project Engineer Field Electronics Technologist °John Hagglund,P.Eng.,C.L.S. Senior Technical Advisor Proposal:Healy to Fairbanks 230 KV Transmission Line -DVG Page 4 JOSEPH PILIECI,P.Eng. POSITION: EDUCATION: EXPERIENCE: MEMBERSHIPS: OPERATIONS MANAGER May,1983 -B.Sc.Engineering (specialization Surveying Engineering), University of Calgary. 1979 -Registered in Electrical Engineering,transferred to Survey Science, University of Alberta. Prior to joining Nortech,Mr.Pilieci worked in various areas of surveying and has gained experience in field data collection,data processing,programming, mapping,crew management,planning roadway projects and materials testing, etc. Mr.Pilieci joined Nortech in 1988,working in Operations.His workload has included field data collection,data processing,and mapping of various types of survey data.At present Mr.Pilieci is involved with Nortech's advanced technology systems from both an operational and development perspective.He has gained much experience on major international projects over the past years utilizing Nortechs airborne systems. The following is a sample list of projects Joe has worked on since joining Nortech: .Project Manager,Laser Profiling/Video Road Reconnaissance,Juneau, Alaska °Project Manager:Laser profiling/video Inventory of existing power Transmission Line,Northern California. .Project Manager:Laser profiling/video ne power transmission line, Libby,Montana. .Project Manager:Mapping project (Tailing Pond DTM)using Laser/Video.Noranda Mines.Libby,Montana. .Field Project Manager:Micro Network,Saudi Arabia,GPS Calibration network &EDM baseline.17 points. .Alternate Field Project Manager:GPS Photo control project in Saudi Arabia -3'4 month project. °Relief Processing Manager,Oman office (1 month)conventional surveys. .Field Processing Manager,GPS Control Project for Alberta Environment Flood Plain Study in Northern Alberta. .Processor:Laser &Video Data. APEGGA Proposal:Healy to Fairbanks 230 KV Transmission Line -DVG Page 5 BARRY G.KASER POSITION: EDUCATION: EXPERIENCE: SENIOR PROJECT MANAGER University of Alberta,B.Sc.,1973 Northern Alberta Institute of Technology,1976 Honours Survey Diploma Mr.Kaser is a Senior Field Surveyor for Nortech Surveys.Upon his graduation from the survey program at NAIT in 1976,he has had varied survey experience. The following is a brief listing of his work experience and travels in the survey industry. From 1976 to 1980,Mr.Kaser was involved in conventional control surveying for photomapping and first and second order survey control as well as legal surveys.This involved pipeline and road right-of-ways,well sites,sub-divisions and other related surveys with both the Control and Engineering Division. Since that time,Mr.Kaser has been involved in such non-conventional survey techniques as Doppler,Inertial,GPS and Laser surveys.He has been involved in many aspects of projects including calibration of instruments,actual field procedures,operation and processing as well as final post-processing.He has gained valuable worldwide experience having been a part of major projects in Canada,the United States,and internationally.A brief summary of the various types of survey and worldwide experience follows: Doppler surveys in Canada,the Arctic,Peru,Sultanate of Oman,Saudi Arabia, Papua New Guinea from 1982 to 1988.Also inertial surveys in Canada,the United States,Saudi Arabia,Spain,Zimbabwe,Sultanate of Oman,Australia, Botswana,Yemen and Ethiopia from 1982 to 1990.GPS surveys (both static and kinetic)in Canada,the United States,Australia,Vietnam,Peru,Ethiopia, Indonesia and Yemen,ongoing since 1985.Laser surveys in Canada,the United States,Indonesia,Papua New Guinea,Malaysia and Mexico,ongoing since1985. Proposal:Healy to Fairbanks 230 KV Transmission Line -DVG Page 6 JOHN M.CARTER POSITION: EDUCATION: EXPERIENCE: PROJECT ENGINEER April,1989 Bachelor of Science (Survey Engineering),University of Calgary May,1982 Engineering Science Technology Diploma (Honours),S.A.I.T. 1992 MACRO Programming,S.A.I.T. 1990 GIS Workshop -University of Regina 1989 AutoCad Operator Course -University of Regina Since joining Nortech Surveys in August,1993,Mr.Carter has been training on our in-house software programs including PNAV and is becoming familiar with our laser system and other equipment.His past experience is as follows: Prior to joining Nortech,Mr.Carter was employed with Challenger Surveys and Services Ltd.His main function was to educate management on the uses and applications of "MapInfo"software to particular projects,and to develop graphics and text databases for GIS related projects and demonstrations.He was also involved in the development and production of product for the provincial mapping program. Mr.Carter has had project management experience on various projects worldwide.In addition to this,he has been in charge of the set-up and supervision of a digital mapping group,rewriting and correction of a digital imagery data retrieval program,provide survey control data for photo mapping programs as well as acting as liaison with other contractors regarding quality control. Proposal:Healy to Fairbanks 230 KV Transmission Line -DVG Page 7 JOHN E.HAGGLUND,P.Eng.,C.L.S. POSITION: EDUCATION: EXPERIENCE: MEMBERSHIPS: SENIOR TECHNICAL ADVISOR University of New Brunswick B.Sc.E.Surveying Engineering,1974 University of Calgary M.Eng.,1987 Mr.Hagglund is a Senior Survey Engineer in the Special Projects Division of Nortech Surveys.Prior to joining Nortech in 1976,Mr.Hagglund spent a two year term with the Surveys and Mapping Branch,Department of Energy,Mines and Resource where he was involved in legal and conventional control surveys. He was also involved in photogrammetric software development. Since joining Nortech,Mr.Hagglund's duties have included Doppler Satellite field work and software development regarding Doppler Satellite observation adjustments.Mr.Hagglund has also been responsible for the development of inertial navigation system software and methodology.Mr.Hagglund is at present developing software for manipulation of digital video imagery.He has also been involved in GPS positioning and navigation technology and in the integration of GPS and inertial systems for marine and airborne navigation.He is the author and/or co-author of several papers related to these topics. Canadian Institute of Surveying and Mapping Institute of Navigation Proposal:Healy to Fairbanks 230 KV Transmission Line -DVG Page 8 DOUGLAS HUNTER POSITION: EDUCATION: EXPERIENCE: SENIOR ELECTRONICS TECHNOLOGIST Southern Alberta Institute of Technology Telecommunications Engineering Technology (Honours),1984. Prior to his involvement in electronics,Mr.Hunter was employed as a Surveyor with McElhanney Surveying and has been involved in many areas of surveying, including overseas work.After graduating from SAIT,Mr.Hunter was with Northern Telecom Canada as part of their Test Engineering Group and was involved in the development,maintenance and repair of "state-of-the-art"test equipment for printed circuit boards. Over the past five years Mr.Hunter has been instrumental in the hardware design,construction and testing of our Digital Video Geographic System (DVG). This has included in-depth involvement with VME Electronics,Servo Electronics,Video and Video Annotation,Laser Ranging Systems,Avionics Navigation,Helicopter Installations,and much more. Other areas of responsibility have included field support for this system and its predecessors,the production of smaller electronics project for our particular interfacing and system needs and the overseeing of our lab facility in Calgary. At present,as our Senior Electronics Technologist,his duties still include those mentioned above,as well as providing guidance and support to our other electronics technologists and helping plan Nortech's future systems development. Proposal:Healy to Fairbanks 230 KV Transmission Line -DVG Page 9 ROLAND JACKMAN POSITION:SENIOR ELECTRONICS TECHNOLOGIST EDUCATION:Southern Alberta Institute of Technology Telecommunications Engineering Technology,1983 EXPERIENCE:Upon graduating from S.A.1.T.,Mr.Jackman was employed with Northern Telecom Canada as part of their test engineering group and was involved in the software and hardware development,maintenance and repair of automated test equipment for printed circuit boards.Mr.Jackman joined Nortech Surveys in March 1987 as an Electronics Technologist. As an employee with Nortech Surveys,Mr.Jackman is involved with the day to day maintenance operations as well as field operations. Mr.Jackman's responsibilities involve general repair,maintenance and upgrade of Nortech's electronic equipment.Areas involved are: *JMR Doppler Equipment «Airborne Laser Profiling System ¢Ferranti Inertial Navigation System *Norstar 1000,TI4100,Trimble GPS receivers *Digital Video Geographical System *LaCoste &Romberg Airborne Gravity System *Datalogger/barometrics Mr.Jackman's international field experience includes Botswana,Gabon,Ivory Coast,Ethiopia,Oman,Papua New Guinea,Australia,Peru,Malaysia,the United States and Mexico. Proposal:Healy to Fairbanks 230 KV Transmission Line -DVG Page 10 SIMILAR LOCAL PROJECT SAMPLES The DVG system has been used on similar projects recently completed in the United States and Canada. Nortech provided route profiling for 120 KM of new transmission line for Alberta Power including precise airborne coordination of all PI's along the route.An additional Alberta Power 150 KM transmission line project required laser profiles and video information to assist in right-of-way measurements. Laser profile and video were utilized on an existing transmission line for Power Engineers,Inc.,to update old survey records and for positioning over 500 structures using video imagery. An environmentally sensitive DVG/laser profiling project was recently completed in Banff National Parks for Trans Alta Utilities Corporation.Both laser profiling information and DVG imagery were used for both route selection and transmission line plan and profile generation. A similar project sample for the State of Alaska Department of Transportation and Public Facilities, which we have enclosed,represents a highway reconnaissance project in Alaska which evaluates the feasibility of constructing a road between Juneau,Alaska and the Continental Highway system and/or improving the Alaska Marine Highway system.Sample plan and profile sheets are part of the report produced by H.W.Lochner,Inc.who worked with Nortech on the Juneau Access Project.(Appendix A). Also enclosed is a sample of a plan/profile sheet generated through AutoCad by Nortech Surveys. (Appendix B). A profile survey reference plan for the Electricity Commission of Papua New Guinea is also enclosed. (Appendix C). Proposal:Healy to Fairbanks 230 KV Transmission Line -DVG Page 12 SCHEDULE AND ABILITY TO PROCEED In order to meet with an April 1,1994 schedule delivery for DVG work and presentation of the plan and profile sheets,Nortech will require the notice to proceed on February 15,1994.The actual DVG data acquisition,post-mission processing of profiles and digitization of attributes on the line will require approximately 45 days.The generation of plan/profile sheets at the scale required by the request for proposal will take approximately 60 days as 220 -250 sheets will be required to cover the 250 line kilometres of DVG profiling.This would delay the project deliverables to May 31,1994.If the plan/profile sheets are only required for the selected route then the DVG component could be completed by April 30,1994. March April May DVG Targets/Radio Link - -_-----(5 days) System Install DVG Data Acquisition =====(8 days) Post-Mission GPS Processing =3 -_---------(10 days) Digitizing Profiles (30 days) Digitizing Attributes (30 days) Image Frame Grabbing (30 days) Plan/Profile Sheet Generation *Optimum conditions for DVG data acquisition should be proposed,weather permitting, without snow cover on the ground.Nortech can proceed on March 1,1994 if weather permits. Proposal:Healy to Fairbanks 230 KV Transmission Line -DVG Page 13 (60 days) FEE SCHEDULE Mob/Demob (Equipment &Personnel)$14,700.00 Survey Control 24,000.00 Helicopter for Survey Control (est.2 days)6,000.00 DVG Field Data Acquisition 43,000.00 Helicopter for Data Acquisition (est.8 days)24,000.00 DVG Processing 30,000.00 Production of Final Plan and Profile Drawings (est.250 miles)55,000.00 ESTIMATED TOTAL $194,700.00 *Stand by charges -3,000.00/day. If Nortech is unable to work due to circumstances beyond our control,(ie.helicopter downtime,local disputes,satellite down time,poor weather conditions,etc.),stand by charges will apply. Notes: DVG data acquisition using a single flight line on each of the proposed routes has been quotedabove.Additional flight lines could be required for areas of difficult or rapidly changing topography which could increase costs. Nortech requests for Golden Valley assistance: Nortech has estimated an hourly helicopter rate of $600.00/hour.If helicopter time can be leased through Golden Valley,these estimated rates could be reduced. Nortech will also request Golden Valley's assistance for the licensing of a radio link for helicopter navigation and precise positioning information. Te and Conditions: 1.Fees are in U.S.dollars 2.Fees exclude all local taxes,duties,customs and agent fees 3 Rates commence the day after arrival into Alaska and cease the day of clearance upon departure. 4,Mob/demob is payable in full upon arrival of personnel and equipment in Alaska. 5.Monthly invoice are payable at net 30 days. Proposal:Healy to Fairbanks 230 KV Transmission Line -DVG Page 14 ADDITIONAL DIGITAL VIDEO GEOGRAPHIC (DVG™)SURVEY SYSTEM INFORMATION Appendix D Juneau T.V.news broadcast video tape.An unsolicited news broadcast created by the local Juneau T.V.station reporting on the Juneau Access Highway project. The first half details the scope of the project.The second half of the tape explains the technology used for route reconnaissance and preliminary design. Appendix E DVG brochure. Appendix F DVG paper presentation. Appendix G Nortech Surveys Company Profile. Proposal:Healy to Fairbanks 230 KV Transmission Line -DVG Page 15 GOLDEN VALLEY ELECTRIC ASSOCIATION INC.Box 71249,Fairbanks,Alaska 99707-1249,Phone 907-452-1151 January 19,1994 Del LaRue Dryden and LaRue PO Box 111008 Anchorage AK 99511-1008 Res Request for Proposal -Healy to Fairbanks 230 kV Intertie Substations and Reactive Compensation Dear Mr.LaRue: Golden Valley Electric Association,Inc.,located in Fairbanks, Alaska,intends to contract with an engineering consulting firm for complete design,material specifications,shop drawing review and preparation of bid documents for two substations.One substation will be located in the Fairbanks area and serve as the terminal of the new transmission line and will include a new Static Var System (SVS)or a Battery Energy Storage System (BES).The other substation will be added near Igloo,south of Cantwell,and will include a new SVS.Studies will be conducted to verify the controls for the existing SVS at Gold Hill and Healy will function correctly when operating in parallel with the electrically adjacent new SVS's.It is anticipated that the existing controls will need to be upgraded to similar speed and response of the new reactive compensation,and therefore,the control upgrade specification is included in this scope.As an option,proposals may include details on additional scope of work which may be expanded to include bid evaluation,project management,and construction inspection. Golden Valley as a member of Electric Power Research Institute (EPRI)can provide the successful proposer with a copy of a turn-key specification for a BES system which was developed by EPRI and Hawaiian Electric Company (HECO)for the procurement of a similar unit rated 10 MW for eight hours.The EPRI specification is proprietary to EPRI and once supplied as a guide to the successfulproposer,may only be used or referenced on this project. The Alaska Energy Authority recently procured two SVS's for Kenai, as part of Bradley Lake Hydro project.All of Bradley LakedocumentationandresponsibilityhasbeentransferredtoAlaska Industrial Development and Export Authority (AIDEA)including a turn-key specification for the Kenai SVS's.It is anticipated thattheSVSspecificationwillbeprovidedasaguidetothesuccessful proposer for use or reference on this project. GOLDEN VALLEY ELECTRIC ASSOCIATION INC. Del LaRue January 19,1994 Page 2 Request for Proposal -Healy to Fairbanks 230 kV Intertie Substations and Reactive Compensation The proposed tasks and responsibilities associated with task completion have been notated and are presented in the responsibility chart provided as an attachment to this letter.The responsibility chart is attached to illustrate specific responsibility sharing and is not intended to be a complete list of required duties. Firms wishing to be considered should respond in the form of a proposal and statement of qualifications,along with the resumes of staff available to support the work,man-hour breakdown for each work packet groups on the form provided,cost breakdown on the form provided,and applicable fee schedule,design schedule to meet proposed construction schedule,firms ability to proceed with the work immediately,sample of a similar project recently completed by the proposed project personnel,list of cold weather projects,and other applicable experience performed by the proposed project personnel.Project proposals will be evaluated on price and supplied information.Please note that complete functional designs are requested,as performance type specifications will not be acceptable for the substation portion of this work.Personal presentations are not necessary,however,if you have questions, don't hesitate to contact us. "Proposal"and information requested shall be sent to Golden Valley Electric Association,Inc.Engineering Department,P.O.Box 71249, Fairbanks,Alaska 99707-1249 and plainly marked "Proposal:Healy - Fairbanks 230 kV Intertie -Substations and Reactive Compensation". Letters of interest will be accepted until 5:00 p.m.local time, February 18,1994.The contract form for this work will be the standard REA Contract Form #236,including Golden Valley Purchase Order -Terms and Conditions. Sincerely, LI Steven Haagenson Manager of Engineering Services Enclosure:Proposed substation interconnection drawings (2 pages) Proposed Contract Forms General Engineering Cost Breakdown (2 pages) General Engineering Responsibility Chart (4 pages)Man-hour Breakdown per Resource/Task Chart (2 pages) ayraryoeOooOoNFDBDNTF&FWHNDISTRIBUTION LIST FOR REQUEST FOR PROPOSAL HEALY TO FAIRBANKS 230 kV INTERTIE SUBSTATIONS AND REACTIVE COMPENSATION 'Dryden and LaRue Power Engineers Stone and Webster Engineering Corporation,Inc. Commonwealth Associates,Inc. R.W.Beck and Associates ECSI Engineering and Consulting Services,Inc. Burns and.McDonnell Bechtel Group,Inc. United Engineers and Constructors,Inc. Fluor Daniel ENGINEERING SERVICE CONTRACT ELECTRIC SYSTEM DESIGN AND CONSTRUCTION AGREEMENT made J 19 ,beled theremafter called the "Ownerij, and _-of (hereinafter called the "Engineer ) WHEREAS,the Owner bas obtained from the Administrator of the Rural Electrification Administration (bereinafter called the ""Administrator'')of the United States of America a loan or loans to finance in whole or in part a rural electric system pursuant to the Rural Electrification Act of 1936,as amended,and plains che construction ofa project designated .being hereinafter called the "Project,''consisting of approximately the following facilities: miles of ______KV line, miles of KV line, KVA substation(s)KVto__COCKY, KVA substation(s)KV to KV, miles of line conversion,________miles of line removal and the following: NOW,THEREFORE,in consideration of the mutual undertakings herein contained,the parties hereto agree as follows: ARTICLE I General Obligations Section 1.The Engineer shall render diligently and competently all engineering services which shall be necessary or advisable for the expeditious,economical,and sound design and construction of the Project with due consideration given to all ecological and enironmental requirements.The enumeration of specific duties and obligations to be performed by the Engineer hereunder shall not be construed to limit the general under- takings of the Engineer. ARTICLE II Pre-construction Period Section 1.The Engineer shall give thorough consideration to aesthetics and the protection of the environment in all pbases.of construction of the Project including line routing and station locations.The REA FORM 236 (REV.6-72)|1 publication,"Enmronmental Critena for Electric Transmission Systems,"issued jointly by the U.S.Devart-ment of the Interior and the U.S.Department of Agniculture sball be used as a guide in the pianning of trans-mission systems,Where an Owner has an "Environmental Statement”ora published environmental analysis,the Engineer shall incorporate all environmental commitments of the statement or the analysis that specifi- cally relate to the transmission facilities to be constructed. BACH WRK EAH EK RS RTI XP K OT ONE fe IK MEK TA OOK HITE RIK XDRMMUdoReYelpLSHEPekaeMA08HtTERaeSead3WOOSKBOSALDOHDERAKEKCOPORI0kKPEARCORMFakatiskKWARHAptopIOWMHaceX Penk SEX pL ert Krall ape WK ok Re HAE XH QOK OPK ML OTPICLONCEOROSR On dA ES OL KWBKOPFRKPerBeratWAHSKIOEOMeatHateOMESeKabKapRAPKfOKUSKIKKROUK Ob Fe eS rt Vd OK Section 3.if requested by the Owner,the Engineer shall prepare and submit to the Owner estimates of quantities of materials to be furnished by the Owner for use in connection with the construction of the Project. The Engineer shall procure and submit to the Owner forms of contracts and other documents for such mate- rials and for such other services as may be necessary or desirable in connection with the construction of the Project. Section 4.For transmission lines the Engineer shall prepare and submit to the Owner and the Adminis- trator for approval a summary of transmission line design data with supporting calculations.The Plans and Specifications and the Plan and Profile,if any,sball be based on the design data approved by the Owner and the Administrator. Section $.The Engineer shall prepare and submit to the Owner and the Administrator for approval plan and profile sheets for all transmission lines except N/A Section 6.In specifying right-of-way clearing for transmission lines where '"feathering''and/or undulat- ing boundaries are required,the Engineer shail mark all brush and trees to be removed unless such marking is the responsibility of anotber authority.The Engineer sball also compute all clearing units,and show all clear- ing units on the plan and profile drawings or on separate drawings prepared for this purpose. Section 7.The Engineer shall prepare,and within days after the date of execution of this Agreement submit to the Owner and the Administrator for approval,two copies of complete and detailed plans and specifications,drawings,maps and other documents required for the construction of the Project (all of the foregoing being bereinafter collectively called the "Plans and Specifications").In the preparation of the Plans and Specifications,the Engineer sball consult with the Owner to the end that the Project sball serve the purpose intended by the Owner and approved by the Administrator.Unless otherwise directed by the Owner with the approval of the Administrator,the Engineer sball use Construction Work Plans and Engineering Studies,as furnished by the Owner,as a basis for the preparation of the Plans and Specifi- cations,The Engineer sball diligently make such changes in the Plans and Specifications as may be required by the Owner and the Administrator as a condition of approval thereof. Section 8.All maps,drawings,plan and profile sheets,plans and specifications,contract forms,addenda, estimates,studies and otber documents required to be prepared or submitted by the Engineer under this *Refer to project schedule . REA FORM 236 (REV.6-72)2 TTP BSE TEE Ss Beer web OEogSTP EDEL?ata le.LaeotherformsprescribedbyytheAdministrator,unless deviation therefrom snail tave Deen presbytheAdministrator. TEHRKLT RMON MK BRR WOK MAKE BRK RR NEX RE KIO Wt WO KOTO IKGRMNPMLHEXMOKMAGEDEBKMORKNICSEKONMACKSROEXOKORGSHELAKMKRUEKRKKMROMACKSNCRHONKKOERKRKOKKEXXARKAGEREKOUKGEMWOKXKWOEONENXDOKKONGEKKARKOWAEHKOKDRINKKNXCRRAERATORNXEAEKGCKTORENRAUIEAREARNMRHORAKORALERERHELDECK Section 10.KWAURHOTRK AX BKM SRK WL MOG KE MEEKER EK FoR AAOOKXSHEMKDLKKORRRRKARKKOMKKAAOpGEMOKRHKSOKOKRKRXPRIMRIXHASNTSKKGKORKKGWXMOCHARKMRKOTEKRRRGXKXXXCOKERKOLORANDERPORARKTheterm"Construction Contract"as used herein shall also include right-of-way clearing contracts,equipment contracts,or materials contracts if such contracts are utilized in the construction of the Project. Section 11.The Engineer shall be available XX2RIXRAPAKLMX for consultation with respect to the details of the Plans and Specifications and all other matters pertaining to the preparation of the pro- posals for the construction of the Project or the supply of materials or services therefor.XIRYERHIERKDRXRRRRAKRRARRKWRKEENSEKSOGKOENKTRAKTOROGESOKMMRKONRORESRRPCYEKINEMKSEKORORNRKMRRERRPOKXENRRRPGRKRKKTXARODMOKMAARUNMKERKBiKKSOXBARKERORKRENDXAGKARXKKANIKIKXKXBORRNGARRHRXNAKARRWRRENARBMAPERAMKOTNRAHAARARRERKARRARRAK Section 12.If any change is to be made in the Plans and Specifications after the Construction Contract bas been approved by the Owner and the Administrator,the Engineer shall prepare and submit the necessary details for a contract amendment in accordance with the procedure prescribed by the Owner and the Administrator. Section 13.Prior to the preparation of Plans and Specifications by the Engineer,the Owner shail furnish to the Engineer the following as may be applicable: (a)Copies of pertinent Engineering Studies,including Construction Work Plans when available,on . which to base the design of the electrical facilities to be built;key maps of the Owner's present and pro- posed facilities;and detail or vicinity maps showing location of existing lines,consumers served and ease- ments obtained. (b)Detailed lists of materials,if any,on band or on order which are to be furnished by the Owner in the construction of the Project,togetber with the quantity and the value of each item of such material. REA FORM 236 (REV.6-72)3 (c)With respect to matertals contamed in the assembly units indicated for removal,a lise showing values of individual matenal items for which the Contractor will be credited with respect to saivaged materials returned to the Owner if not included in item (b)above. ARTICLE Ill Staking Section 1,The Engineer,with the approval of the Owner,shall determine when staking of the Project shall begin;PeSHdth 108 MAM KORO Kee ARK tS KOO MOURA TIC TEC G HO Oe YK OO RK K XXCORMAN2GXHKOEMXGPOSHSHOEKMace2ObROOEGOLYOYEBEKOROTHOCKBYERAKX. PHYS ABE RAMAYANA The Owner shall furnish qualified persons to negotiate with landowners or tenants with respect to such right-of-way authorizations and easements and the locations of meter poles or service entrances,Pod EHpirit te ShGN PNAS Migs WH RN KOCK MAO MK CONLORGK NK ON K ROK XXreWAeKAMAOHKOKAKPARKERNawePREOwnershallberesponsibleforstakingoftheProjectunderaseparatecontract. Before the Construction Contract shall bave been approved by the Administrator,all project distribution line if less than 100 miles and all project transmission line if less than 30 miles should be completely staked.If project distribution line is 100 miles or greater,all conversion,repbasing,and removals (hereinafter called line changes)and one-third of the project distribution line not including line changes or 100 miles whichever is greater should be staked.If project transmission line is 30 miles or greater,one third of the project trans- mission line or 30 miles whichever is greater should be staked.Staking of the balance of the Project shall be completed before one-balf of the period specified in the Construction Contract for completion of construc- tion shall bave elapsed but in no event later than sixty (60)days prior to the date of completion specified in the Construction Contract. The staking shall be done in a thorough and workmanlike manner and in accordance with the latest revision of the National Electrical Safety Code,applicable state codes,plans and specifications and approved trans- mission line plan and profile sheets.FBS ApH MATOKAOXME WARE LMA Wb yt en ee EK BOK XCWEOUEKMEKBitCORHAIRaTRWOKEABOEKOEARMASBOKKESWOEMEKOOIUKOFHOEKXKXKPROSAEKXABIKESSARSETEFSOKAKDSOHMEKMONADonabeMatSRKBOXPORKMOTKORKXKKK SPB OSS BLK Ke Hk BK EM BBE MX All stakes shall be marked to show the pole number.Where practi- cable,all stakes shall be driven in such manner that the pole number shall be visible from the pole hauling truck when poles are being distributed.Each transmission structure stake shall be marked with the station number and the beig d class of pole.Where it is probable that the Contractor will have difficulty inlocatingstakes,wegen drive a four-foot building lath ov equivalent in addition and adjacent tothestake.The shall give due consideration to the location of the consumer's load center and service termination in staking pole locations on or near the consumer's premises so that the service entrance cable or low voltage conductors to buildings will be as short as possible. Section 2.The Engineer shail cause staking sheets ov structure lists to be maintained in such form as the Owner witb the approval of the Administrator shail require,on which shail be accurately entered all pertinent and useful information and directions concerning the construction of the Project,Five counter- parts of the staking sbeets or structure lists shall be supplied by the Engineer to the Contractor and two copies shall be supplied to the Owner.When revisions in staking sbeets or structure lists are necessary,the Engineer sball cause all copies of the staking sheets or structure lists to be corrected to reflect such revisions in the information or directions previously incorporated thereon. Section 3.The Engineer shall prepare and submit to the Owner and to the Administrator a report showing the quantity,kind,price,and extended total of all units of construction for each portion of the Project at the time such portion is released to the Contractor for construction. REA FORM 236 (REV.6-72)4 secaoon 4.A competent resident engineer,w21t0 pul auinonty (oact for ime Zapneet ioa re mae tained by the Engineer at the site of the Project at all ames when staking 1s being performed ARTICLE IV Construction Period ;rovide Construction Management (C1)serviceSection1,The Engineer shall Fete a UAL EPI HEALER OPA Rand shall make diligent effort to insure the expeditious and economical construction thereof tn accordance with the Plans and Specifications and the terms of the Construction Contract or contracts and insure that all specified environmental criteria are followed.The Engineer sball carefully inspect ail materials prior to their incorpo- ration tn the Project and shall promptly reject all materials not in compliance with the Specifications.The Engineer shall also wmpermeROAKinspect the manner of the incorporation of the matenals in the Project and the workmanship with which such materials are incorporated.Such inspection sball be deemed to be ade- quate if a reasonable percentage of all construction units are inspected at the time of installation.The Engineer,as representative of the Owner,shall bave sole responsibility for requiring the Contractor to per- form the Construction Contract in accordance with its terms and the Plans and Specifications;and,in performing the duties incident to such responsibility,the Engineer shall issue to the Contractor such direc- tives and impose such restrictions as may be required to obtain reasonable and proper compliance by the Contractor with the terms of the Construction Contract,Plans and Specifications,in construction of the Project;provided that the Engineer shall not be required to exercise any actual control over employees of the Contractor.The obligations of the Engineer bereunder run to and are for the benefit of only the Adminis- trator and the Owner. Section 2.The Engineer shall measure ground resistance at all substation ground fields prior to bond- ing the ground field to the substation structure.In addition,upon recommendation by the Engineer and authorization by the Owner,the Engineer shall measure the ground resistance at the following locations: (a)At all transmission structures with overhead ground wire prior to the installation of the overhead ground wire. (b)At all transmission structures with pole grounds prior to the installation of power conductor.The Engineer shall prepare a report of the ground resistance measurements mentioned above and submit such report to the Owner together with recommendations for changes,if any,required to insure satisfactory operation.To the extent such changes are approved,the Engineer shall make appropriate changes in the Plans and Specifications in accordance with the provisions of Section 12 of Article II. Section 3.The Engineer shall maintain at the site of the Project during the entire period of construc- tion a competent resident engineer with full authority to act for the Engineer,unless specifically directed otherwise by the Owner in writing with approval of the Administrator.When necessary to assure adequate inspection,one or more competent inspectors shall also be maintained when construction umits are being installed or corrective work is being performed,the number of inspectors being subject to approval by the Owner and the Administrator.The Engineer shall report,in writing,all defects in workmanship or matenals to the Contractor and the Owner and sbail instruct the Contractor to correct all such defects immediately, in accordance with the terms of the Construction Contract.A resident engineer shail be present during the final inspection of completed construction by a representative of the Administrator. Section 4.The Engineer shail test along lines,immediately after they bave been energized,for obyec- tionable radio interference.All cases of radio interference due to faulty construction of,or defective equip- ment in the Project sball be reported to the Contractor for correction. REA FORM 236 (REV.6-72)5 ARTICLE V Final Documents Section 1.The Engineer shall prepare and,within twenty (20)days after the completion of con-struction of the Project by the Contractor,submit to the Owner and the Administratorfor approval com-plete and detailed final documents. ARTICLE Vi Compensation Section 1.The Owner shall pay the Engineerfor the services performed hereunder as follows: (a)For all services in connection with the preparation of the transmission line design data as required ..xkbyArticleII,Section 4 bereof,the sum of Dollars (s__**), plus the sum of **Dollars ($**)per mile for each mile of Project transmission line included therein,which sum sball be due and payable ten (10)days after the approval of such services by the Owner and the Administrator. (b)For all services in connection with the preparation of the plan and profile sheets provided for in the approved Plans and Specifications,if and as amended,including lines which,pursuant to the direction of the Owner with the approval of the Administrator,sbail not be constructed the sum of *K**Dollars ($*)per mile of Project lines which sum shall consist of: kk$_______per mile of Project line for transit and tape survey,$**per mie of Project line *k ..:...for level survey,$__.per mile of Project line for office engineering as evidenced by approved plan and profile sheets.Such sums shall be due and payable ten (10)days after the plan and profile sbeets, im units of not less than ten (10)miles,are approved by the Owner and the Administrator. (c)For all services set forth in Article II,Section 9 bereof,a sum equal to the out-of-pocket expense of the Engineer plus N/A percent c_N/A_%)thereof,plus subsistence expense,if any,paid ta (or on bebalf of)employees,plus reasonable transportation costs of employees,plus the cost ofprints and telepbone and telegraph expenses,which sum sball be due and payable ten (10)days after approval by the Owner of the service performed and the invoice of the Engineer.Out-of-pocket expense sball be limited to money paid by the Engineer for direct labor,labor taxes,labor insurance,pro-rated sick leave,vacation, holiday,retirement,medical insurance,and life insurance benefits,all applicable to such direct labor,except that,in the case of services performed with the prior approval of the Owner by the following named officers, partners ov others baving ownersbip interest in the Engineer the rates corresponding to ''direct labor”set forth below sball apply: **Refer to estimated costs REA FORM 236 (REV.6-72)-6 (4)For all other services set forth in Artcie Il nereof,inciuding witrous wmilaiion,ite precaracs 4ofPlansandSpecifications,the award of the Construction Contract or contracts and any approved amen. ments thereto,and the preparation and awards of contracts for materials or services,the sum of xk K*K* Dollars ($_-____.),plus **...-Dollars ($)per mile for each mile of Project distribution line,including line changes,and Kk Dollars ($)per mile for each mile of Project transmission line included therein,which sum shail be due and payable ten (10)days after the approval of the Plans and Specifications and any amendment by the Owner and the Administrator. (e)For all services in connection with the staking of Project lines provided for in the approved Plans and Specifications if and as amended,including line changes otber than line removals and including lines which,pursuant to the direction of the Owner,with the approval of the Administrator,shall not be con- kkstructed,the sum of Dollars (s__**)per mile of ..... ****Project distribution line,and the sum of.Dollars ($__ per mile of Project transmission line,which sum shall be due and payable ten (10)days after delivery to the Owner each month ofa certificate by the Engineer of the staking completed during the preceding month. Such payments shail not constitute unqualified approval of the staking and where restaking is required for reasons witbin the control of the Engineer no additional compensation sball be payable. (f)For the replacement of stakes made necessary by causes beyond the control of the Engineer and where the total mileage of such replacements is in excess of ten (10)percent of the total miles of Project lines staked,a sum equivalent to seventy-five (75)percent of the compensation specified in subsection (e)of this Section shall be paid for each mile of replacement of stakes in excess of ten (10)percent of the total miles of project line staked,which sum shall be due and payable ten (10)days after delivery ta the Owner,each month ofa certificate by the Engineer of the miles of replacement of stakes completed during the preceding month. (g)For all services tn connection with the supervision and inspection of the construction of the Project as set forth in Article I'/hereof: (1)The sum of *%(s *%*)per day for each engineer for the time each engineer is actually and solely engaged in the supervision or inspection of construction,when construction is regularly scheduled and actually performed including time when the Engineer ts available and through no fault of the Engineer scheduled construction is not performed. (2)The sum of **($**)per day for each inspector for the time each inspector is actually and solely engaged in the inspection of construction,when construction is regularly scheduled and actually performed including time when the inspector is available and through no fault of the Engineer scheduled con- struction is not performed. The Engineer sball submit to the Owner each week a statement showing the names of the engineers and inspectors and the time actually spent by each engineer and each inspector during the preceding week in supervision and inspection work.Written approval by the Owner of such statement shall be a condition precedent to the payment by the Owner of any compensation under this subsection (g).**Refer to estimated costs REA FORM 236 (REV,6-72)7 Compensation payable under this subsection (g)shall be due and payable cen (10)daysafterthedeliveryeachmonthofastatementbytheEngineerofthesupervisionandinspectionworkperformedduringtheprecedingmonthandapprovedbytheOwnerasprovidedintheprecedingparagraph. (b)For all services in connection with substations or switching stations,except supervision and inspection of construction,an amount equal to N/A percent ¢___N/A %)of the cose of construction of such substation or switching station which sum shall be due and payable as follows: (1)50%of the compensation estimated by the Owner to be payable under this subsection (hb) sball be payable witbin 30 days after the approval of the Plans and Specifications by the Owner and the Administrator. (2)Such additional amount as will,with payment under (1)equal 80%of the compensation estimated by the Owner to be payable under this subsection (b)shall be payable within 30 days after the approval of the Construction Contract by the Owner and the Administrator. (3)The remaining compensation under this subsection (b)shall be due and payable 30 days after completion of the Project as bereinafter defined. "Cost of Construction”shail mean the total cost of labor and materials used in the con- struction of the substation or suntching station as shown in the Final Inventory Documents and Inventory of Work Orders in respect of work performed by the Owner. (i)For all other services in connection with the Project,including without limitation,the making of the Final Inventory and the preparation ofall final documents and maps,the sum of, **Dollas($___**__),plus **Dollars ($__**__), kkpermileforeachmileofProjectdistributionline,including line changes,and kkDollars($____+_e ss)per mile for each mile of Project transmission line included in the Final Inventory which sum sball be due and payable thirty (30)days after completion of the Project as hereinafter defined. Section 2.The total compensation to be paid for ail services performed by the Engineer under this kk we speAgreementisestimatedtobe,but not limited to $for transmission facilities,and kkS$for distribution facilities. Section 3.Compensation payable to the Engineer under this Agreement shall be in addition to taxes, or levies (excluding Federal,state and local income taxes),which may be assessed against the Engineer by any state ov political subdivision directly on services performed or payments for services performed by the Engineer pursuant to this Agreement.Such taxes or levies,which the Engineer may be required to collect or pay,sball,in turn,be added by the Engineer to invoices submitted to the Owner pursuant to tbis Agvee- ment. one (12)percent per month Section 4.Interest at the rate of SEPARAPLAKPekHehedshall be paid by the Owner to theEngineeronallunpaidbalancesduetheEngineercommencingthirty(30)days after the due date;provided **Refer to estimated costs REA FORM 236 (REV.6-72)8 that the telay in payment beyond che due date 1s not caused by any condition wighin tee camze:,tree Engineer.Such compensation shall be paid ten (10)days after the amount of interest Fas been dergemine j by the Engineer and the Owner. Section §.For the purposes ofthis Agreement,a transmission line is defined as any line 33 RV or more. Section 6.All computations of miles of Project lines actually constructed or cost of stations erected in connection with the determination of compensation payable under this Article VI,shall be determined from the Final Inventory Documents,Inventory of Work Orders in respect of work performed by the Ouner, Plans and Profile,or structure sheets supposed by the final documents approved by the Owner and the Administrator;provided,however,that where the original mileage used as a basis for the preparation of transmission line design data or plans and specifications shall have been reduced by action of the Owner after baving been ininally established by agreement of the Owner and the Engineer,compensation under Sections I (a)and 1 (d)of this Article VI sball be determined from the mileage first established and for which such work bas been completed by the Engineer.Compensation paid under this Article VI shall be subject to adjustment in conformity with this Section 6. Section 7.Prior to the time when any payment sball be made to the Engineer pursuant to this Agreement,the Engineer if requested by the Owner shail furnish to the Owner,as a condition precedent to such payment,a certificate to the effect that ail salaries or wages earned by the employees of the Engineer in connection with the Project,have been fully paid by the Engineer up to and including a date not more than fifteen (15)days prior to the date when such payment shail be made.Before the time when the respective final payments provided to be made pursuant to this Article VI shall be made to the Engineer by the Owner,the Engineer shall also furnish to the Owner,as a condition precedent to such payment,a certificate that all the employees of the Engineer bave been paid by bim for services rendered by them in connection with the Project and that all otber obligations which might become a lien upon the Project bave been paid. Section 8.The length of the Project lines shall be determined by taking the sum of all straight bori- zontal span distances between pole or structure stakes or from center to center of poles or structures carrying conductor,plus the length of service measured borizontally from center of last pole to point of attachment to the consumer's building.In computing the length of Project lines,underbuild and the additional circuit in the case of double circuit lines sball not be considered. ARTICLE VII Miscellaneous Section 1.The Owner may at any time terminate this Agreement by giving notice to the Engineer in writing to ebat effect not less than ten (10)days prior to the effective date of termination specified in the notice.Such notice shall be deemed given if delivered or mailed to the last known address of the Engineer. From and after the effective date specified in such notice,this Agreement shall be terminated,except that the Engineer shall be entitled to receive compensation for services hereunder as provided in Section 2 of this Article VIL Section 2.In the event that this Agreement at any time be terminated pursuant to Section 1 of this Article VI,the compensation which sball be payable to the Engineer by the Owner shall be computed so far as possible in accordance with the provisions of Article VI.To the extent that the provisions of Section I ofArticle VI cannot be applied because construction is incomplete at the effective date of such termination, the Engineer shall be paid for engineering services in respect of incomplete construction a sum which shall bear the same ratio to the compensation which would bave been payable under the provisions of Section | of Article VI,if such construction bad been completed as the engineering services in respect of such REA FORM 236 (REV.6-72)9 incomplete construction bear to the engineenng sernces which would have been rendered if construction bad been completed. If requested by the Owner,the Engineer shall submit to the Owner in duplicate a verified statement of his actual expenses in respect of such incomplete construction.All compensation payable under this Section 2 sball be due and payable thirty (30)days after the approval by the Owner of the amount due hereunder. Section 3.The Engineer shall have the right,by giving to the Owner not less than thirty (30)days notice in writing,to terminate this Agreement if the Engineer shail bave been prevented by conditions beyond the control and without the fault of the Engineer (t)from commencing performance of this Agreement for a period of rwelve (12)months from the date of this Agreement and (it)from proceeding uith the completion offull performance of any remaining services,required of the Engineer pursuant to this Agreement,fora period of six (6)months from the date of last performance by the Engineer of otber services required pursuant to this Agreement.From and after the effective date specified in such notice this Agreement shail be terminated,excepe that the Engineer shall be entitled to receive compensation for services performed hereunder,computed and payable in the same manner as set forth in Section 2 of this Article. Section 4.Upon completion of the Project or termination of the Contract,the Engineer shall be obligated forthwith to deliver to the Owner all maps,tracings,and drawings of the Project and all letters, documents,and other material,including all records pertaining thereto. The term "Completion of the Project..shall mean full performance of all obligations under this Contract and all amendments and revisions thereofas evidenced by the approval of the Administrator of the final documents. Section $.The following REA bulletins further describe the work to be performed by the E ngineerpursuanttocertainprovisionsofthisAgreement: REA Bulletin Tide 20-21 National Environmental Policy Act 40-6 Construction Methods and Purchase of Materials and Equipment 62-1 Transmission Line Manual 80-6 Summary of Construction Releases 80-11 Reports of Progress of Construction and Engineering Services 81-6 Closeout Procedure and Documents for Contract Construction of Distribution and Transmission Facilities 81-9 Preparation of Plans and Specifications for Distribution and Trans- mission Facilities In the performance of the Engineer's general obligations,other REA bulletins may be applicable. Section 6.The Engineer sball prepare and execute in such form and detail as the Owner and the Administrator sball direct all estimates,certificates,reports,and other documents required to be executed by the Engineer pursuant to the terms of the Construction Contract or the Loan Contract,including progress reports of engineering services and reports of the progress of construction. Section 7.The Engineer shall approve each monthly estimate of the Contractor prior to payment by the Owner.Such approval shall include a certification by the Engineer that all construction for which payment is requested bas been completed in accordance with the terms of the Construction Contract and that all defective construction,of which the Contractor shall bave received fifteen (15)or more days' written notice,bas been corrected.The Engineer shall also maintain at the site of the Project a cumulative inventory of all units of construction incorporated in the Project. ' REA FORM 236 (REV,6-72)10 Section 8.The Engineer shall nonfy the Owner when the Project,or any section thereof.irail cereadytobeenergized.When requested by the Administrator such notice shall also be given to the Adminis: trator.Whenever the Owner shall notify the Engineer that the Project,or such section thereof,may be energized,the Engineer shall,when directed so to do by the Owner,cause the Project,or such section thereof,to be energized. **=Section 9.The Engineer shall take out and maintain throughout the period of this Agreement the following minimum insurance:: (a)Workmen's compensation insurance covering all employees of the Engineer who shall perform any of the obligations of the Engineer bereunder,whether or not such insurance ts required by the laws of the State governing the employment of any such employee.If any employee is not subject to the workmen's compensation laws of such State,such insurance shail extend to such employee voluntary coverage to the same extent as though such employee were subject to such laws. (b)Public liability and property damage liabilit$108 OO ng all operdabasubder 02%,gree:ment;limits for bodily injury or death,not less than SABKFOOfor one person and XFACKBAfor each accident;for property damage,not less than SIS%00B for each accident andSXH000 aggregate for accidentsduringthepolicyperiod.$1,000,000 $1,000,000 be De hileess ¢.$1 0.,000(c)Automobile liability insurance on all self-propelled vebicles used in connectién with the Agreement whether owned,nonowned,or bired;public liability limits of not less than KHUBIGMDfor one person and 'or each accident;property damage limit ofS4@RO0 for each accident.P00,000 erry Samage ms oP "000,000Thepoliciesofinsuranceshallbeinsuchformandissuedbysuchinsurer as sball be satisfactory to the Owner,Upon request,the Engineer shall furnish to the Owner a certificate evidencing compliance with the foregoing requirements. Section 10.The obligations and duties to be performed by the Engineer under this Agreement shall be performed by persons qualified to perform such duties efficiently,The Engineer,if the Owner shail so direct and the Administrator sball so approve,shall replace any resident engineer or other persons employed by the Engineer in connection with the Project.The Engineer shall file with the Owner and the Adminis- trator a statement,signed by the Engineer,of the qualifications,including specific experience of each engineer and inspector assigned to the Project and the duties assigned to each. Section 11.Approvals,directions and notices provided to be given bereunder by the Administrator to the Engineer or the Owner shall be deemed to be properly given if given by any person autbonized by the Administrator to give approvals,directions or notices. SeXVAION RX RAEN N KRM ERK MARR AKANE ERE TER EERILY HEH ER LAEHARTOMOORHITKKABAWRENNHRIKIBOLLEKALLERIYLERRKKHOROURTMCOROTKHatinKERKASEHIHREHERREELRRAREheeydelineTed$OtR SSUES Section 13.This Agreement may simultaneously be executed and delivered in two or more counter- parts,each of which so executed and delivered shail be deemed to be an original,and all shall constitute but one end the same instrument. Section 14.The obligations of the Engineer under this Agreement shall not be assigned without the :approcal in writing of the Owner. Section 1$.The Engineer sball comply witb all applicable statutes pertaining to engineering and REA FORM 236 (REV.6-72)DB| **The limits of insurance have been increased to be complientwith7CFRPart1788,Subpart C -Insurance for Contractors,Engineers and Architects 7CFR 1788.48-Contract Requirements. Section 16 -The Engineer shall establish and implement aprogramtomonitorthequalityoftheconstruction.The Engineershallnothavecontroloverorchargeofandshallnotbe responsible for construction means,methods,techniques,and sequences or procedures,or for safety precautions and programs in connection with the Work,since these are solely the Contractor's responsibility under the Contract for Construction.The Engineer shall not have control over or charge of acts or omissions of the Contractor,Subcontractors,or their agents or employees,or of any other persons performing portions of the Work. Section 17 -All documents and drawings provided by Engineer related to this Project,are not intended or represented to be suitable for reuse by GVEA or others on expansions of this Project or any other project.Any such reuse without written verification or adaptation by Engineer for the specific purpose intended shall be at the reuser's sole risk and without liability or legal exposure to Engineer. The Engineer shall have the right to include representations of the design of the Project,including photographs among the Engineer's promotional and professional materials.The Engineer's materials shall not include the Owner's confidential or proprietary information.- Section 18 -Claims,disputes or other matters in questions between the parties to this Agreement arising out of or relating to this Agreement or breach thereof shall be subject to and decided by arbitration in accordance with the Construction Industry Arbitration Rules of the American Arbitration Association currently in effect unless the parties mutually agree otherwise. Demand for arbitration shall be filed in writing with the other party to this Agreement and with the American Arbitration Association.A demand for arbitration shall be made within a reasonable time after the claim,dispute or other matter in question has arisen.In no event shall the demand for arbitrationbemadeafterthedatewheninstitutionoflegalorequitable proceedings based on such claim,dispute or other matter inquestionwouldbebarredbytheapplicablestatuesoflimitations. No arbitration arising out of or relating to this Agreement shall include,by consolidation,joinder or in any other manner,an additional person or entity not a party to this Agreement,exceptbywrittenconsentcontainingaspecificreferencetothisAgreementsignedbytheOwner,Engineer,and any other person orentitysoughttobejoined.Consent to arbitration involving anadditionalpersonorentityshallnotconstituteconsenttoarbitrationofanyclaim,dispute or other matter in question notdescribedinthewrittenconsentorwithapersonorentitynot named or described therein. -1llA- The award rendered by the arbitrator or arbitrators shall be final,and judgement may be entered upon it in accordance with applicable law in any court having jurisdiction thereof. Section 19 -Nothing contained in this Agreement shall create a contractual relationship with or a cause of action in favor of a third party against either the Owner or Engineer. Section 20 -Unless otherwise provided in this Agreement,the Engineer and Engineer's consultants shall have no responsibility for the discovery,presence,handling,removal or disposal of or exposure of persons to hazardous materials in any form at the Project site,including but not limited to asbestos,asbestos products,polychlorinated biphenyl (PCB)or other toxic substance. Section 21 -The Engineer's Proposal for Design Services dated ,199_,and the Engineer's Proposal for Construction Management and Inspection Services dated ,199_,by mutual agreement,incorporated into and made a part of this contract. -11B- who will be in responsible charge of the Projectwarrantsthat NAME OF ENGINEER issued to bom by the State ofpossesseslicensenumber on the day of 19 22 Section if.The attached Golden Valley Electric Association, Inc.(GVEA)Purchase Order Terms and Conditions are hereby,bymutualagreement,incorporated into and made a part of this contract.If conflicts exist between the Form 236 Contract and the Purchase Order Terms and Conditions,the Form 236 will govern. IN WITNESS WHEREOF,the perries bereto bave caused bis Agreement to be duly executed. Golden Valley Electric Association OWNER By ATTEST:PRESIOENT SECRETARY ENGINEER By PRESIDENT,PARTNER® ATTEST: SECRETARY *Strike out inapplicable designation. REA FORM 236 (REV,672)12 GOLDEN VALLEY ELECTRIC ASSOCIATION,INC.(GVEA) Purchase Order-Terms and Conditions PRICEQUANTITIES:The price of prices and quantities stated on the face of this purchase order shail be firm and fixed except as aitered with written approval ofGVEA's purchasing agent.The price stated shail include federal,state and localtaxesuniessotherwiseexpressiyprovided. ACCEPTANCE OF ORDER:This purchase order confirms @ contract between the parties on the terms of this purchase order end any other relevant document(s)as listed on its face.By acceptance of this purchase order andor performance here- under,Seller agrees to comply fully with the terms and conditions of sale set forth on both the front and reverse sides of this document,end any supplements hereto which ere incorporated by a reference herein.Acceptance of this purchase order must be made on its exact terms and if additional or different terms are proposed by the Seller,such response will constitute @ counteroffer and no contract snail come into existence without GVEA's written consent to the counteroffer.Seiler represents that all goods supplied are free and ciear from all claims and liens of any nature whatsoever.Nothing in this order or acceptance shail be construed to make Seller an employee or agent of GVEA.This purchase order together with any relevant documents or attachments to it constitutes the entire agreement between the parties.Any deviation from this agreement must de accepted in writing by GVEA. INSPECTION ANO ACCEPTANCE:Final inspection of goods and services shail be upon GVEA's premises uniess otherwise agreed in writing.Any acceptance of goods is subject to inspection within a reasonable time after receipt.Payment oftheinvoicedoesnotcosteinsporotanceofmateriaiscoveredby the order,and GVEA reserves the right to inspect the goods before payment.if, upon inspection,any goods are found to be unsatisfactory,defective,or of inferior Quality or workmanship,or fail to meet the specifications furnished or the re- Quiremrents stated in the purchase order,GVEA may return such goods to Seiler at the Seller's sole risk end expense,including the cost for handling and transport- ation,inspection,and any other charge connected with noncompliance of the purchase order. SHIPPING:Ail shipments and routing shail comply with the directions on the face of this purchase order or,in the absence of specific shipping instructions,goods shail be shipped FO8 destination via the most economical means availabie.All transportation,shipping and forwarding charges must be prepaid unless other-wise indicated on the purchase order.GVEA reserves the right to refuse any and ail shipments with collect charges.Seller shail notify GVEA of shipments within sufficient time to permit GVEA to arrange for unioeding,and any claim for de-murrage resuiting from Seller's failure to comply shail be paid by the Seiler.Seilershallbeartheriskoftimelydeliveryofshipmentsinroute.The risk of loss shall remain with the Seller until delivery of goods into GVEA's possession at desti- nation,sudject to Seiler responsibility for adequate packaging. WARRANTY:The Seller warrants articles supplied on this purchase order to conform to specifications stated herein and to be fit and sufficient for the purpose manufactured.of good material and workmanship,and in the absence of otherapplicableexpressorimpliedwarrantyspecifying@longerperiod,free fromdefectsforaminimumperiodoftweive(12)months from delivery to GVEA.This warranty shail survive any inspection,delivery or ice of the goods or services,or psyment therefore by GVEA.Seiler further warrants that Selier shail comply with the requirements of ail soplicabie federal,state and local laws,ruies, ordinances and regulations,such as,but not limited to OSHA,Hazardous MaterieisTransportationAct,Toxic Substances Control Act and Consumer Product Safety Act. CHANGES/CANCELLATION:GVEA may require changes to this order at any time 8nd written modification shall be made ss ¥with all ce for increased cost,date of delivery.or other matters affected by the changes). GVEA may,at it's option,1 any unshipped merchandise previously ordered,subject to the obligation to pey for merchandise shipped prior to cancellation.if thepurchaseordercoversmerchandisemanufacturedorfabricatedtospecifications of GVEA,Seller shail discontinue ail performance on the subject matter,except as otherwise directed,immediatety upon receiving notice of such cancellation.in thesereofsuchcanceilation,end providing Seiler is nat in default,GVEA snail pay toeller: a)=6The cost incurred by Seller in connection with this order prior to notice of cancellation;or b)Such other costs,including cancellation charges under subcontract,es GVEA May have approved. The total cancelistion payment.pius previous payments,shall not exceed the total price of this order.Upon such payment,at GVEA's option,titie to eny materials or uncompleted merchandise shail pass to GVEA, REMEDIES.WAIVER:Time ie of the essence of this order,end in the event that performance or delivery is not timely,GVEA reserves the right to cancel,purchaseeisewhere,andor hold Seller eccountabie for resulting costs end damages in-curred.Seiler shall promptty notify GVEA of any event that threatens to delay performance or delivery. Any waiver by GVEA of any breach or default shail not be deemed continuing or applicable to other breech or default. 10. 1. 12. 13. 14. 18. 146 17. THIRD PARTY CONTRACT/ASSIGNMENT:Nerther this order nor any rgrts and obligations under it shail be assigned or contracted to third cares ov Se-er without the prior written consent of GVEA.GVEA shail promptly be furn:shed with written notice and @ signed copy of any assignment.Any claim for cavment ovAssigneesshallbesubjecttothosedefensesandset-offs which GVEA Tay PaveagainstSeiler.Seller shail insure that any third party contract and of assignment shail incorporate the provisions of this order by specific reference hereto INDEMNIFICATION:Seiler shail indemnify GVEA for any ioss,clam.damages. liadtlity,expense (inctuding reasonabie attorney's fees)of any cause of action whatsoever arising out of any act or omission of the Seller,its agents.emolovees or subcontractors.Seiler shall maintain such public tiability,property damage.em- ployee liability and compensation insurance 6s to protect GVEA from any saidrisxs and from any ciaims under eny appiicabie workers'compensation and occu- pational disease acts. GVEA reserves the right to require thet it be named as an edditional insured anSeller's insurance policies,that certificates of such insurance coverage be fur- nished upon request and that such additional insurance as it deems necessary be provided. The Selier agrees to defend,at its expense,GVEA and GVEA's empioyees.or any others using the product of GVEA,and hold them harmiess,with respect to any and all claims that the products or materials furnished by the Selier under this orcer infringe any United States and/or foreign patent,trademark,copyright and.or other property right of third partes. BUY AMERICAN:Selier shail edhere to the "Buy American”requirement of REA Bulletin 43-9.Any deviations from this requirement must be spproved in writing byGVEA's purchasing agent. LABOR AGREEMENTS:It is understood end agreed that the Seller shall abide by GVEA's project labor agreements if work at the jobsite is required in this order. SERVICES:Seiler and GVEA understand and agree that ail "services”con- templated by this egreement and provided by Seller to GVEA shall heave the same complete and entire meaning as the word "goods”in application of the UniformCommercialCode.All warranties a6 provided for by application of the Uniform Commercial Code,inctuding implied warranties of merchantabililty end fitness for @ particular purpose,shall apply to any and all services provided by Seiler to GVEA @s provided for in this agreement.Any and all other warranties,whether written or oral,statutory,express or implied,provided by Seiler to GVEA snail apply to the services specified in this Agreement. FEDERAL LAWS,ORDERS AND REGULATIONS:GVEA and ail subcontractors. vendors,and suppliers agree and certify that they shat!compiy with the re- quirement of ail pertinent federal iews,orders and regulations including dut notlimitedtoExecutiveOrder112461,a8 armended,and the requiations at 41 CFR 60-1 through 60-60,at 41 CFR 60-250 and 60-741 and Sections 38 USC 2012 503. CHOICE OF LAW:Any civil action arising from this purchase order shail be broughtintheFourthJudicialDistrictfortheStateofAlaska.The laws of the State of Alaska shail govern the rights end the obligations of the parties uncer this purchase order. LOBBYING DISCLOSURE:Any contract or sub:act which ds $100,000 shall comply with Federal Law,which governs this contract,and requires that ail contractors and any subcontractors comply with the following: No Federal appropriated funds have been paid or will be paid.by or on behalf of the undersigned,to any person for influencing or attempting to influence an officer oremployeeofanysgency,s Member of Congress.an officer or employee of Congress,or en employee of 8 Member of Congress in connection with theewardingofanyFederalcontract,the making of any Federal grant.the making of any Federal loan,the entering into of eny cooperative egreement.and the exten-sion,continuation or renewal,amendment or modification of any Federal contract, grant,joan or cooperative agreement. Vf any funds other than Federal eppropriated funds have been pard or will be pad to any person for influencing or attempting to influence an officer or employee of anyagency,a Member of Congress,an officer or employee of Congress,or an em- ployee of a Member of Congress in connection with this Federai contract.grant. loan,or cooperative agreement,the undersigned shail complete and submit Stan-dard Form-Li,"Disciosure Form to Report Lobbying,”in accordance with its instructions. By acceptance of this contract with GVEA,you are certifying that you are incompliancewiththisfederalrequirement.If you are required ta comoiete StandardForm-LLL,'Disclosure Form to Report Lobbying,”you must submit this form toGVEAatthetimethiscontractisenteredinto. WAIVER OF RIGHT TO FALE LIENS:Seiler hereby egrees not to file any mechanics', laborers',of materiaimen's lien or other lien egainst any GVEA premises or any part thereof on account of any services or goods furnished uncer ths order or anyadditionsorsddendatothisorder.Setier hereby waives the ngit to hie any such tien,and shail,if requested,execute e waiver of lien in recordanie form in favor of GVEA and the premises.Seiler shail insure thet any third party contract end or assignment shell incorporate the provisions of this purchsse order by specificreferencetothesetermsandconditions. SEVERABILITY:The invalidity in whole of in part of any condition of this purchase order shall not effect the validity of the other conditions.The remed'es reserved in these terms end conditions shail be cumulative end additional to any 'emedies in law of equity. ---[=-- HF138SUB.XLS General Engineering Cost Breakdown by Design Task and Links Project:Healy to Fairbanks 230 kV Intertie Substation and Reactive Compensation Task #Link # 1.0 PROJECT ADMINISTRATION Fbks MH $ Igloo MH $ 2.0 DATA REVIEW Fbks MH $ Igloo MH $ 3.0 DESIGN CRITERIA Fbks MH $ Igloo MH $ 4.0 DESIGN MANUAL Fbks MH $ Igloo MH $ 5.0 SOILS INVESTIGATION Fbks MH $ Igloo MH $ 6.0 SURVEY /ACCESS Fbks MH $ Igloo MH $ 7.0 CONSTRUCTION SPECIFICATIONS/DETAILS Fbks MH $ Igloo MH $ 8.0 MATERIAL SPECIFICATIONS /LIST Fbks MH $ Igloo MH $ 9.0 BID DOCUMENTS Fbks MH $ Igloo MH $ 10.0 BIDEVALUATION Fbks MH $ Igloo MH $ 11.0 ENGINEERING DURING CONSTRUCTION Fbks MH $ Igloo MH $ 12.0 RECORD DRAWINGS /CLOSEOUT Fbks MH $ Igloo MH $ 13.0 REACTIVE COMPENSATION Fbks _MH $ Igloo MH $ Page 1 Task # HF138SUB.XLS General Engineering Cost Breakdown by Design Task and Links Project:Healy to Fairbanks 230 kV Intertie Substation and Reactive Compensation Link # 14.0 15.0 16.0 0.0 0.0 EXISTING STATIC VAR SYSTEM CONTROLS Gold Hill MH $ Healy MH $ Teeland MH $ PROJECT/CONSTRUCTION MANAGEMENT Fbks MH $ Igloo MH $ CONSTRUCTION INSPECTION Fbks MH $ Igloo MH $ EXPENSES -DESIGN Fbks $ Igloo $ EXPENSES -CONSTRUCTION MANAGEMENT Fbks $ Igloo $ TOTAL LABOR AND EXPENSES | CONTINGENCY 10.00% GRAND TOTAL N.T.E.9 =====>| Page 2 HF138SUB.XLS General Engineering Responsibility Chart Project:Healy to Fairbanks 230 kV Intertie X =Primary Responsibility x =Minor Support Substation and Reactive Compensation RESPONSIBILITY Task #GVEA |ENGR]OTHERS 1.0 PROJECT ADMINISTRATION Project initiation meeting X X Monthly Progress Reports X Project Administration X 2.0 DATA REVIEW 2.1 Area Maps Xx 2.2 Determine Site location based on use requirements Xx 2.3 Local,State and Federal agency Coordination x x X 2.4 Determine access requirements /routes/helipad Xx X 2.5 Field review substation locations X 2.6 Final Site Map x x Xx 2.7 Cost Estimate Verification -Substations and SVC's x X 3.0 DESIGN CRITERIA 3.1 Develop Design Criteria x X 3.2 Ultimate future substation layout and site requirements x x 3.3 Develop relay,control and breaker requirements X 3.4 Structure Designs X 3.5 Clearance Requirements X 3.6 Reactive Compensation Type and Capacities x x x 3.7 Communications for SCADA control and indication x x 3.8 Acquire substation land rights for ultimate layout x x 4.0 DESIGN MANUAL 4.1 Basic Design Document-Substations X 4.2 Basic Design Document -Civil Design xX 4.3 Basic Design Document -Relay and Controls X 4.4 Basic Design Document -Reactive Compensation X 4.5 Design Data Summary (REA Form 265)X 46 Obtain REA approval of basic design document x x 5.0 SOILS INVESTIGATION 5.1 Geotechnic drilling (arctic experience required)X 5.2 Geotechnic analysis xX 5.3 Foundation /Embedment Design X 5.4 -Ground Resistance Measurements X Page 5 HF138SUB.XLS General Engineering Responsibility Chart Project:Healy to Fairbanks 230 kV Intertie Substation and Reactive Compensation X =Primary Responsibility x =Minor Support RESPONSIBILITY Task #GVEA |ENGR|OTHERS 6.0 SURVEY /ACCESS 6.1 Field survey -specifications and contract admin.X 6.2 Obtain field survey info.and perform control survey X 6.3 Assist surveyor during structure staking X 7.0 CONSTRUCTION SPECIFICATIONS /DETAILS 7.1 Prepare foundation plans for construction Xx 7.2 Structure data sheets X 7.3 Structure staking sheets and drawings x 7.4 Prepare structure drawings x 7.5 Prepare assembly drawings X 8.0 MATERIAL SPECIFICATIONS /LIST 8.1 Material inquiries X 8.2 Preliminary bill of materials Xx 8.3 Final bill of materials X 8.4 Prepare Material Bid Specifications xX 8.5 Obtain bids for materials X 8.6 {issue purchase orders for materials materials Xx 8.7 Expedite,inspect,and receive materials Xx 9.0 BID DOCUMENTS 9.1 Prepare construction contract packet -REA form 831 X 9.2 Issue construction contract for review X 9.3 Review design and construction contract packet x 9.4 -Solicit construction bids.Xx 9.5 Prepare engineer's estimate for Sub.construction X 9.6 Prebid Conference X X 10.0 BID EVALUATION 10.1 Conduct bid opening xX 10.2 Evaluate construction bids X 10.3 Notice to Proceed X 10.4 Preconstruction Conference X X 11.0 ENGINEERING DURING CONSTRUCTION 11.1 Provide engineering assistance during construction xX 11.2 Relay Settings for substation devices X Page 6 HF138SUB.XLS General Engineering Responsibility Chart Project:Healy to Fairbanks 230 kV Intertie Substation and Reactive Compensation X =Primary Responsibility x =Minor Support RESPONSIBILITY Task #GVEA |ENGR}OTHERS 12.0 RECORD DRAWINGS /CLOSEOUT 12.1.Perform as-built revisions X 12.2 Complete REA Closeout Documents -Form 254,etc.X 13.0 REACTIVE COMPENSATION (RC) 13.1.Finalize reactive compensation type and sizing x x X 13.2 |Prepare technical specifications for turn-key RC's X x 13.3.Evaluate technical proposals for turn-key installations X 13.4 Finalize technical proposals for commercial bids X 13.5 Prepare engineer's estimate for RC construction X 13.6 Evaluate commercial proposals x X 13.7 Review and Approve submittals and shop drawings X 14.0 EXISTING STATIC VAR SYSTEM CONTROLS 14.1.Study existing Gold Hill and Healy SVC controls x Xx 14.2 Specifications for replacement of Gold Hill SVC controls X 14.3.Specifications for replacement of Healy SVC controls X 14.4 Evaluate turn-key proposals for SVC control changes x X x 14.5 Review and Approve submittals and shop drawings X 15.0 PROJECT/CONSTRUCTION MANAGEMENT 15.1.Construction contract administration X 15.2 Conduct initial mtg with std.info exchange Xx 15.3 Conduct partnering mtg.with Contractor/GVEA xX X Xx 15.4 Review Contractor construction schedule x xX x 15.5 |Work with inspector for production and field decisions x 15.6 Review and recommendation for partial payments x 15.7 Maintain records of completed units/scheduled wk Xx 15.8 Develop and present Change Orders to GVEA Xx 15.9 Interpret contract for Contractor X 15.10 Maintain log of contract discussions and changes X 15.11.Assist GVEA with Agency Coordination X 15.12 Backup inspector as needed Xx 15.13 Conduct Final Inspection X 15.14 Perform as-built revisions X Page 7 HF138SUB.XLS General Engineering Responsibility Chart Project:Healy to Fairbanks 230 kV Intertie X =Primary Responsibility x =Minor Support Substation and Reactive Compensation RESPONSIBILITY Task #GVEA |ENGR{OTHERS 16.0 CONSTRUCTION INSPECTION 16.1.Daily on-site inspection of construction activities X 16.2 Provide daily inspection reports X 16.3 Conduct regular meeting with contractor X 16.4 Work w/CM to select best options for field conditions X 16.5 Develop data for change orders X 16.6 Assist GVEA with material record keeping X x 16.7 Review and approve wire stringing procedures x 16.8 Maintain a log of contractor discussions /changes X 16.9 Maintain independent reports of testing activities xX 16.10 Assist GVEA with agency coordination x x Page 8 HF138SUB.XLS Project:Healy to Fairbanks 230 kV Intertie Substation and Reactive Compensation Man-hour Breakdown per Resource /Task |Unit$$$$$$$$TOTAL Project Project Engineer AutoCAD Clerical CM Inspector COSTS Manager Engineer Staff PROJECT ADMINISTRATION Fbks Igloo AiGDATA REVIEW Fbks Igloo PADESIGN C RITERIA Fbks Igloo PAADESIGN M ANUAL Fbks Igloo AIGSOILS INVESTIGATION Fbks Igloo SURVEY/ACCESS Fbks Igloo CONSTRUCTION SPECIFICATIONS /DETAILS Fbks Igloo MATERIAL SPECIFICATIONS /LIST Fbks Igloo BID DOCUMENTS Fbks Igloo P|PAAIDP/HAAAPR(ABID EVALUATION Fbks Igloo ENGINEERING DURING CONST RUCTION Fbks Igloo AHAA/DRECORD DRAWINGS /CLOSEOUT Fbks Igloo ABAREACTIVE COMPENSATION Fbks Igloo AGAPage 9 HF138SU8.XLS Project:Healy to Fairbanks 230 kV Intertie Substation and Reactive Compensation Man-hour Breakdown per Resource/Task|_Unit$$$$$$$$ Project Project Engineer AutoCAD Clerical CM Inspector Manager Engineer Staff TOTAL COSTS |||| EXISTING STATIC VAR SYSTEM CONTROLS Gold Hill Healy Teeland P|PiSHPROJECT/CONSTRUCTION MANAGEMENT Fbks Igloo CONSTRUCTION INSPECTION Fbks Igloo AASUM | Total MH=>tl i Page 10 SUB-RC.XLS 69 kV to FMUS 138 kV to Gold Hill 138 kV to Ft Wainwright 69 kV . '' to Gold Hil +_t__60/80/100 . :Po Xfmr fo 1 69kV !1 138kV Ibaysoyedbays144!! ;1 6)| eee@) s |im ot i] ot en ee eed | :|reactive !'+Compensation ',4 'nn ree tot14future, |;4 230kV I Pb 'L__boy | , :1 '1 e | :' :1 ;1 69 kV to Ft.Wainwright 230 kV to Healy Proposed Interconnection Drawing for the Northern Terminal of the Intertie Page | SUB-RC.XLS 345 kV line to Cantwell and Healy i (operated at 138 kV) |Helilpad | || !| ]t I ----------: ro root |=4 Boysto be constructed for 230 kVstatic2|138kKV Var ;Bays po Breakers to be rated 138 kV System 1 (3)! 345 kV line to Douglas and Teeland (operated at 138 kV) Proposed interconnection Drawing for the Igloo Substation on the existing Anchorage to Fairbanks Intertie Page 2 GOLDEN VALLEY ELECTRIC ASSOCIATION INC.Box 71249,Fairbanks,Alaska 99707-1249,Phone 907-452-1151 January 19,1994 Power Technologies Inc. 775 Sunrise Avenue Suite 210 Roseville CA 95661 Res:Request for Proposal -Healy to Fairbanks 230 kV Intertie Electrical System Studies Golden Valley Electric Association,Inc.intends to contract with an engineering study firm for the development of a system design criteria and device sizing document for the Healy to Fairbanks 230 kv Intertie. The proposed scope of work is as follows: 1.Develop the system data base and unit dispatch for the appropriate study systems. 2.Study the system response at maximum transfers and determine the appropriate placement and size reactive compensation required dynamic response under secure imports. 3.Study the response of the existing static Var controls, recommend if the controls should be upgraded to reduce control interactions,and provide parallel unit operation and loading. 4.Prepare a report of results for these system studies. The scope of work was broken down into four tasks which are: 1.0 Project Administration 2.0 Data Review 3.0 Reactive Compensation -Rating and Placement 4.0 Existing Static Var Control Study The proposed tasks and responsibilities associated with task completion have been notated and are presented in the responsibility chart provided as an attachment to this letter.The responsibility chart is attached to illustrate specific responsibility sharing and is not intended to be a complete list of required duties. GOLDEN VALLEY ELECTRIC ASSOCIATION itIc. Power Technologies,Inc. January 19,1994 Page 2 Request for Proposal -Healy to Fairbanks 230 kV Intertie Electrical System Studies Completion date for all work and presentation of the draft report shall be March 1,1994.The information on the type,placement,and sizing of all reactive compensation is requested by February 15, 1994.If alternative time frames are proposed,please address the proposed dates in your proposal. Firms wishing to be considered should respond in the form of a proposal and statement of qualifications along with the resumes of staff available to support the work,man-hour breakdown for each work packet link groups on the form provided,cost breakdown on the form provided and appropriate fee schedule,schedule to meet proposed project schedule,firms ability to proceed with the work upon notice to proceed,sample of a similar project recently completed by the proposed project personnel,and a list of applicable local experience performed by the proposed project personnel.Project proposals will be evaluated on price and on the supplied information.Personal presentations are not necessary, however,if you have questions,don't hesitate to contact us. Proposal and information requested shall be sent to Golden Valley Electric Association,Inc.,Engineering Department,PO Box 71249, Fairbanks AK 99707-1249,and plainly marked "Proposal:Healy to Fairbanks 230 kV Transmission Line -Electrical System Studies." Letters of interest will be accepted until 5:00 p.m.,local time, January 28,1994.The contract form will be that of the Golden Valley Purchase Order with Standard Terms and Conditions,a copy which is included in this letter. Sincerely, a Steven Haagenson Manager of Engineering Services Enclosures Purchase Order Terms and Conditions -Cost Breakdown by Task and Link form Responsibility ChartMan-hour Breakdown per resource/task form GOLDEN VALLEY ELECTRIC ASSOCIATION,INC.(GVEA) Purchase Order-Terms and Conditions PRICLQUANTITIES:The price or prices and quantities stated on the face of this purchase order shail be firm and fixed except as sitered with written aporovel of GVEA's purchasing agent.The price stated shail inciude federal,state and local taxes uniess otherwise expreasiy provided. ACCEPTANCE OF OADER:This purchase order confirms @ contract between the parties on the terms of this purchase order and any other relevant document(s)as ”listed on its face.By acceptance of this purchase order andor performance here- under,Seller agrees to comply fuily with the terms and conditions of sele set forth on both the front and reverse sides of this document,and any supplements hereto which ere incorporated by a reference herein.Acceptance of this purchase order must be made on its exact terms and if additional or different terms ere proposed by the Seller,such response will constitute s counteroffer and no contract snail come into existence without GVEA's written consent to the counteroffer.Seller reoresents that all goods supplied are free and clear from sil claims and liens of any Nature whatsoever.Nothing in this order or ecceptance shall be construed to make Seller an empioyee or agent of GVEA.This purchase order together with any relevent documents or attachments to it constitutes the entire agreement between ov parties.Any deviation from this agreement must be accepted in writing byVEA, INSPECTION ANO ACCEPTANCE:Final inspection of goods and services shali beuponGVEA's premises uniess otherwise agreed in writing.Any ecceptance of goods is subject to inspection within a reasonabie time after receipt.Payment of the invoice does not constitute inspection or acceptance of materais covered by the order,and GVEA reserves the right to inspect the goods before payment.If, upon inspection,eny goods ere found to be unsatisfactory,defective,or of inferior quality or workmenship,or fail to meet the specifications furnished or the re- Quirements stated in the purchase order,GVEA may return such goods to Seller et the Seller's sole risk end expense,inciuding the cost for handling and transport- ation,inspection,and any other charge connected with noncompliance of the purchase order. SHIPPING:All shipments and routing shall comoty with the directions on the face of this purchase order or,in the absence of specific shipping instructions,goods shalt be shipped FOS destination via the most economical means avaiiadie.All transportation,shipping and forwarding cherges must be prepaid uniess other-wise indicated on the purchase order.GVEA reserves the night to refuse any and sil shipments with collect charges.Seller shail notify GVEA of shipments withinsufficienttimetopermitGVEAtoarrangeforunloading,and any claim for de-murrage resuiting from Selier's failure to comply shall be paid by the Seiler.SellershailDeartheriskoftimelydeliveryofshipmentsinroute.The risk of loss shail remain with the Seiler until delivery of goods into GVEA's possession at desti- Nation,subject to Seiler resp bility for edeq packaging. WARRANTY:The Seller warrants articles supplied on this purchase order to conform to specifications stated herein and to be fit and sufficient for the purpose manufactured.of good material and workmanship,end in the ebsence of otherapplicableexpressorimpliedwarrantyspecifyingalongerperiod.free fromdefectsfor8minimumpenodoftwelve(12)months from delivery to GVEA This werranty shail survive any inspection,delivery or of the goods or services,of peyment therefore by GVEA.Seiler further werrants that Seiler shail comply with the requirements of ail applicadie federal,state and local ews,rules, ord andr 18,such as,but not limited to OSHA,Hazardous MatensisTransportationAct,Toxic Substences Control Act and Consumer Product SafetyAct. CHANGES/CANCELLATION:GVEA may require aeroe to this order st any timeandwrittenmodificationshailbemadesswithceforincreasedcost,dete of delivery,or other matters effected by'thechengets). GVEA may,at it's opti i anyu d nandise previously ordered,subject to the obligation to pey for merchandise shipped prior to cancellation.If thepurchaseordercoversmerchendisemanufacturedoffabricatedtospecifications of GVEA,Seiler snail discontinue ail performance on the subject matter,except ss otherwise directed,immediatety upon receiving natice of such cancellation.in thesareofsuchcancellation,end providing Selier ie not in default,GVEA shail pay toeller: a)=6 The cost incurred by Seller in connection with this order prior to notice ofcancetlation;of b)Such other costs,including cancellation charges under subcontract.as GVEA may have approved. The total cancetlation payment,plus previous peyments,shail not exceed the total price of this order.Upon such payment,et GVEA's option,title to any mateneis oruncompletedmerchendiseshallpasetoGVEA. REMEDIES.WAIVER:Time is of the essence of this order,and in the event that performance of delivery is not timeiy,GVEA reserves the right to cancel,purchaseeisewnere,andor hold Seiler accountable for resulting costs and dameges in- curred.Seiler shall promptty noufy GVEA of sny event that threatens to deley performance of delivery. Any waiver by GVEA of any breech or default shell not be deemed continuing or applicedie to other breech of default. 10. WW. 12. 13. 14. 18. 16. 17. THIRO PARTY CONTRACT/ASSIGNMENT:Neither this order nor any 1 9r's ardobligationsunderitshailbeassignedorcontractedtotnirdcarescvSeer without the prior weitten consent of GVEA.GVEA shall pramotiy oe furn sped with written notice 8nd &signed copy of any assignment.Any claim for cayment oyAssigneesshallbesubjecttothosedefensesandsat-offs wich GVEA Tay rave against Setler.Seiler shail insure that any third party contract and or ass.gnmrent shail incorporate the provisions of thie order by specific reference Nereto. INDEMMIFICATION:Seller shall indemnity GVEA for any joss.claim.damages. labthity,expense (inctuding reasonacie attorney's fees)of any cause of action whatsoever arising out of any act or omission of the Seller,ts agents.employees of subcontractors.Seiler shail maintain such public ladility.croperty camage.em- ployee liability and compensation insurance as to protect GVEA from any said risns and from any claims under any appiicabie workers compensation and occu- pational disease ects. GVEA reserves the right to require that it be named as an additional insured onSeller's insurance policies,that certificates of such insurance coverage Oe fur- nished upon request and that such additional insurance as it deems necessary oe provided. The Seller agrees to defend.at its expense,GVEA and GVEA's empiovees.or any others using the product of GVEA,and hold them harmiess,with respect to any end ail claims that the products or matenals furnished by the Selier uncer tis order infringe any United States endor foreign patent,trademark,copyngnt and or other property right of third parties. BUY AMERICAN:Seiler shail adhere to the "Buy American”requirement of REA Bulletin 43-9.Any deviations from this requirement must be approved in writing byGVEA's purchasing egent. LABOR AGREEMENTS:It is understood and agreed that the Setier shail snide byGVEA's project labor agreements if work at the jobsite 1s required in this order. SERVICES:Seller end GVEA understand and agree that sil "services”con- templated by this agreement and provided by Seller to GVEA shail have the same complete and entire meaning as the word "goods”in sopiication of the UniformCommercialCode.All warranties 88 provided for by eppiication of the Uniform Commercial Code,including implied warranties of merchantabililty end fitness for8particularpurpose,shall apply to any end all services provided by Seller to GVEA 88 provided for in this agreement.Any and ail other warranties,whether wntten or oral,statutory,express or imolied,provided by Seller to GVEA shall spply to the services specified in thie Agreement. FEDERAL LAWS,ORDERS AND REGULATIONS:GVEA and ail sudcontractors, vendors,and suppliers agree end certify that they snail comply with tne re- Quirement of all pertinent federal jaws,orders and reguiations inciuding but notlimitedtoExecutiveOrder112461,as amended,and the reguiations at 41 CFR 60-1 through 60-60,at 41 CFR 60-250 and 60-741 and Sections 38 USC 2012 $03. CHOICE OF LAW:Any civil action arising from this purchase order shail be broughtintheFourthJudicialDistrictfortheStateofAlaske.The laws of the State of Alaska sheil govern the rights and the obligations of the parties under ths purchase order. LOBBYING DISCLOSURE:Any contract of sub act which ds $100.000 shalt comply with Federal Law,which governs this contract.and requires that all contractors and any sudcontractors comply with the foliowng: No Federal sppropristed funds heve been paid of will be paid.by of an benhaif of the undersigned,to any person for influencing or attempting to influence an officer oremployeeofanyagency.e Member of Congress,an officer or employee ofCongress,or en employee of Member of Congress in connection with theawardingofanyFederalcontract.the making of eny Federel grant.the making ofanyFederalloan,the entering into of any cooperstive egreement.and the exten-8iON,CONtinUstiON oF renewal,amendment or Modification of any Federai contract,grant,loan of cooperstive agreement. ¥any funds other than Federal appropriated funds heve been paid or will be paid ta any person for influencing or attempting to influence an officer or empiovee of anyagency,a Member of Congress,an officer or ernpioyee of Congress.or en em-pioyee of a Member of Congress in connection with this Federsi contract.grant, loan,or cooperative sgreement,the undersigned shail complete and submit Stan-dard Form-LULh,"Oisciosure Form to Report Lobbying,”in sccordance with iteinstructions. By acceptance of this contract with GVEA,you ere certifying that you ere incompliancewiththisfederelrequirement.if you ere required to complete StandardForm-LLL,"Disclosure Form to Report Lobbying,”you must submit this form taGVEAatthetimethiecontractisenteredimo. WAIVER OF RIGHT TO FILE LIENS:Seller hereby agrees not to file any mechanics',laborers',or materisimen'e lien or other lien egainst any GVEA premises of any pert thereof on sccount of ary services or goods furnished under this order or anyadditionsoreddendatothisorder.Seiler hereby waives the right to file any such tien.and shail,if requested,execute a weiver of lien in recordabie form in favor of GVEA end the premises.Seller shall insure that eny third party contract andor assignment shell incorporste the provisions of this purchase orcer by specific reference to these terms end conditions, SEVERABILITY:The invalidity in whole o¢in part of any condition of this purchaseordersnailnoteffectthevalidityoftheotherconditions.The remedies reserved inthesetermeendconditionssnailbecumulativeandadditionaltoanyremediesin lew OF equity. -=- HF138PTI.XLS Electrical System Study Cost Breakdown by Design Task and Links Project:Healy to Fairbanks 230 kV Intertie Task #Link # 1.0 PROJECT ADMINISTRATION Total MH $ 2.0 DATA REVIEW Total MH $ 3.0 REACTIVE COMPENSATION Total MH $ 4.0 EXISTING STATIC VAR CONTROL STUDY Total MH $ 0.0 EXPENSES Total $ TOTAL LABOR AND EXPENSES i i CONTINGENCY 10.00% GRAND TOTAL N.T.E.9 =====>|| Page 1 HF138PTI.XLS Electrical System Study Responsibility Chart Project:Healy to Fairbanks 230 kV Intertie X =Primary Responsibility x =Minor Support RESPONSIBILITY Task #GVEA |ENGR}OTHERS 1.0 PROJECT ADMINISTRATION 1.4 Project initiation meeting X X 1.2 Monthly Progress Reports X 1.3 Project Administration X 2.0 .DATA REVIEW 2.1 Verify System Electrical Data Base X 2.2 Determine Unit Dispatch and Transfers x x 2.3 Verify Existing SVC Control model xX 3.0 REACTIVE COMPENSATION 3.1 Fairbanks Area 3.1a Identify type of reactive compensation X 3.1b identify size of reactive compensation X 3.1¢identify placement of reactive compensation Xx 3.2 Healy Area 3.2a Identify type of reactive compensation Xx 3.2b Identify size of reactive compensation Xx 3.2¢Identify placement of reactive compensation X 3.3 Teeland Area 3.3a Identify type of reactive compensation x 3.3b Identify size of reactive compensation Xx 3.3¢Identify placement of reactive compensation Xx 4.0 EXISTING STATIC VAR CONTROL STUDY 41 Gold Hill Substation 41a Verify existing control response X 4.1b Recommend Corrective action if needed x 4.1c Identify required response of new controls X 42 Healy Substation 4.2a Verify existing control response X 4.2b Recommend Corrective action if needed X 4.2c Identify required response of new controls x 4.3 Teeland Substation 4.3a Verify existing control response Xx 4.3b Recommend Corrective action if needed Xx 4.3c ;Identify required response of new controls x Page 2 HF138PTI.XLS Project:Healy to Fairbanks 230 kV Intertie Electrical System Study Man-hour Breakdown per Resource /Tas |_Unit$$$$$_$$$TOTAL Project AutoCAD Clerical COSTS Manager Staff Staff i PROJECT ADMINISTRATION || ae Total |$__ DATA REVIEW Total |$_ REACTIVE COMPENSATION Total ||$ EXISTING STATIC VAR CONTROL STUDY|$ _Total |||$ SUM : Total MH=>[ Page 3 GOLDEN VALLEY ELECTRIC ASSOCIATION INC.Box 71249,Fairbanks,Alaska 99707-1249,Phone 907-452-1151 January 18,1994 Land Field Services PO Box 72510 Fairbanks AK 99707-2510 Rez:Request for Proposal -Healy to Fairbanks 230 kV Intertie Golden Valley Electric Association,Inc.intends to contract with a title research firm for the development of a Land Ownership Research document for the Healy to Fairbanks 230 kV Intertie. The proposed scope of work is as follows: 1.Identify land parcels and names of ownership of land parcels south of the proposed substation site along available alternative routes north of the Tanana River. 2.Identify potential parcels and ownership of available land for the Fairbanks area substation site.The proposed site is estimated to require approximately 20 acres. 3.Identify potential parcels and ownership of available land for the Igloo area substation site.The proposed site is estimated to require approximately 10 acres. 4.Identify land parcels and type of ownership of land parcels 'south of the Tanana River along the proposed alternative routes to Healy Substation. 5.Prepare location maps with mapping information listed. The scope of work was broken down into three tasks which are: 1.0 Project Administration 2.0 Data Review 3.0 Land Identification The proposed tasks and responsibilities associated with task completion have been notated and are presented in the responsibility chart provided as an attachment to this letter.Theresponsibilitychartisattachedtoillustratespecific responsibility sharing and is not intended to be a complete list of required duties. GOLDEN VALLEY ELECTRIC ASSOCIATION INC. Land Field Services January 18,1994 Page 2 Request for Proposal -Healy to Fairbanks 230 kv Intertie Land Ownership Research Completion date for all work and presentation of the Land Ownership information shall be March 1,1994.The information on the Fairbanks area substation site and routes north of the Tanana River is requested by February 15,1994.If alternative time frames are proposed,please address the proposed dates in your proposal. Firms wishing to be considered should respond in the form of a proposal and statement of qualifications along with the resumes of staff available to support the work,man-hour breakdown for each work packet link groups on the form provided,cost breakdown on the form provided and appropriate fee schedule,schedule to meet proposed project schedule,firms ability to proceed with the work upon notice to proceed,sample of a similar project recently completed by the proposed project personnel,and a list of applicable local experience performed by the proposed project personnel.Project proposals will be evaluated on price and on the supplied information.Personal presentations are not necessary, however,if you have questions,don't hesitate to contact us. Proposal and information requested shall be sent to Golden Valley Electric Association,Inc.,Engineering Department,PO Box 71249, Fairbanks AK 99707-1249,and plainly marked "Proposal:Healy to Fairbanks 230 kV Transmission Line -Land Ownership Research." Letters of interest will be accepted until 5:00 p.m.,local time, January 28,1994.The contract form will be that of the Golden Valley Purchase Order with Standard Terms and Conditions,a copy which is included in this letter. Sincerely, YB Steven Haagenson Manager of Engineering Services Enclosure:Route Map Purchase Order Terms and Conditions Cost Breakdown by Task and Link form Responsibility ChartMan-hour Breakdown per resource/task form BW GOLDEN VALLEY ELECTRIC ASSOCIATION INC.Box 71249,Fairbanks,Alaska 99707-1249,Phone 907-452-1151 January 18,1994 Yukon Title 714 4th Avenue Suite 1 Fairbanks AK 99701 Re:Request for Proposal -Healy to Fairbanks 230 kv Intertie Golden Valley Electric Association,Inc.intends to contract with a title research firm for the development of a Land OwnershipResearchdocumentfortheHealytoFairbanks230kVIntertie. The proposed scope of work is as follows: 1.Identify land parcels and names of ownership of land parcels south of the proposed substation site along available alternative routes north of the Tanana River. 2.Identify potential parcels and ownership of available land for the Fairbanks area substation site.The proposed site is estimated to require approximately 20 acres. 3.Identify potential parcels and ownership of available land for the Igloo area substation site.The proposed site is estimated to require approximately 10 acres. 4.Identify land parcels and type of ownership of land parcels 'south of the Tanana River along the proposed alternative routes to Healy Substation. 5.Prepare location maps with mapping information listed. The scope of work was broken down into three tasks which are: 1.0 Project Administration 2.0 Data Review 3.0 Land Identification The proposed tasks and responsibilities associated with task completion have been notated and are presented in the responsibility chart provided as an attachment to this letter.The responsibility chart is attached to illustrate specific responsibility sharing and is not intended to be a complete list of required duties. GOLDEN VALLEY ELECTRIC ASSOCIATION iNC. Yukon Title January 18,1994 Page 2 Request for Proposal -Healy to Fairbanks 230 kV Intertie Land Ownership Research Completion date for all work and presentation of the Land Ownership information shall be March 1,1994.The information on the Fairbanks area substation site and routes north of the Tanana River is requested by February 15,1994.If alternative time frames are proposed,please address the proposed dates in your proposal. Firms wishing to be considered should respond in the form of a proposal and statement of qualifications along with the resumes of staff available to support the work,man-hour breakdown for each work packet link groups on the form provided,cost breakdown on the form provided and appropriate fee schedule,schedule to meet proposed project schedule,firms ability to proceed with the work upon notice to proceed,sample of a similar project recently completed by the proposed project personnel,and a list of applicable local experience performed by the proposed projectpersonnel.Project proposals will be evaluated on price and on the supplied information.Personal presentations are not necessary, however,if you have questions,don't hesitate to contact us. Proposal and information requested shall be sent to Golden Valley Electric Association,Inc.,Engineering Department,PO Box 71249, Fairbanks AK 99707-1249,and plainly marked "Proposal:Healy to Fairbanks 230 kV Transmission Line -Land Ownership Research." Letters of interest will be accepted until 5:00 p.m.,local time, January 28,1994.The contract form will be that of the Golden Valley Purchase Order with Standard Terms and Conditions,a copywhichisincludedinthisletter. Sincerely, GA Steven Haagenson Manager of Engineering Services Enclosure:Route Map Purchase Order Terms and Conditions Cost Breakdown by Task and Link form Responsibility chartMan-hour Breakdown per resource/task form GOLDEN VALLEY ELECTRIC ASSOCIATION,INC.(GVEA)Purchase Order-Terms and Conditions PRICLQUANTITIES:The price of prices and quantities stated on the fece of this burchase order snail be firm end fixed except as aitered with written approval ofGVEA's curchasing agent.The once stated shail inciude federal,mate and iocal taxes uniess otherwise expressly provided. ACCEPTANCE OF ORDER:This purchase order canfirms 8 contract between the parties on the terms of this purchase order and any other relevant documentis)as hated on its face.By ecceptance of this purchase order andor performance nere- under.Seller egrees to comoly fully with the terme and conditions of sale set forth on DOIN the front and reverse sides of this document,and any supplements hereto which ere incorporated by 8 reference Nere:in.Acceptance of this ourchase order Must De Made On its exact terms and if adaitionai of different terms ere proposedbytheSelier,such response will constitute @ counteroffer and no contract snail come into exstence without GVEA's written consent to the counteroffer.Seller represents that all goods suopiied ere free end ciear from ali claims and liens of any Mature whatsoever.Nothing in ths order or ecceotance shail be construed to makeSeileranempioveeoragentofGVEA.This puren order together with any relevent documents or etachments to it constitutes the entire agreement between oven Any deviation from this agreement must be eccepted in writing byVv INSPECTION ANO ACCEPTANCE:Final inspection of goods and services shail beuponGVEA's premises uniess otherwise agreed in writing.Any acceptance of goods is subject to inspection within a reasonabie time after rece:pt.Payment of the invaice does not constitute ir or ce of matenats covered bytheorder,and GVEA reserves the right to inspect the goods before payment.i, UPON inspection,any goods ere found to be unsatisfactory.defective,or of infenor Quality or workmanship,of fail to meet the specifications furnished or the re- quirements stated in the purchase order,GVEA may return such goods to Seiler ettheSetler's sole nsk and expense.inciuding the cost for handling and transport-ation,inspection,and eny other charge connected with noncompliance of the purchase order. SHIPPING:All shipments and routing shail comply with the directions on the fece of tue purchase order or.in the absence of specific enipping instructions,goodsshailbeshippedFwiathemosteconomicalmeansavailable.All transportation,shipoing and forwarding charges must be precaid uniess other- wise indicated on the purchase order.GVEA reserves the mgt to refuse any and ail shipments with collect charges.Seller snait notify GVEA of shipments withinsufficienttimetopermitGVEAtoarrangeforunioeding,and any claim for de-murrege resulting from Seller's failure to comply shail be paid by the Seller.Selier shail bear the nsk of timely delivery of shioments in route.The net of loss shail remain with the Seiler unt!delivery of goods inte GVEA's possession at dest- Nation,subject ta Seiler responsibility for adequate packaging. WARRANTY:The Seller warrants articies supplied on this purchase order to conform to specifications stated herein and to be fit and sufficient for tne purpose manufactured.of good maternal end workmanship,and in the edsence of other applicable express of implied warrenty specifying @ longer period.free fromdefectsforaminimumpenodoftweive(12)months from delivery to GVEA.This werranty shail survive any inspection,delivery or of the g or services,or payment therefore by GVEA.Seiler further werrante that Seiler snail compty with the requirements of ail appiicadie federel,state and local jews.ruies, ordinances and reguiations,such as.Dut not limited to OSHA,Hazardous MatensisLaneponationAct,Tome Substances Control Act and Consumer Product Safety CHANGES/CANCELLATION:GVEA may require enone to this order at any timeandwnttenmodificationshailbemadesewathailceforincreasedcost,date of delivery,or other matiers effected by the chengete). GVEA may,at it's opti i ony d merchandise previously ordered,sudject to the obligation to pey for er d pnor toca .tftne purchese order covers merch st ed of fabricated to specifications of GVEA,Seller shail discontinue aif performance on the subsect Matter.excent as otherwise directed,immedlatety upon receiving notice of such cancellation inthexenofsuchcancellation,end providing Seller is not in default,GVEA snail pay toler: 0)§=6The cost incurred by Seller in connection with thie order pnor ta nouce ofcancellation;or db)Such other costs,including cancellation charges under subcomract,as GVEA may heve spproved. The total cancellation peyment,plus previous psyments,shall not exceed the totalpriceofthieorder.Upon euch payment,st GVEA's opnon,ute to eny maetenais oruncompletedmerchandisechalpasetoGVEA. REMEDIES/WAIVER:Time is of the essence of this order,and in the event thetpertormanceordeliveryisnottimety,GVEA reserves the right to cancel.purchasesisewnere,andor hold Seller accountable for reeuiting costs end damages in-curred.Seiler shail promptty noufy GVEA of any event that threatens to delay performance or delivery. Any waiver by GVEA of any breech of defeult shell not be deemed continuing orepplcadietootherBreachofdefault. 10. "1. 12. 14, 18. 1% 17. THIRD PAATY CONTRACT/ASSIGNMENT:Neher this orcer 707 ary -gr's arcObligationsunderitsmailbeessignedorcontractedto'hird cates ty Se a without (he orior written consent of GVEA.GVEA snail oramotiv oe fue shed wn written notice 8nd 8 signed copy of any assignment Any cam for savant tyAssigneessnailbesubjecttothosedefensesandset-ofs wnich GvEA Tay nave agemnst Setler.Seller snail insure thet any third party contract and of ass.gnmrertshailincorporatetheprovisionsofthisorderbyspecificreferenceNereto INDEMNIFICATION:Seller shail indemmty GVEA for any loss.clam.cereges.haoilty,expense linciuding ressanadie attorney 0 'ees:of any <ause of act.an whatsoever arising out of any act or orm:ssion of the Seer tsagents.er ocvees orsubcontractors.Seiler shail mamntain such public heouity,property camage em-ployee lamiity and compensation insurance as (o protect GVEA from ary sad:suaandfromanyclaimsunderanyepplicabieworkers'compensation and occu: pational disease ects. GVEA reserves the right to require that it be named as an additional insured onSetier's insurance policies,thet certificates of such insurance coverage De 'ur-fished UPON request end that such additional insurance ast deems necessary be provided. The Seiler agrees to defend.et its expense.GVEA and GVEA's emplovees.or any others using the product of GVEA,and Noid them harmiess.with rescectto any and ail Clarrme thet the products of materiais furnianed by (he Seiler under ths orger infringe eny United States and/or foreign patent,trademark,copyngnt ana or cinerpropertyrightofthirdparties. BUY AMERICAN:Seller shail edhere to the "Buy Amencan”requirement of PEA Bulletin 43-9.Any deviations from this requirement must be soproved in writing byGVEA's purchasing agent. LABOR AGREEMENTS:It is understood and agreed that the Seller shail anice byGVEA's project labor agreements if wort at the jobsite 1s required in this orcer. SERVICES:Seiler and GVEA understand and agree that all "services”con- templated by this agreement and provided by Setier to GVEA snail have tne samecompleteandentiremeaningestheword"goods”in soplication of the UniformCommercialCode.All warranties es provided for by application of the UniformCommercialCode.inciuding implied warranties of merchantability ena fitness for 8 particular purpose,shail appiy ta sny and ail services provided by Seiler to GVEA 80 provided for in this agreement.Any and all other warranties,whether written or oral,statutory,express of implied.provided by Seller to GVEA snail apply to tne services specified in this Agreement. PEOERAL LAWS,ORDERS ANO REGULATIONS:GVEA and ail sudcontractors, vendors,and supphers agree and certify that they shail comoy with tne reQuirementofallpertinentfederallaws,orders and reguistions inciuding but notlientedtoExecutiveOrder112461,8 amended,end the reguistions at 41 CFR 60-1through60-60,at 41 CFR 60-250 and 60-741 and Sections 38 USC 2012 $03. CHOICE OF LAW:Any civil ection ansing from this purchase order shall be DroughtwntheFourthJudicialOietnctfortheStateofAlaska.The jaws of the State of Alasta shell govern the nghts end the obligations of the parties under this purchase order. LOGSVING DISCLOSURE:Any contract or ntrect which ds $100,000 shail comply with Federal Law,which governs ths contract,and requires that ailcontractorsandenyeubcontrectorsptywithtnef9: No Federal epprooristedfundsNevebeenpaidorwill be paid.by of on bensifoftheundersigned,to any person for influencing of sttempung ta influence an officer oremployeeofanyegency.a Member of Congress,en officer or employee ofCongress,or an employes of a Member of gress 1A Connection with theawardingofonyFederalcontract.the making of any Fecers!grant.the making ofanyFederalloan,the entering into of any cooperative agreement.end the exter:SION,CONTINUETONOFrenewal.amend aif of any Feceral contract,grant,loan or cooperstive sgreement. Hf any funds other than Federal appropriated funds Neve beer paid or will be paid ta any person for influencing of attempung to influence an officer or empiovee of anyagency.a Member of Congress.an officer or employee of Congress.or en em-ployee of a Member of Congress in connection with this Federal contract.grant, loan,of cooperative egreement,the undersigned snail complete and suomi Sten-dard Form-LLh,"Disclosure Form te Report Lobbying,”in eccordance with its inetructions, By scceptence of this contrect with GVEA,you are cerufying thet you are incompliancewrththisfederalrequirementifyouererequiredtocompleteStandardForm-iLl,'"Diecioeure Form to Report Lobbying,”you must submit tne form taGVEAatthetimethecontractisenteredinto. WAIVER OF RIGHT TO ALE LIENS:Seiler hereby agrees not to fle amy mechanics',laborers',or meteriaimen's lien or other lien egeingt any GVEA premises of armypertthereofoneccountoferryservicesorgoodsfurnishedundertheorderoranyadditionsoreddendetothieorder.Seller hereoy weives the mgmt to file any such len,and snail,if requested,execute 6 waiver of lien in recordebie form in favor of GVEA and the premises.Seller shall insure that eny third party contract andaetergnmentshellincorporstetheprovissoneofthiepurchseeorderbyspecificteterencetothesetermsendcondroons, SEVERABELITY:The invelidity in wholeor in pert of eny condition of this purchesaordershellnoteffectthevalidityoftheotherconaitionsThesemediesreservedf theese terms end condivens shall be cumuisove and edditone to eny remedies if lew of equity. -E-- HF138LND.XLS Land Ownership Research Cost Breakdown by Design Task and Links Project:Healy to Fairbanks 230 kV Intertie Task #Link # 1.0 PROJECT ADMINISTRATION Total MH $ 2.0 DATA REVIEW Total MH $ 3.0 LAND IDENTIFICATION 3.1 MH $ 3.2 MH $ 3.3 MH $ 3.4 MH $ 0.0 EXPENSES Total $ TOTAL LABOR AND EXPENSES CONTINGENCY 10.00% GRAND TOTAL N.T.E. Page 1 HF138LND.XLS Land Ownership Research Responsibility Chart X =Primary Responsibility x =Minor Support Project:Healy to Fairbanks 230 kV Intertie RESPONSIBILITY Task #GVEA |LAND |OTHERS 1.0 PROJECT ADMINISTRATION 1.1 Project initiation meeting X X 1.2 Monthly Progress Reports X 1.3 Project Administration X 2.0 DATA REVIEW 2.1 Area Maps X 2.2 Preliminary Line Routing and Pt Selection xX x 2.3 Preliminary Line Route Map X 3.0 LAND IDENTIFICATION 3.1 North of Tanana River (Fairbanks area) 3.1a Identify Land Parcels along Route X 3.1b Identify Ownership along Route (by name)X 3.1¢Provide route information maps X 3.2 Fairbanks area substation site 3.2a Identify Land Parcels for substation site X 3.2b Identify Ownership of sites (by name)xX 3.2c Provide site information map xX 3.3 Igloo area substation site 3.3a identify Land Parcels for substation site X 3.3b Identify Ownership of sites (by name)X 3.3¢Provide site information map X -3.4 South of Tanana River (Fairbanks)to Healy Sub. 3.4a identify Land Parcels along Route X 3.4b Identify Ownership along Route (by type)X 3.4¢Provide route information maps X Page 2 Project:Healy to Fairbanks 230 kV Intertie Land Ownership Research Man-hour Breakdown per Resource /Task HF138LND.XLS |Unit$$$$$$$$ Project Manager Staff Staff AutoCAD Clerical PROJECT ADMINISTRATION L Total i a flDATAREVIEW Total LAND IDENTIFICATIO 3.1 3.2 3.3 3.4 | I | |onost {1 i PAA|HSUM Total MH=> Page 3