The URL can be used to link to this page

Home My WebLink AboutDOE Info distribution sheet 1995._Department of Energy !Y aWashington,DC 20585 UNITED STATES DEPARTMENT OF ENERGY ""_QFFICE OF CONGRESSIONALAND ..INTERGOVERNMENTAL AFFAIRS - DISTRIBUTION SHEET I am pleased to provide you with the enclosed information.if you have anyquestions,call me at 202/586-7944. Robert M.Alcock Deputy Assistant Secretary, .Intergovernmental Affairs Enclosures . . .&Printedwith Soy ink on fecycied paper onR-95-017 NEWS MEDIA CONTACTS:. -| 'FOR IMMEDIATE RELEASE Hope Williams,202/586-5806 February 14,1995.Keith Holloway,202/586-5806 DOE,ENERGY SERVICE COMPANIES LAUNCH JOINT EFFORTTOCUTENERGYUSE,SAVE MONEY , A partnership launched today between the Department of Energy and the National Association of Energy Service .Companies (NAESCO)--could save building owners as much as $700 million ayearinenergycostsbyyear2000. NAESCO members are responsible.for installing and managing energy systems.Under the new joint effort,DOE and the energy"service companies will encourage building owners to reduce theirenergyuseandsavemoneybyinvestinginenergy-efficient.equipment.DOE and NAESCO will-also educate building owners about the benefits of energy efficient technologies available innewspaceconditioning,lighting,water heating and refrigeration"equipment. "Partnerships with groups like NAESCO are so importantbecausebuildingsuse36percentoftheenergyconsumedin the United States,"said Christine Ervin,DOE's Assistant SecretaryforEnergyEfficiencyandRenewableEnergy."We will act as a catalyst to bring together commercial,industrial and state and local government customers and energy service companies." NAESCO's efforts will include production of a how-to guide for companies interested in the step-by-step process of performance contracts.Customers benefit because energy servicecompanieswillgetnewenergyefficientproducts,and systems.Terry Singer,Executive Director of Washington-based NAESCO,said energy service companies can help finance a project,andtherebyhelpbuildingownersavoidlargeinitialequipmentexpenses."This 'Energy Fitness'campaign can make building'owners aware of the advantages of long-term energy efficiencyinvestments.These investments can be cash-flow positive fromdayone,"Singer added.(MORE) &Printed with soy ink on recycled paper =U.S.Department of Energy ©-Office of the Press Secretary ©Washington,DC20585 - -2- The goal is to reduce U.S.energy consumption annually by anamountapproximatelyequaltoallthegasolineconsumedin,theU.S.during a two-and--a-half day period. "This is a low-capital cost,low-risk way for building)owners to see the savings add up year after year,"said Lynn Sutcliffe,NAESCO's president and head of SYCOM Enterprises. ,Investments in energy efficient building upgrades are whollyorpartially'funded through savings in utility bills.Energyservicecompaniesimprovebuildingenergysystemsandgive .building owners performance guarantees that result in long-termreducedenergybills._DOE is contributing $400,000 in 1995 to the cost-sharedprojectwithNAESCO. -DOE- R-95-017 .- : -- NEWS MEDIA CONTACT:FOR IMMEDIATE RELEASEAnneElliott,202/586-1607 February 16,1995 |ENERGY DEPARTMENT ADVISORY COMMITTEE WILL EXAMINE-OPTIONS FOR IMPROVING NUCLEAR SAFETY OVERSIGHT |Secretary of Energy Hazel R.O'Leary and Under Secretary Charles Curtis today announced the formation of a federal Advisory Committee on External Regulation of Department of Energy (DOE)Nuclear Safety.The panel will recommend how existing and new DOE facilities and operations should best be -overseen to protect environment,safety and health,eliminate unnecessary oversight,and reduce costs. The committee's charter responds to a growing sentiment within the Department,at DOE facilities,and by external observers that DOE self- regulation is cumbersome and inefficient,and that.external regulation couldimprovesafetyandcutcosts.Work of the Committee follows on the recently released Galvin Task Force Report on the DOE Laboratories,which concludedthattheDepartmentshouldshiftlaboratoryoversightandinspectionfunctionstootherfederalagencies. A transition to external regulation was also embraced during a meetingthisweek,chaired by Under Secretary Curtis,of the Directors of DOE's majorlaboratories,and senior DOE officials. Dr.John F.Ahearne and Mr.Gerard F.Scannell will serve as the committee's co-chairs.Secretary O'Leary remarked,"I can't imagine two morequalifiedpeopletoguidethisimportanteffort."Dr.Ahearne is theExecutiveDirector,Sigma Xi,The Scientific Research Society;and past Chairman,Nuclear Regulatory Commission and the DOE Advisory Committee onNuclearFacilitySafety.Mr.Scannell is President,National Safety Council;former Assistant Secretary for Occupational Safety and Health in the Bush Administration;and former Vice President,Corporate Safety Affairs,Johnson & Johnson.The advisory committee staff,whose members are from the DepartmentofEnergy,the Environmental Protection Agency and the Nuclear RegulatoryCommission,has been assembled under Executive Director Thomas H.Isaacs,aseniorcareerDOEofficial.. (MORE) R-95-013 @ Printed with soy ink on recycled paper a U.S.Department of Energy e Office of the Press Secretary e Washington,DC 20585 B -2- "In announcing the committee,Under Secretary Curtis said,"This eminent .committee will help the Department move aggressively toward external ' regulation --a key commitment in our 1994 Strategic Plan and an importantstepinadvancingtheDepartment's critical missions".The advisory ;'committee's formation fulfills.a commitment made last:year by Under SecretaryCurtisbeforetheHouseSubcommitteeonEnergyandMineralResources,during ahearingonabilltosubjectthedepartmenttoNuclearRegulatoryCommissionregulation. ;Secretary O'Leary emphasized,"The advisory:committee isa major step intthedepartment's continuing efforts to increase program productivity and savetaxpayerdollars.The department is dedicated to achieving unquestioned : environmental,safety and health protection in.all of its activities.At the-Same time,|we need a regulatory fframework that is more effective and less .expensive."Over the past half century,the department and its predecessor agencieshaveregulatedthemselveswithregardtonuclearsafety,as provided for undertheAtomicEnergyAct.The manner of oversight established in the Actreflectedtheagency's primary responsibilities for development and productionofnuclearmaterialsandweapons,and for many other classified nationalsecurityactivitiesappropriateinaColdWarenvironment.Production was ofhighestpriorityduringthosetimes,and the results include a legacy ofsafetyandenvironmentalproblemsatnumerous:DOE sites.The nuclear mission of the department has changed and is now focused largely on the stewardship and dismantlement of nuclear weapons,cleanup ofcontaminatedsites,safe decommissioning of facilities,and minimization ofriskstoworkersandthepublic.In addition,in recent years the departmenthasbecomesubjectto.an increasing number of external federal and stateregulatoryrequirementsandoversight,while at the same time internalrequirementsandoversighthaveintensified.The department also now receives . advice from the Defense Nuclear Facilities Safety Board,established by : Congress in 1988 to make recommendations regarding safety at DOE defense -nuclear facilities.AccordingtoO'Leary,"This patchwork of regulatoryrequirementsandoversightmustberethought...This committee is essential todevelopingasmarterapproach.”Regulatory options will be examined whichweighcostsagainstprojectedbenefitsinsafety,health,and environmental .'protection.Secretary O'Leary also emphasized,"We are not talking about additionalregulation.Quite the opposite.The committee will examine how to streamlineandfocussafetyoversight.I look forward to receiving the committee'srecommendationslaterthisyear.". .The committee will be asked to submit an interim report to the SecretaryandsimultaneouslytotheWhiteHouse,Office of Management and Budget,andCouncilonEnvironmentalQualitywithinsixmonthsandprovidefinalrecommendationsbytheendoftheyear.A complete roster of advisory committee members.is attached. -DOE - R-95-013 "MEMBERS OF ADVISORY COMMITTEE ON EXTERNAL REGULATION OF DEPARTMENT OF ENERGY NUCLEAR SAFETY Dr.John F.Ahearne,Co-chair;'Executive'Director,Sigma Xi,The ScientificResearchSocietyandAdjunctScholar,Resources for the Future,North |'Carolina (Former Chairman,U.S.Nuclear Regulatory Commissionand DOE .Advisory Committee on Nuclear Facility Safety)Gerard F.Scannell,Co-Chair;President,National Safety Council,Itasca,-Illinois (Former Assistant Secretary of Labor for Occupational Safety andHealthAdministrationandFormerVicePresident,Corporate Safety_Affairs,Johnson.and Johnson)Andrew D.Caputo,Attorney,Nuclear Progran,Natural Resources Defense_Council,Washington,D.C.'Joseph A;Dear,Assistant Secretary for Occupational Safety and Health,Department of Labor,Washington,D.C.Victor A.Franklin,Chief Environmental Counsel,Westinghouse,Pittsburgh,PennsylvaniaBeverlyE.C.Gattis,'Serious Texans Against Nuclear Dumping,Amarillo,Texas |J.J.Glauthier,Program Associate Director for Natural Resources,Energy andScience,Office of Management and Budget,Washington,D.C.Sheri W.Goodman,Deputy Under Secretary of Defense for Environmental -..Security,Washington,D.C.Dr.Andrew C.Kadak,President and Chief Executive Officer,Yankee AtomicElectricCompany-_'Sylvia M.Kieding (Krekel),Health and Safety Coordinator,Oil,Chemical andAtomicWorkersInternationalUnion,Lakewood,California.Mathew Leivas,Sr.,Chairman and Chief Executive Office,Chemhuevi Tribe,.Havasu Lake,CaliforniaDr.Walter E.Massey,Provost and Senior Vice President Academic Affairs, -University of Calffornia,Berkeley,California.Dr.Mildred McClain,Executive Director,Citizens for Environmental 'Justice,.Savannah,Georgia _-Dr.James Melius,Scientific and Medical Director,Center 'to Protect Workers''Rights,AFL-CIO,Washington,D.C.Michael H.Mobley,Director,Department of Environment and Conservation, Division of Radiological Health,Nashville,Tennessee and Council of:Radiation Control Program Directors -: 'Dr.Thomas.E.Murley,Consultant,Former Director,Nuclear Reactor Regulation,U.S.Nuclear Regulatory Commission,Potomac,Maryland_Robert H.Neill,Director,Environmental Evaluation Group,Albuquerque,NewMexico-Mary D.Nichols,Assistant Administrator for Air and Radiation,U.S..Environmental Protection Agency,Washington,D.C. Dr.Tara 0O'Toole,Assistant Secretary for Environment,Safety and Health,Department of Energy,Washington,D.C.: Jim Payne,Assistant Attorney General,Environmental Enforcement Section, .Office of the Attorney General,Columbus,Ohio and National AssociationofAttorneysGeneralStephenD.Ramsey,Vice President,Corporate.Environmental Programs,General.Electric Company,Fairfield,Connecticut©Gail Schoettler,Lieutenant Governor,State of ColoradoBruceG.Twining,Manager,Albuquerque Operations Office,DOE,Albuquerque,New MexicoTroyE.Wade II,Wade Associates,Former Assistant Secretary for DefensePrograms,DOE,Las Vegas,Nevada R-95-013©as Energy Information Administration EIA Reports=-U.S.DepartmentofEnergy . ,.a"Washington,DC 20585 FOR IMMEDIATE RELEASE: .February 15,1995 -Natural Gas Wellhead Prices Expected,-to Remain Low In First Half 1995:According toaa report released today by the Energy Information Administration (EIA),a_recovery in natural gas wellhead prices is tempered by the general expectation:that gasdemandwillgrowmoreslowlyin1995thanin1994.This lower demand projectionreflectsthelikelihoodthattheextremecoldwinterofearly1994willnotberepeatedandthelikelihoodthattheeconomyin1995willnotmatchits1994averagerateof_growth.- EIA's Short-Term Energy Outlook reports that spot natural gas wellhead prices in the last_quarter of 1994 averaged about 50 cents per thousand cubic feet below year-ago levels.-.This was largely the result of notably high levels of underground storage,and lower.demand caused by the very mild weather on the East Coast (the month of November.'was the 4th warmest on record).Continuation of this mild weather through January1995isexpectedtoresultinlownaturalgaswellheadpricesthroughthefirsthalfof1995.The 1995 average wellhead price is projected to decline by 7 cents per thousand -cubic feet compared with 1994.In 1996 the average wellhead Price is expected to rise by.14 cents compared with 1995,although most of the 1996 changeis related to the .temporarily depressed gas.market iin the current.quarter.The EIA also projects that slower economic growth,firmer product prices and assumed | normal weather patterns are expected to slow U.S.petroleum demand growth to an: average of 250,000 barrels per day during the two year forecast period,or 1.3 percent in1995and1.4in 1996.Other major findings from the EIA quarterly report Short-Term Energy Outlook include: '_ @ .Crude oil prices are expected to rise steadily during the next 2 years,assuming no)major disruption of supplies.From $15.65 per barrel at end-December 1994,_crude oil prices are projected to climb to $18 per barrel by the end of 1996..Petroleum product prices are expected to rise slowly,reflecting theincrease incrudeoilpricesaswellasspecialfactors,such as the recent introduction ofreformulatedgasoline. -MORE- EIA-95-06 -2- a Barring a return of the cold weather patterns experienced during the first quarter .,of 1994,the most likely scenario is for.a declinein heating fuel demand,compared with the same period last year,resultingin no growthin distillate fuel -oil demand for 1995.Because deliveries of natural gas were less affected by lastyear's severe winter,demandis projected to register continued steady growth,_even though some weakness this winter is expected compared to last year. e --Having grown by 2.5 percent in 1994,natural gas demandis projected to increase'more slowlyin 1995 and 1996 along with the economy.Most of 1994's robustgrowthwasattributedtotheincreaseinelectricity-generating demand.1995 and_.1996 are expected to witness continued substantial growthin electricity-generating--demand,accounting for over one-third of the total growth iin natural gas demand.- |@ _Electricity demandis expected to grow at 2.0 percent in 1995 and 2.5 percent in:-1996.:The commercial sector is expected to account for the bulk of that growth. o Growth iin electricity demand will be the only major source of growthin coal'demand during the forecast period.-Coal production,which gained almost 80milliontonsin1994asaresultoflabordisputesinthepreviousyear,is expectedtoincreasebyover20millionttonsduring1995and1996.'Copies of Short-Term Energy Outlook aare available from the U.S.Government Printing -Office or through EIA's National Energy Information Center,Room 1F-048,ForrestalBuilding,Washington,DC,20585,+202/586-8800.. EIA. EIA Program Contact:'David Costello,202/586-1468EIAPressContact:Thomas Welch,202/586-1178 DOE News Media Contact:'Pailip Keif,202/586-5806)EIA-95-06- Department of Energy oo Washington,DC 20585 |ae Ir A UNITED STATES DEPARTMENT OF ENERGY OFFICE OF CONGRESSIONAL AND INTERGOVERNMENTAL AFFAIRS DISTRIBUTION SHEET 1 am pleased to provide you with the enclosed information.If you have any questions,call me at 202/586-7944. Robert M.Alcock _Deputy Assistant Secretary, intergovernmental Affairs . Enclosures &Printed with soy ink on recycled paper NEWS YOU CAN USE May 24,1995 PROJECTS SELECTED FOR SMALL BUSINESS TECHNOLOGY TRANSFER Grants averaging $100,000 over nine months will be awarded to 17 small,high tech firms selected by DOE for Phase I of the Department's two-part annual Small Business Technology Transfer (STTR)program.Phase I grants --with technical topics ranging from biomass production of alternative fuels to miniaturized equipment for nonproliferation radiation detection instruments --will be used to determine the innovative concept's feasibility.Successful researchers will be eligible to compete for Phase II awards (with funding of up to $500,000 over two years)to further develop the concept.The STTR program,designed to increase commercialization of federally funded R&D projects conducted by small firms in collaboration with research institutions such as federal laboratories,universities,colleges,etc.,is part of a three-year DOE program.The next STTR solicitation is expected this fall.A list of the winning firms --located in Alabama,Arkansas,California,Colorado,Connecticut,Massachusetts, Maryland,New York,Tennessee,Washington,and Wisconsin --is available from the press office., Media contact:Jeff Sherwood,202/586-5806 PETROLEUM ASSOCIATION SAYS ENERGY BUDGET CUTS "VIOLATE SPIRIT OF THE ELECTION MANDATE" In a letter to Congressman Joe Barton (R-TX),the Permian Basin Petroleum Association opposed budget cuts to the Department of Energy's research and development partnership programs.The letter notes that "over the past two years,the DOE-industry shared technology and research program[s]have begun to bridge the gap lost in the research cutbacks"among major oil and gas companies.The association lambasts House Budget Committee Chairman Kasich's (R-OH)"demonizing and false comments."The association also highlights projects ®Printed with soy ink on recycled paper a U.S.Department of Energy ©Office of the Press Secretary e Washington,DC 20585 | designed to minimize the declinein domestic oil and gas production,emphasizing the need forthistypeofresearch,especially when "domestic productionis at an all-time low"and "imports[are]approaching 51 percent in 1994."In addition,Midland,TX-based Parker &Parsley Petroleum USA told Senator Pete Domenici (R-NM)about its support for DOE's research partnerships.The company reiterated that "without DOE's current program,the petroleum industry would be 'null and void"with domestic production becoming "a tombstone in remembrance."Copies of the letters are available. Media contact:Mike Gauldin,202/586-4940 ,WEST VIRGINIA CENTER SELECTED TO DEVELOP TECHNOLOGIES FOR DECOMMISSIONING NUCLEAR WEAPONS FACILITIES .DOE's Morgantown Energy Technology Center (METC)has been selected by the OfficeofEnvironmentalManagementtodevelopnewandinnovativetechnologiestoaddressawide range of problems associated with deactivating and decommissioning former nuclear weapons facilities operated by the Department.One high priority focus will be to develop and demonstrate technologies that will reduce the quantities of contaminated waste from nearly 7,000 DOE facilities (buildings,waste sites,etc.)that are scheduled to be deactivated,decontaminated,dismantled and disposed during the next 30 years.. Media contact:Jayne Brady,202/586-5806 CONFERENCES/WORKSHOPS/SPEECHES SECRETARY SPEAKS IN ITALY ON GEOTHERMAL ENERGY Secretary of Energy Hazel R.O'Leary addresses the World Geothermal Congress today on the benefits and wide availability of geothermal energy.O'Leary is speaking at the closing - plenary of the Congress taking place this week in Florence,Italy.Geothermal energy has been "hugely successfulin the United States"and "is rapidly becoming a competitive source of energyworldwide,"O'Leary says. Media contact:Penny Adams or Amber Jones,202/586-5806 FOREIGN RESEARCH REACTOR SPENT FUEL TO BE DISCUSSED IN WASHINGTON,DC PUBLIC MEETING The US government's proposed policy on managing spent nuclear fuel from foreign research reactors will be discussed at an open house and public meeting scheduled on 'Wednesday,May 31 from 1:00 to 5:00 pm at the Omni Shoreham Hotel,2500 Calvert St.,NWinWashington,DC.An additional 15 meetings are scheduled around the country to answer questions and hear public views on the policy which will be managed by DOE and the U.S. Department of State.The public is invited to attend all the meetings.For more information call 1-800/741-0060.Media contact:Jayne Brady;202/586-5806 -30- B-95-17 NEWS MEDIA CONTACT:FOR IMMEDIATE RELEASE Jayne Brady,202-586-5806 May 25,1995 STATEMENT OF THOMAS P.GRUMBLY ASSISTANT SECRETARY OF ENERGY FOR ENVIRONMENTAL MANAGEMENT IN RESPONSE TO THE ACTION BY THE NATIONAL SECURITY COMMITTEE The Department of Energy is concerned with the cuts of nearly $750 million taken by the House National Security Committee from its Environmental Management budget.We are concerned about cuts directed to specific program areas,particularly in the high risk nuclear materials program.In light of the serious health,environmental,and safety problems posed by the former nuclear weapons complex,these cuts,which amount to about half of the Committee's reductions for the Department's weapons cleanup program,are significant and will have a substantial impact on program results.The other half were uncosted balances.Beliefs that . uncosted obligations is "free money"ora "slush fund"are not true.These funds are the result of prudent accounting,resulting from withheld contractor funds until actions are completed,or scheduling slippage to obtain permits.We have already reduce our uncosted obligations and our.| current balances are $500 million less than previous years.Cutting our budget on the assumption that these uncosted balances are "available"is "borrowing from Peter to pay Paul." If finally enacted,the impacts will be felt around the country through delays in cleanup actions and in additional reductions in the work force.We will continue to stand by the President's budget,which supports the most analytically defensible program,and will work with the Congress to address these concerns. R-95-079 | -DOE- ®Printed with soy ink on recycled paper a U.S.Department of Energy ®Office of the Press Secretary e Washington,DC 20585 a NEWS MEDIA CONTACTS:FOR IMMEDIATE RELEASE Penny Adams/Amber Jones,202/586-5806..May 26,1995 , SECRETARY OF ENERGY PENS AGREEMENT WITH ITALIAN MINISTER;PROMOTES JOINT ENERGY RESEARCH AND DEVELOPMENT AND ENERGY CONSULTATIONS Joint projects in energy cooperation between the United States and Italy got a boost today in an agreement signed by Secretary of Energy Hazel R.O'Leary in Florence,Italy. The accord signed by O'Leary and Alberto Clo,Italy's Minister of Industry,Commerce,and . Handicraft,expands and extends a Memorandum of Understanding that has enabled joint activities between the two countries since December 5,1985,It provides a framework that encourages joint experiments and tests;the exchange of scientific and technical information,personnel,materials,and equipment;jointly funded research and development projects of interest to both parties,and consultations on energy planning and energy policy and market issues. 'Accomplishments under the previous agreement included a demonstration of US coal/water mixture - technology in Italy,coal studies,improvements in coal gasification and liquefaction technology,enhanced oil recovery programs in both countries,and exchange ofinformation and experience in renewable energy sources,particularly geothermal energy. The new accord improves on the previous one by addressing the issue of protecting intellectual property created during joint research. Secretary O'Leary was in Florence today to address the closing plenary of the World Geothermal : Congress. , -DOE- R-95-078 u 3)Printed with soy ink on recycled paper a U.S.Department of Energy e Office of the Press Secretary e Washington,DC 20585 . NEWS MEDIA CONTACT:FOR IMMEDIATE RELEASE Penny Adams/Amber Jones 202/586-5806 May 25,1995 "GEOTHERMAL ENERGY --RELIABLE,COMPETITIVE" U.S.ENERGY SECRETARY TO ADDRESS WORLD GEOTHERMAL CONGRESS IN ITALY Geothermal energy is ready,reliable and competitive worldwide,says U.S.Secretary of Energy Hazel R.O'Leary who will speak at the World Geothermal Congress on May 26. "This reliable,abundant,and environmentally friendly resource which has been hugely successful in the United States,is rapidly becoming a competitive source of energy worldwide,"she said today. "Geothermal energy is ready to be put to practical use in many countries,"she said,"and through cooperation between governments and between governments and industry,we can accomplish this quickly." The U.S.Department of Energy (DOE)has actively cooperated with private industry to promote the development of the geothermal energy market in the United States,and the industry has grown rapidly since the 1970s.DOE recently formed a consortium with the U.S.Environmental Protection Agency and severalelectricutilitiestopromotegeothermalheatpumps. Geothermal energy comes from natural underground layers of hot rock or hot water that can be foundinmanypartsoftheworld.The heat is brought to the surface where it can be used in a variety of ways,_ including driving turbines to generate electricity. Up to 1,000 persons are expected to attend the May 18-31 meeting in Florence,Italy.Secretary O'Leary will address the closing plenary of the Congress on May 26.Some 20 organizations from the UnitedStateswillsponsorexhibitsthere.DOE's exhibit will highlight accomplishments of the U.S.geothermalenergyresearchanddevelopmentprogram. -DOE- R-95-077 &)Printed with soy ink on recycled paper a U.S.Department of Energy ®Office of the Press Secretary e Washington.DC 20585 a NEWS MEDIA CONTACTS:,FOR IMMEDIATE RELEASE Penny Adams or Amber Jones,202/586-5806 May 24,1995 SECRETARY O'LEARY SPEAKS AT CASPIAN OIL AND GAS CONFERENCE Secretary of Energy Hazel R.O'Leary spoke yesterday at the opening ceremony of the Second International Caspian Oil and Gas Conference in Baku,Azerbaijan.The conference on 'May 23-26 is addressing oil and gas development prospects in the Caspian Sea region,which includes several former republics of the Soviet Union. "The United States is keenly interested in promoting international trade and investment in the Caspian,which is both the birthplace of the international oil industry as well as one of the world's richest locations for new oil and gas production,"O'Leary said."I'm here in Baku to ; strengthen support for new partnerships involving U.S.businesses that will create jobs in America and help ensure the economic self-sufficiency of the Caspian region's newly independent states." Secretary O'Leary joined President of Azerbaijan Heydar Aliyev in presenting remarks at the official opening ceremony yesterday morning.Secretary O'Leary addressed the U.S. commitment to bolstering the economies of the newly independent republics,diversifying the energy supplies in the world market and facilitating U.S.investment in the region. The conference sessions are addressing oil and gas policies,markets,resources,and recovery techniques as well as foreign investment opportunities. Secretary O'Leary's visit,which followed a seven-nation tour of the Caspian region by Deputy Secretary of Energy Bill White in April,underscored this administration's commitment to supporting the region's economic independence and competitiveness in the global market.The visits also reflect the importance the U.S.places on energy developments in the region contributing to the diversity of the world's energy supply. -DOE - R-95-076 ®Printed with soy ink on recycled paper a U.S.Department of Energy e Office of the Press Secretary e Washington,DC 20585 a NEWS MEDIA CONTACT: . FOR IMMEDIATE RELEASE Joanna Stancil,202/586-5806 May 23,1995 , CALL.HER DOCTOR MOODY:CLINTON APPOINTEE EARNS HONORARY DOCTORATE Corlis S.Moody,the Department of Energy's (DOE)Director of the Office of Economic Impact and Diversity,has received an Honorary Doctorate in Public Administration from Morgan State University.Mrs.Moody received the honorary degree following her delivery of the commencement address at Morgan State's May 21,1995,commencement ceremony.. Moody was nominated by President Clinton in September 1993 to head the thennewly-formed Office of Economic Impact and Diversity..Mrs.Moody brought to herpositionastrong,unwavering and uncompromising dedication to equality andfairnessandtominoritypresenceinDOE's policy-making and participation in government programs.She has displayed an especially strong commitment toinvolvingminorityinstitutionsofhigherlearninginresearch,instructional and community-outreach projects sponsored by the department. The Honorary Degree Citation from Morgan State's President,Earl S.Richardson,read in part:"For her lifelong devotion to eliminating the lastvestigesofdiscriminationinthisland,for her outstanding work in promotingequityinpublicadministration,for her untiring crusade to rid the workplaceofprejudiceandharassment,and for the fine example that she has set as aresponsibleandeffectivepublicadministrator,I am please to present ...."Mrs.Corlis S.Moody,Warrior Against Injustice,to receive at your hands the degree doctor of Public Administration Honoris Causa." "Doctor"Moody is a graduate of Southern University,in Baton Rouge,Louisiana,with a Bachelorof Arts Degree and received her Master of Arts DegreeinpublicadministrationfromDrakeUniversityinDesMoines,Iowa.BeforecomingtoDOE,Moody was Director of Workforce Effectiveness and Diversity atNorthernStatesPower,in Minneapolis,Minnesota.: -DOE- R-95-075 (e)Printed with soy ink on recycled paper ]U.S,Department of Energy °e 66fice of the Press Secretary e Washington.DC 20585 g NEWS MEDIA CONTACTS:FOR IMMEDIATE RELEASE Penny Adams /Amber Jones,202/586-5806 May 19,1995 SECRETARY O'LEARY TO LEAD INTERNATIONAL ENERGY AGENCY MINISTERIAL --FIRST U.S.CHAIR SINCE 1980 Secretary of Energy Hazel R.O'Leary will be the first US Secretary of Energy since 1980 to chair the ministerial meeting of the International Energy Agency (IEA)this month.The meeting will include senior representatives from the 23 IEA member countries and the European _Union. The meeting on May 22 in Paris,France,will focus on the theme "Energy in a Global Market"and will include discussions of energy and environment,energy security,and relations with non-member countries,including Russia. "By participating in this international forum,member countries are reaffirming their commitment to responsible energy policies that promote security,environmental goals and economic development,"Secretary O'Leary said. "Increasing investment and transferring advance technologies to growing energy markets like Russia are important ways that the industrialized countries can contribute to global energy security,"O'Leary continued.In addition,the ministerial will consider the increasingly important role developing nations will play in energy security and global environment.They sill discuss ways to begin broader cooperation to promote sustainable development of these important energy markets. ' -MORE - R-95-074 &Printed with soy ink on recycled paper a U.S.Department ofEnergy e Office of the Press Secretary ®Washington,DC 20585 a -2- The one-day meeting is scheduled for 9 a.m.-4 p.m.(Paris time),with closing press conferences scheduled for 4 p.m.The Secretary will hold a press conference on the results of the ministerial discussions. Secretary O'Leary will be accompanied to the meeting by Assistant Secretary for Energy Policy Susan Tierney and Under Secretary of State Joan Spero.The Secretary led the U.S. delegation to the ministerial in 1993.Charles W.Duncan,Jr.,was the last U.S.Secretary to chair the meeting in 1980. , The IEA was founded in 1974 to ensure international energy security and coordinate responses to disruptions in oil supplies.The agency promotes alternative energy sources and energy efficiency,better systems for coping with disruptions,integrated energy and environmental policies,and dialogue with non-member countries on energy markets.The IEA also maintains information systems on international energy markets. -DOE- R-95-074 NEWS MEDIA CONTACTS:FOR IMMEDIATE RELEASE Keith Holloway,202/586-5806 May 19,1995 Wendy Butler,202/586-5806 . STATE GRANTS FORM ENERGY PARTNERSHIPS AND SAVE MILLIONS IN ENERGY COSTS The Department of Energy (DOE)today announced its intention to award nearly $5 million in financial assistance grants to states to update andimplementtheenergyefficiencyprovisionoftheirbuildingcodes.The grantsarebeingawardedona.competitive,cost shared basis. "Over the next 15 years;American consumers and businesses could save $38 billion on energy bills for heating,cooling and operating the nation's buildings,"said Christine Ervin,Assistant Secretary for Energy EfficiencyandRenewableEnergy."The improvement in state codes funded by these grants will play a big part in reaching that potential." DOE officials estimate that energy use in buildings is growing at a rate of 3.3 percent each year with the nation's 95 million househcids and 4.5millioncommercialbuildingsspending$195 billion each year.A 30 percent improvement in U.S.building.energy efficiency would reduce consumer costs by $38 billion within 15 years.- The grant program will help develop codes where they do not exist.andstrengthenexistingbuildingcodes.The assistance will help-enable builders,states and consumers to make buildings more efficient and cost effective. "Our goal is to empower states to adopt and implement building energyefficiencycodesforresidentialandcommercialbuildingsbasedontheir©individualized needs.We recognize that not one size fits all,"said Ervin. Thirty-four states and territories are receiving grants totallingapproximately$5 million for building energy code programs.Some of thesestateshaveexistingenergycodesbutneedadditionalsupporttoexpandorenhancetheircodestoequalorexceedthe1993ModelEnergyCodeandthe American Society of Heating.Refrigerating.and Air Conditioning Engineers Society of North America li luminating Engineering Society cf North America Standard 90.1-1989. (MORE) R-95-073 ®Printed with soy ink on recycled paper a U.S.Department of Energy e Office of the Press Secretary e Washington.DC 20585 a ee . The Model Energy Code is an energy performance standard for residential buildings and the Standard 90.1-1989 is an energy performance standard for commercial buildings.The Model Energy Code and Standard 90.1-1989 are benchmark residential and commercial standards under theEnergy Policy Act(EPAct)of 1992.The application of current commercial and residential buildings energy standards to new buildings translates into long term economic and productivity gains for a large sector of the U.S.economy.In 1994,building constructioncosting$500 billion has an estimated life of 50 to 70 years.In 1994,residential construction reached $300 billion,and commercial construction was $200 billion. "Upgrading energy codes overcomes market barriers and improves theefficiencyofbuildingsandlowersenergycostsbyhelpingstatesattract and retain industry,"said Ervin. The Upgrade Building Energy Codes Projects is part of DOE's Energy Partnerships for a Strong Economy program,which is guided by the Energy 'Policy Act (EPAct)of 1992., For more information,contact DOE's Energy Efficiency and Renewable Energy Clearinghouse at 1-800-DOE-EREC. -DOE- R-95-073 NEWS MEDIA CONTACT:FOR IMMEDIATE RELEASE Joanne L.Johnson,202/586-5806 May 25,1995 ENERGY DEPARTMENT INITIATES DEMONSTRATIONS ON ANNEALING REACTOR PRESSURE VESSELS The Department of Energy (DOE)today announced the award of two cost- share contracts valued at about $9 million to evaluate the feasibility of thermally treating U.S.reactor pressure vessels to correct embrittlement problems. The process of thermal annealing restores the physical properties of reactor pressure vessel steel to its initial condition.Annealing the reactor pressure vessel could prevent premature shutdown and allow plants that are most susceptible to embrittlement to operate longer. DOE authorized Sandia National Laboratories in Albuquerque,N.M.,to award cost-share contracts to two groups,the American Society of Mechanical Engineers (ASME)Center for Research and Technology Development and MPR Associates of Alexandria,Virginia.At least 50 percent of the value of these contracts will be provided by the contractors and other non-DOE sources. Westinghouse Electric Corp.is part of the ASME team,and the MPR team includes MOHT-OTJIG RM,a Russian consortium that has successfully annealed several Russian reactors. (MORE) R-95-071 ®Printed with soy ink on recycled paper |U.S.Department of Energy e Office of the Press Secretary e Washington,DC 20385 a -2- There are 72 pressurized water reactors (PWR)in operation in the United States and 245 around the world.In the operation of a reactor,the reactor pressure vessel may become brittle due to the constant bombardment of neutrons 'produced in the fission process.This embrittlement over the years,if not managed,could result in an early shutdown of the reactor for safety reasons. The MPR team will perform its annealing demonstration project at Consumers Power Company's nuclear power plant at Midland,Mich.The ASME team will carry out its demonstration at the Public Service of Indiana's Marble Hill nuclear power plant in southern Indiana.Neither reactor is licensed to operate.The projects are expected to take about two years. On the ASME team are Westinghouse Electric Corp.,Cooperheat,Gilbert/Commonwealth and the Electric Power Research Institute (EPRI)which isaresearcharmoftheutilityindustry.The MPR team consists of MOHT-OTJIR RM,B&W Nuclear Technologies,Consumers Power and EPRI. Due to significant risks associated with the different heater technologies,DOE is supporting two annealing demonstration projects. Supporting both projects will increase the probability of success.Also, with two projects,more information will be available to resolve regulatory technical and procedural issues associated with annealing. Each project will have a steering committee for direction and to provide a forum for all stakeholders,including both domestic and international organizations. These annealing projects are part of the first phase of a three-phase DOE effort.In addition to these two projects,there are other areas which require further development and assessments so that regulatory acceptance ofthisannealingtechniqueisassured.Those activities will be addressed inlaterphasesofthisproject,and,as currently planned,would include supportofthefirstannealofthereactorpressurevesselofaU.S.commercial operating plant.; If successfully proven for U.S.commercial reactors,as was demonstrated for Russian and U.S.naval reactor pressure vessels,reactor pressure vessel annealing would provide a cost-effective approach to extending the life of U.S.commercial nuclear power plants. -DOE- R-95-071 4 Earthquake threat addressed at Hanford Last spring an updated com- puter analysis revealed that a major earthquake could drain Hanford's 1950s-vintage K Basins,where 80 percent of DOE's nationwide inventory of spent nuclear fuel is stored.Now, steel barriers have been installed to isolate the 2,300 tons of spent fuel from a vulnerable unreinforced con- struction joint in the floor of the basins, which would break open in a major earthquake,draining the basins. "Our first priority is protecting the Columbia River,”explained Project Di- rector John Fulton,Westinghouse Han- ford Company."Even though a large earthquake in this area is highly un- likely,we believe that any discharge of contaminated water from the basins is unacceptable.And,we have to make sure that the spent fuel is kept covered with water to prevent radioactivity Hanford is addressing the threat from severely damaged spent fuel rods. Isolating the construction joint is in- surance against an earthquake.It's also a stop-gap measure to prevent con- taminated water from leaking from the basins before the fuel is removed be- ginning in late 1997,Fulton said.The K East basin has a history of leaking, spilling 15 million gallons of water in the late 1970s and another 94,000 gal- lons in early 1993. Several options are being considered to move the fuel out of the K Basins and into safe storage for 40 years.Some of the fuel has been stored in the basins since 1975 and is badly deteriorated, complicating handling and storage. Entrepreneurs get grants Call Peter Boissiere at Sandia Na- tional Laboratories,and you'll hear this voice-mail message:"I will not be available for the next two years as I am on a technology transfer leave of absence.” Boissiere is one of a growing number of Sandia employees taking advantage of a new program which enables Sandia scientists and engineers to take ex- tended sabbaticals to try their hands as technology entrepreneurs.At the end of two years,the entrepreneur has the op- tion of staying in the private sector or re- turning to Sandia.The program is in- tended to encourage commercialization of technologies developed at Sandia. Boissiere left Sandia to start Boissiere Engineering and Applied Robotics,Inc., a company based on labs-developed ro- botics technology.His robots have broad applications in hazardous waste cleanup projects and other work in dangerous environments.His business and three other start-up ventures with strong Sandia connections will be the recipients of $10,000 start-up business grants awarded by Technology Ven- tures Corp.TVC was founded by Lockheed Martin in 1993. Sites lend a helping band Seventy-five pallets of protective clothing and safety equipment from the Rocky Flats Environmental Technology Site were delivered to Oklahoma City as part of a Denver-area relief shipment to assist rescue workers at the federal building site.Supplies in- cluded coveralls,disposable suits,safety shoes,hard hats,surgical gloves and res- pirators,to help supply rescue workers in their dangerous job of removing de- bris from the bomb site. Employees of the Oakland Opera- tions Office pitched in to help the small town of Pajaro,south of Monterey, when it was flooded by a rain-swollen river.Lisa Cronister and Mary DeSantis of DOE Oakland's Hispanic Employ- ment Program put out the call for dona- tions.After a one-week whirlwind ef- fort,employees had donated food, new clothes,baby supplies,cleaning supplies,blankets and $500 cash. United States Department of Energy (PA-5) Washington,D.C. Official Business 20221604PpCRIM!ENERGY AK COMMU! 333 WEST ANCHORAG 99501-2353 3 0OCOl 052595 -PA-5 "REG AFFAIRS AVE #220 FIRST-CLASS MAIL POSTAGE &FEES PAID U.S.DEPT.OF ENERGY Permit 2707 FIRST-CLASS MAIL 20 DOE This Month yomaerJune 1995 The Savannah River Site in South Carolina has adjusted its mission with the end of the Cold War.Before,the site was primarily tasked with providing nuclear materials for the nation's defense effort.Now,the Savannah River Site's mission has expanded to include environmental restoration and waste management In one aspect of environmental cleanup,the use of radiological containment huts has saved more than $7 million and reduced waste.The one pictured above was used in the L Area Oil and Chemical Basin. For more on the containment-hut project and other highlights of the Savannah River Site,see the special section on pages 8-11. SEE REDON SS LT RA NTE EA EEO LO Alignment Champions named.......... Sulfur light honored ...............sseseseeee Costs cut across complex ..............0 3 4 Military carriers recovered ws 4 5 Energy in a global market................6 6Electronicsharingsavesmoney...... THiéMonth U.S.Department of Energy Published monthly at Washington,D.C., by the Department of Energy,Office of Public and Consumer Affairs for the infor- mation of Department employees and af- filiates and available to others by paid subscription. The Secretary of Energy has determined that this periodical is necessary in the transaction of public business as required by law.Use of funds for printing has been approved by the director of the Of- fice of Management and Budget.The con- tent is reprintable without permission and pictures are available for media reproduc- tion upon request. Hazel R.O'Leary Secretary of Energy Michael G.Gauldin Director of Public and Consumer Affairs Tracy L.Cozzens Editor Lorraine Entwisle,Tina Scott Graphic Design SUBSCRIPTION price for 12 issues is $16 domestic,$20 foreign;single issue $1.50 domestic,$1.88 foreign.Subscriptions must be ordered through,and checks made payable to:Superintendent of Documents,U.S.Government Printing Of- fice,Washington,D.C.20402. Circulation Office:202-586-2050 News Office: DOE This Month c/o Westinghouse Hanford Company Employee Communications P.O.Box 1970,mailstop B3-26 Richland,WA 99352 Phone:509-376-4639,fax:509-376-5560 Internet address:Tracy_L_Cozzens@rl.gov Street address:1100 Jadwin Ave. Richland,WA 99352 Deadline for submissions:15th of every month for the following month. DOE PA-0018-6 DOE This Month /s printed on paper containing at least 50 percent recycled materials. hod Rostrum Smarter government,not meat-cleaver politics "In calling for the termination of DOE,Congressman John Kasich (R-Ohio)seeks a trophy without demonstrating savings or need.Dismantling the agency would severely affect our mis- sions:national security,weapons site cleanup,energy security, and science and technology.DOE already is delivering $14.1 billion to deficit reduction over the next five years.And we are showing results-whether it's winning Nobel Prizes or boost- ing American energy exports;enhancing national security at home or reducing the nuclear danger abroad.This administra- tion has the best approach:smarter government,not meat-cleaver politics.” -Secretary Hazel O'Leary,responding to the House of Representatives'Budget Resolution. Associations voice support for DOE "To dismantle the focal point of U.S.energy policy would send a strong message that the United States no longer recognized the importance of energy security to our nation's economic fu- ture.” -From letter to Congressman John Kasich signed by National Independent Energy Producers, Nuclear Energy Institute,Edison Electric Institute,National Mining Association, Solar Energy Industries Association. Elk Hills an important first step "Today's (May 18)action by the House National Security Committee's Subcommittee on Military Readiness to privatize the Naval Petroleum Reserve (Elk Hills)is an important first step in support of the administration's plan to streamline gov- ernment and reduce its size and intrusiveness.Some things- like the business of producing and selling oil and natural gas- can best be performed by the private sector.Taxpayers want a smaller,smarter government.This reform will allow Elk Hills to increase its capital budget and increase its production.Elk Hills is the ninth largest field in the United States.”) -Deputy Secretary Bill White. DOE This Month DOE kicks off gas technology program DOE joined with the American Gas Cooling Center and gas industry part- ners in launching a new effort to com- mercialize high-efficiency gas cooling technologies at a media briefing in Washington,D.C.,March 15. Christine Ervin,assistant secretary for Energy Efficiency and Renewable En- ergy,said through government/industry partnerships like this,"Small highly le- veraged investments by the federal gov- ernment could help lead to $17 billion in energy savings in the next 15 years.” Ervin also recognized Ben Phillips, developer of the residential generator-absorber heat-exchange (GAX)heat pump.Through his own company,Phillips completed the first working prototype of the GAX,an idea that has been considered for more than 70 years.Phillips Engineering,a small business,then licensed GAX to Carrier, the largest HVAC manufacturer in the world.Carrier plans to commercialize GAX as soon as possible. DOE is also introducing three other technologies through the program. (Ronald Fiskum,202-586-9130)¢ ™Publications Country Analysis Briefs:1994 (May 1995).Available from the U.S.Govern- ment Printing Office or the Energy In- formation Administration's National Energy Information Center,Room 1F-048,Forrestal Building,Washington, D.C.,20585,202-586-8800;via ELA's Home Page,http://www.eia.doe.gov. USDOE Office of Inspector General re- port on Audit of the Department of Energy's Environmental Molecular Sciences Laboratory (Apri!)DOE/ IG-0371.Available from Office of Sci- entific and Technical Information,P.O. Box 62,Oak Ridge,TN 37831. EEL CSAVINGS .inAmerica WJ,BONDS department's Savings: -Bone) eeNoe(Carmozign dune 1-30,1995 - 5 You will be provided forms -_and information by your local canvasser.2pated,Milestones YEARS OF SERVICE June 1995 HeadquartersChiefFinancial Officer -Thomas F. Fisher (25 years),Pamela J.Roberts (25).Defense Programs -Wallace A. Stringfield (35),Sydney E.Teegarden (35),Michael E.Long (25),Mary L.Van Cleave(25).Education &Tech.Info.-Mary C.Grissom (35),Kenneth R.Hohenbrink (25).EIA -Ronald F.Earley (25).Energy Effi-ciency -Robert H.Annan (35),Sarah J.Kirchen (25),Gailene Reinhold (25),NellieL.Tibbs (25).Energy Research -CarolynA.Magers (35).Envir.Management -David R.Berg (25),Diane W.Gillis (25),Johnnie D.Greenwood (25),Linda D.Hillman (25). FERC -Sandra B.Wyvill G5),Lottie L.Davis (30),James Goris (30),Charles F.Harland (30),Joseph M.Harkins G0),Randolph E.Mathura (30),Margaret L.McGowan (30),Kenneth M.Anderson (25),Artis L.Baldwin (25),Jerry T.Chastain (25),Mark B.Eckell (25),Joseph Hamilton (25),Andrew L.Lyon (25),James S.Taylor (25). Field Management -Albert Chrisp (25).Fossil Energy -Carey A.Kinney (35),Gene H.Kight (25),Ralph Lamonda (25). General Counsel -John L.Gurney (25),Edward Jiran (25).Human Resources -Helen A.Clark (35),Dorothy L.Hoff(35),Eugene A.Peeks (30),John E.Staley (30),Rickey D.Hall (25),Gloria J.Hoover (25),Calvin Lee (25),Jean P.Levi(25),William G.Pearce (25),Bruce L. Van Duzer (25). Inspector General -Roy H.Taylor (35),David B.Schumer (30),Peter J.Kauslick(25).National Security -Nancy H.Holmes (35),Gail L.Bradshaw (30),Sheila M.Brumage (25).Nuclear Energy -Ber-nard J.Rock (40),Jon C.Geisbush (30),Sol Rosen (30),Ernest A.Condon (25), Cynthia D.Davis (25),Paul I.Herman(25),Robert E.Murphy (25).Policy -Charlene E.Caulkins (25),Robert Copaken(25).Radioactive Waste -Jerome D.Saltzman (35),Judith A.Leahy (30). Field Albuquerque -Ona M.Bellino (50),Will-iam D.Bryant (30),Nancy R.Romero (30),Antonio V.Aragon (25),Lawrence E. Biddle (25),Robert A.Bills (25),James D.Finley (25),William L.Harrell (25),GeorgeK.Laskar (25),Lillian A.Retallack (25).Chicago -Sheena P.Coleman (25),Norman F.Hansen (25),Marta Mims (25). Morgantown ETC -Richard McQuisten30). Nevada -Alice M.Davis (30),Sally A.Gonzalez (30).Oakland -Carl W.Powers (35),Martin W.Molloy (30),Richard R.Haddock (25),Dorothy J.Short (25).OakRidge-Stephen D.Hamel (35),Dorothy J. Hembree (35),Robert M.Poteat (35),Rob-ert J.Spence (30),Larry W.Boyd (25),Judith P.Hall (25),Ronald D.Oglesby(25),John D.Rothrock (25). Pittsburgh ETC -Leonard J.Shaw (35),Richard B.Snedden (30).Pittsburgh Na- val Reactors -Henry A.Cardinali (25).Richland -James S.Abernethy (25),JohnJ.Broderick (25).Rocky Flats -Judith A.Krumm (30).Savannah River -Frank R. McCoy III (25).Schenectady Naval Reac-tors -Alfred F.Riccio (25).Western Area Power -Richard L.Gallegos (25),Stanley L.Mason (25),Mark L.Meyer (25),Bonnie J.Nieland (25),John D.Welton (25). Bonneville Power -Harold F.Alsop (35),S.J.Pongracz-Bartha (35),Gregg E.Childs(30),Edward S.Chittester (30),James B.Cook (30),Michael L.Cramer (30),DonaldE.Gorger (30),Edward D.Gutknecht (0),Robert M.Hasibar (30),Eugene McClellan(30),Dennis L.Noble (30),Thomas M.Noguchi (30),Wilbert E.Ramsey,Jr.(30),Karen J.Davenport (25),Jonathan B.Giard(25),Paul F.Hansen (25),Joe A.Johnson(25),John C.Kreitzer (25),Susan K.Peterson (25),Ronald D.Schachner (25),Reynaldo M.Viray (25). RETIREMENTS April 1995 HeadquartersPolicy-Gwendolyn M.Jordan (34). Field Albuquerque -Ronald D.Hanson (22).Oak Ridge -Wendall W.Ogg (13). June 1995 19 PeopleNERGY e Jessie Roberson has been named assistant manager for Environmental Restoration at the Rocky Flats Envi- ronmental Tech- nology Site.Previ- ously,Roberson was deputy assis- tant manager for Environmental Restoration and Solid Waste Man- agement at Savan- nah River. Roberson will oversee scientists,ge- ologists and environmental and techni- cal specialists involved in cleanup. e J.Whitfield Gibbons,professor of ecology at Savannah River Ecology Laboratory,was awarded a prestigious teaching award from the Association of Southeastern Biologists in Knoxville, Tenn.The award recognizes Gibbons' contribution to the education of under- graduate and advanced-level science students during his 28-year career."He was also recognized for his tireless dedication to educating the general public about natural history and envi- 'ronmental issues through lectures, writing and the news media,”said Joe Pechmann,Gibbons'former student and now a postdoctoral fellow at the Roberson lab."A common thread in all these en- deavors is the infectious enthusiasm with which he communicates his love of,fascination with and broad knowl- edge of nature.” ¢Philip Schultz has been named controller for Lawrence Livermore Na- tional Laboratory,after serving in an acting capacity for nine months."Phil has extensive experience in the controller's organization,having been the laboratory budget officer for over 10 years,”said Director Bruce Tartar. ¢The American Nuclear Society has named Charles Till winner of the Walker Cisler Medal for outstanding scientific or engineering research achievements or management associ- ated with the design and development ;of fast reactors for electric power generation.Till has led reactor de- velopment re- search at Argonne National Labora- tory for 15 years. ' Under his direc- Till tion,an inher- ently safe reactor design has been proved and demon- strated.He also led Argonne in major advances in nuclear reactor effi- ciency and in developing new tech- nologies to reduce nuclear reactor waste and lessen problems of nuclear material proliferation. Rhys Williams,right,an analyst with the Office of En- ergy Intelligence,Office of Nonproliferation and National Security,receives the National In- telligence Certificate of Distinction from Admiral William Studeman, acting director of the Central In- telligence Agency. The certificate is awarded by the intelligence community to recognize significant acts of special merit performed by one of its members.Williams was the primary drafter on an im- portant national intelligence es- timate which shed new light on a problem of growing concern to policy-makers across the U.S. government. Heroes Training with dispatch The job of a power system dis- patcher can best be performed by someone with the fine touch of a sur- geon.There is no place for an occa- sional "oops”or a lapse in memory.In some cases,lives are at stake with each decision made. Dianne Peck looks forward to that challenge as Southwestern Power Administration's first female dis- patcher-trainee. Peck,now in the Springfield,Mo., Operations Division,entered federal service in 1973 with the Federal High- Peck way Administration.In 1977,she joined Southwestern as a clerk-typist. She has also been a statistical clerk, power systems technician and power operations technician. Peck was interested in the two-year training program to become a dis- patcher,but at the time,she had a young son and daughter who needed her at home. After several years working with se- nior dispatcher Tom Edwards,said Peck, "I realized that I wanted to learn more about the transmission side of power marketing.”Peck received support from her supervisor,family and the dispatch- ers."They promised to take the extra time to train me well,”she said,"though I'll have to admit to being a little anx- ious about the unknown.”Senior Dis- patcher Phil Sutton assured Peck she had nothing to worry about."I don't know of anyone who has ever had more people wanting her to succeed than Dianne does here in Power Opera- tions,We'll bet on her future success.” 18 DOE This Month Strategic Implementation Team hard at work On May 3,Secretary Hazel O'Leary committed to implement changes rec- ommended by the Strategic Alignment Initiative working group to streamline the department's functions in support of its critical national missions. Immediately after her employee meeting to present the recommenda- tions of the working group,the Strate- gic Alignment Implementation Group was formed.Chaired by Don Pearman, associate deputy secretary for Field Management,the team includes sev- eral members of the original Strategic Alignment Team,as well as represen- tatives from a cross-section of the department's offices and organizations. The implementation group's charter is to facilitate and coordinate the de- velopment of implementation plans for all realignment initiatives. The schedule for developing align- ment implementation plans is on a very fast track.All plans are scheduled to be completed between June 1 and June 22.Due to the wide scope of the initiatives and stakeholder involvement required,"Champions”have been des- ignated for each alignment initiative. The Champions are responsible Strategic Alignment Implementation Group Work Plan June Jui©|Task Name aA [se Tone Tapa Ta [es [en2 ais Tee [7a -tra Caran1|implementation Work Pian +a 'a 2 Group Charter -if tl.3 |WeeklyReporttoSecretary e909 9°00 8 9'90 89090 HO 9 39 |Phase 1 -Implementation Work Plan =-_'''' 40 |Action Matrix one H ''! 41 |Success Messuree -_---}'42 |Fee Budget Amendment , 43 |Communications Pian - !)1 |i ' 44 |__Quality Pian |-__ca '445|Legislative initiatives Pian a ! 46 |Status Tracking -OTN = "7 Plans |-___a ': 48 Biweekly Bulletin to Employees ry Key 'Fos >'>°H res > 67 |__Implementation@&A e100 590900409090 006019090 4103} lasue Resolution r ) 104 mien {|' 105|Secretarial Approval i :'Amma ' 106|Phase It -implementation Work Pian H t ' 107 Implementation Announcement '''A 7728108,Phaseil implementation ''' Saving Dollars and Making Sense for developing the plans,with goals, outcomes,milestones,success mea- sures,consensus coordination of all involved parties,and solutions iden- tified to overcome implementation barriers.These plans will be re- viewed by the Strategic Alignment Implementation Group during June, with recommendations due to the Secretary on July 14. Each organization within DOE is also developing five-year workload/ workforce analysis plans that will be submitted to the Strategic Alignment Implementation Group by June 16. These plans will be reviewed for conti- nuity with the Strategic Alignment goals of the Secretary.+ 'Champions Naval Petroleum Reserve:Pat Godley Consolidate Fossil Energy Offices:Pat Godiey Consolidate Morgantown and Pittsburgh Energy Technology General Management/Crosscut/Other Office of the Secretary:Dan Reicher Carolyn Watts Align Policy/International:Sue Tierney Close Paris Office:Sue Tierney Quality Management:Nancy Weidenfeller Hearings and Appeals:George Breznay Inspector General:John Layton Diversity Advocacy:Corliss Moody Asset sales:Bob Alvarez Realign Field:Don Pearman Science and Technology Ray Hunter Energy Offices:Christine Ervin Consolidate Public Affairs/Congressional:Michael Gauldin, Centers:Pat Godley National Security Consolidate Emergency Management:Ken Baker National Security alignment:Vic Reis Nuclear Materials Management alignment:Greg Rudy Realign Field management:Don Pearman Consolidate Energy Cluster:Christine Ervin Strategic Petroleum Reserve Office:Christine Ervin Consolidate Energy Efficiency and Renewable Energy Support Assure diversity during implementation:Corliss Moody Rightsize Science and Technology:Jim Decker Nuclear reactor cost control (energy research reactors): Safeguards and Security alignment:Ken Baker Environmental Quality Roles and responsibilities of HQ and Field:John Wagoner Integration of basic and applied science:Jim Decker Environmental Impact Statements:Tom Grumbly Environmental Management:Tom Grumbly Nationa!Environmental Policy Act savings:Peter Brush Environment,Safety and Health:Peter Brush Administration/Support Headquarters space consolidation:Arch Durham Headquarters Administrative Service Center:Arch Durham Freedom of Information Act:Arch Durham Consolidate Accounting functions:James Reid Chief Financial Officer functions:Lynwood Henderson Re-engineer travel:Tim Travelstead Reduce support service contractors:Richard Hopf Realign Transportation Management:Richard Hopf Integrate information Management:Spain Hall Correspondence and Document Control:Ann Lavin Realign/consolidate General Counsel:Robert Nordhaus Policy writing positions:Marcia Morris DOE Orders:Marcia Morris Training:Tom Evans Retraining,outplacement,buyouts:Timothy Dirks June 1995 the past year. able today. Sulfur light wins! The sulfur light-a scientific and technological breakthrough in lighting-has won the 1995 Dis- cover Award for Environmental Technological Inno- vation,sponsored by Discover magazine. The award honors the best American technology to be developed in each of seven categories during The sulfur light was invented by FusionLighting, Inc.of Rockville,Md.,and developed with scien- tists at Lawrence Berkeley Laboratory.Powered by microwave energy,the mercury-free sulfur light has no wires,filaments or metal parts to burn out.The light released by the lollipop-shaped bulb is brighter and more energy-efficient than lights avail- During the awards ceremony,held at Epcot '95 in Walt Disney World April 29,Secretary Hazel O'Leary and Michael Ury of FusionLighting unveiled "Solar 1000,”the next generation of sulfur light that delivers the equivalent of 80 100-watt conventional household lightbulbs from a device the size of a shoebox.Epcot will feature the sulfur light in its Innoventions Pavil- Secretary O'Leary demonstrates the award-winning sulfur light, honored by Discover magazine in a special award ceremony. ion,a showcase of future technologies. The light is powerful enough to light stadiums and airplane hangars,yet its color spectrum so closely matches the sun's that it's used for experimental medical and plant research.Its energy effi- ciency combined with absence of mercury ensure environmental safety.The sulfur light will be launched commercially in 1996. IG Office recovers carriers sold to individuals DOE's Office of Inspector General recovered eight military armored per- sonnel carriers May 2 and 3,some of which had been offered for sale after having been donated by DOE as mu- seum displays.The carriers were trans- ported to military bases,where they will remain while the investigation proceeds. The vehicles were once used for security at Rocky Flats.In December 1990,the vehicles were declared sur- plus due to their age and lack of parts. The Historical Armor Museum,a divi- sion of the McClain Museum in Ander- son,Ind.,purportedly obtained the ve- hicles as a donation through the fed- eral property program.The vehicles were delivered to locations in Colo- rado and Indiana in October 1992 and February 1993 and then,contrary to the terms of the donation,were not demilitarized and four were sold to various individuals across the country. In 1994,officials of Rocky Flats contractor EG&G learned that an em- ployee was offering one of the military armored vehicles for sale.EG&G noti- fied DOE officials at Rocky Flats who, in turn,contacted the Office of the In- spector General which immediately began an investigation. "Hopefully,this instance will dem- onstrate the importance of reporting potentially illegal actions to the Office of Inspector General,”Inspector Gen- eral John Layton said."In this instance, eight armored military vehicles have been recovered from organizations that could misuse them.” Special agents from DOE's Office of Inspector General,the Federal Bureau of Investigation,and the Defense Criminal Investigative Service executed search warrants at businesses and resi- dences in Colorado Springs,Colo.; Anderson,Ind.;Bedford,Ind.;Sturgis, Mich.;and Palmdale,Calif. $4.6 million granted for energy-efficiency projects DOE has awarded $4.6 million in grants to eight state agencies for en- ergy-efficiency projects that could pre- vent 163 million tons of pollution and save industrial users more than $6.8 billion by the year 2010. Fourteen proposals from state agen- cies in California,Maryland,Minnesota, Michigan,Ohio,North Carolina,Virginia and Wisconsin were named winners as part of the National Industrial Competi- tiveness through Energy,Environment and Economics (NICE*)program. Proposals are sponsored and.sub- mitted by state agencies,working with industrial partners.At least half of each project must be funded by the state or industrial partner. "With these grants,DOE is making a public investment in preventing pol- lution and saving energy,”said Chris- tine Ervin,assistant secretary for En- ergy Efficiency and Renewable Energy. "It's likely that without this public-pri- vate partnership,the new technologies being developed and commercialized with these grants would reach the marketplace more slowly or not at all. We expect these grants to pay big re- turns to the country.” 4 DOE This Month Events Ervin to speak at SOLAR '95 SOLAR '95,slated for Minneapolis, Minn.,July 15-20,will feature a discus- sion of the role of government in the de- velopment of solar energy technologies. Christine Ervin,assistant secretary for En- ergy Efficiency and Renewable Energy, will participate. \sob SOLAR 795 will be the year's largest and most comprehensive national solar energy conference.Sessions will em- phasize practical,cost-effective appli- cations of solar energy that can im- prove the nation's economy.More than 140 technical sessions and ple- nary and symposium presentations will address issues and report on progress in photovoltaics,solar thermal,wind, biomass,solar hydrogen,passive solar design,energy policy and renewable energy commercialization. One-day workshops will be held July 15 and 16.Also scheduled are special solar tours displaying large- scale utility wind projects,passive so- lar lighting,and a PV-powered canoe outfitter.The conference is sponsored by DOE and others.(American Solar Energy Society,2400 Central Ave.G-1, Boulder,CO 80301,303-443-3130;fax 303-443-3212) June 27-29 Advanced coal-fired power systems 95,Morgantown Energy Technology Center, Morgantown,W.Va.(Conference Services, METC,P.O.Box 880,MS-K07,Morgantown, WV 26507-0880,304-285-4108) 27-30 Records management conference, Albuquerque,N.M.Sponsored by DOE. (Margarita Sexson,Albuquerque Opera- tions Office,PAB/IMD,P.O.Box 5400,Al- buquerque,NM 87125-5400,505-845-4826; fax 505-845-4793) 28-30 7th national demand-side manage- ment conference:delivering customer value,Dallas,Texas.Sponsored by EPRI, DOE,Edison Electric Inst.(Electric Power Research Institute,Ms.P.Turner,P.O.Box More than 650 people attended the Office of Industrial Technologies' first Industrial Energy Efficiency Symposium and Exposition May 1-3 in Washington,D.C.The theme was "Investing in a cleaner environment and more productive economy.” The conference examined indus- triai energy,economic and environ- mental policy issues.Information gathered from participants will be used to create innovative ways to ac- complish national objectives through cooperative programs and teaming ar- rangements. Secretary O'Leary was the key- note speaker at the plenary session, along with Congressman Vernon Ehlers (R-Mich.)and Mark Little,vice president of General Electric. O'Leary spoke on the pivotal role in- dustry plays in the U.S.economy and the benefits that result when government and industry work to- gether. "I found the symposium to be ex- ceptional,”said Stan Eller,Maine 650 gather for industrial energy expo Metal Products Association."The opportunities for networking with industry,labs and other federal pro- grams were extraordinary.I expect to build the contacts I made into substantive technology-transfer op- portunities that will make compa- nies more competitive and efficient while meeting environmental con- cerns.” The conference allowed industry and government representatives to discuss the benefits and problems of working together and to consider ways they can improve the process in the future.Sessions were offered on OIT's seven focus industries and their progress toward creating "vi- sions of the future”to guide OIT's re- search and development agenda.The seven focus areas are:aluminum, chemicals,glass,forest products, metal casting,refining and steel. OIT also unveiled its new Internet home page,at www.eren. doe.gov/industry.Joe Bryson or Lisa German,202-586-3604) 10412,3412 Hillview Ave.,Palo Alto,CA 94304,fax 415-855-2041) July 15-20 SOLAR '95 conference,"10,000 solu- tions:paths to a renewable future,”Minne- apolis,Minn.The year's largest and most comprehensive national solar energy confer- ence emphasizes cost-effective applications that can improve the nation's economy. Co-sponsored by DOE.(American Solar En- ergy Society,2400 Central Ave.G-1,Boulder, CO 80301,303-443-3130,fax 303-443-3212) August 3-4 14th international seminar on ion-atomic collisions,Seattle,Wash.(Lawrence Livermore Nat'l Laboratory,Ms.D.Rae,P.O. Box 808,L-421,Livermore,CA 94550;fax 510-422-5940) 6-10 4th international conference on metal- lurgical and materials applications of shock-wave and high-strain-rate phenomena, El Paso,Texas.Sponsored by Los Alamos National Laboratory,others.(University of Texas,Div.of Professional and Continuing Education,500 West University Ave.,El Paso, TX 79968-0602;fax 915-747-5538) 9-10 Fuel Cells 95,Morgantown,W.Va. Sponsored by METC (Morgantown Energy Technology Center,3610 Collins Ferry Rd., P.O.Box 880,Morgantown,WV 26507-0880,304-285-4108) 13-18 ER 95 (Environmental Remediation Conference),committed to results,Denver, Colo,Sponsored by DOE.Workshops,oralandpostersessions,tours of Rocky Flats. (Environmental Resources Specialist,Inc., P.O.Box 440112,Aurora,CO 80044, 303-690-4245) 27-Sept.1 9th international conference in liquid and amorphous metals,Chicago,III.(Argonne Nat'l Laboratory,M.L.Saboungi,9700 S.Cass Ave.,Argonne,IL 60439;fax 708-252-7777;Calvin College,Physics Dept.,Prof.J.van Zytfeld,3201 Burton SE, Grand Rapids,MI 49546,fax 616-957-6501) September 19-21 International symposium and tradefaironthecleanupofmanufacturedgasplants,Prague,Czech Republic.SponsoredbyDOE,EPA,Umweltbundesamt.(Florida State University,MGP'95 Symposium,2035E.Paul Dirac Dr.,226 HMB,Tallahassee, FL 32310,fax 904-574-6704;e-mail MGP95@mailer.fsu.edu) October 3-5 Environmental Technology Develop-ment through Industry Partnership, Morgantown,W.Va.Sponsored by METC(Morgantown Energy Technology Center,3610 Collins Ferry Rd.,P.O.Box 880, Morgantown,WV 26507-0880, 304-285-4108) June 1995 17 QualityCORNER Team brings info age to employees The Communications Team-an ar- ray of action-oriented,voluntary,tech- nology buffs-has labored for the good of electronic communication throughout DOE. Rudolph Hirzel and George Karmis developed electronic structures for sharing charters and projects across the department. In addition to creating a training da- tabase that lists Total Quality Manage- ment courses on the Internet,they pio- neered the Quality Home Page as an in- formation tool to facilitate sharing. Nancy Crosby,Martha Bailey,Lana Cobb,John Bruhl,John Shea,Benny Goodman and John Coffman all had a hand in making the Quality Home Page a reality.A hearty thank-you also belongs to Arch Durham,who champi- oned the pioneers. Access the future through the Internet menu.The address is:http:// www/DOE.gov/html/quality/ tqmhome.html. We are all in their debt and want to thank them for bringing the informa- tion age to our door-Submitted by Tom Sperl,Energy Quality Council. Diving into the gene pool This prehistoric horsefly preserved in amber is part of the world-renowned scientific collection that inspired Jurassic Park.It's just one of the fascinating exhibits on the mysteries of genetics and DNA at the new display,"Diving into the Gene Pool,”at the Exploratorium in San Francisco through Sept.4.DOE is a primary sponsor of the display.Among the featured exhibits is "Chromosome Trails,”based on work by Brigitte Brandriff of Lawrence Livermore National Laboratory on a revolutionary technique for highlighting the position of genes on chromosomes by painting them with fluorescent dyes. Adrift over-change? Government is getting smaller and changingthewayitdoesbusiness.If you're adrift in theoceanofchange,let us be your life line. We specialize in procurement,supply,travel - and transportation,and property and space management.We'll get you to shore by teach- ing you a new job or making you smarter at what you do.We schedule our courses year round at loca- tions throughout the country.We'll even come right to your place of business.=eCall703-603-3216 and ask -Interagencyforacatalog.We'll also tell Training Center you how to access the cata- log electronically.In this US.Generalocean,there's more than one 4 way to dry land.Administration Career centers offer new resources The Career Management Resource Centers are a valuable asset to em- ployees facing the challenges of a changing Department of Energy.The Forrestal Center is in room GA-156, and the Germantown Center is in room F-135. The centers'staffs are committed to providing employees with the informa- tion and counseling they need ina 21st century work environment.Re- sources are available to prepare em- ployees to excel in customer-focused, quality-driven work environments. Many new materials have been added to the Resource Exchange lending li- brary in each center. The lending library consists of sev- eral hundred books,audiocassette pro- grams,and videos available for em- ployees and contractors to borrow. Topics range from job search and re- tirement,to total quality management and presentation skills. The centers also are sponsoring workshops and seminars in June and July,including a Private Sector Job Fair June 8,9 a.m.-4 p.m.,1E-245 FOR.For more information,call the Forrestal Center at 586-2452 or the Germantown Center at 903-0409.+% Recent additions to the Research Exchange lending library: Career transition: Knock 'Em Dead '95 by Martin Yate 101 Great Answers to the Toughest Interview Questions by Ron Fry Peterson's Hidden Job Market 1995 The 1994-95 Occupational Outlook Hand book Public-sector employment: The Complete Guide to Public Employment The Directory of FederalJobs and Employers by Ron and Caryl Krannich Find a Federal Job Fast Career and professional development: Flight of the Buffalo by James Belasco and Ralph Stayer Power Networking Tom Peters on...the New Manager and the New Organization Career Power!by Richard H.Koonce 16 DOE This Month Cutting costs across the DOE complex Facing shrinking budgets,DOE sites across the country are finding ways to reduce expenditures and still make progress. Many sites are reducing services to cut overhead costs while allowing pri- ority work directly related to their mis- sions to continue. For example,12 buses a day are being eliminated from the current bus fleet of 120 at the Idaho National En- gineering Laboratory. In addition,INEL is planning cuts to food service,mail systems and cus- todial services."These changes are the beginning of our efforts to direct our funding where it is most critical-on our missions,”said Lockheed Idaho Executive Vice President Greg Baker. Hanford has eliminated the major- ity of its bus services and reductions in support-service functions are being considered,such as fire protection and ambulance services,road construction and maintenance,sewage treatment and water treatment. "We are exploring with the city and county which services they might effi- ciently provide,”said John Wagoner, Richland Operations Office manager. All non-essential costs are under scrutiny and contractors are being chal- lenged by incentives.The M&O contrac- tor Westinghouse Hanford Company has a financial challenge to save at least $170 million this fiscal year alone.Since 1988 Westinghouse Hanford's productiv- ity efforts have saved $973 million. Major cost-cutting initiatives include competitive contracting out for com- mercially available equipment and ser- vices,sharp reductions in overhead, and cutting unnecessary paperwork. Cost-cutting steps will result in more than $1 billion saved between now and 1998.This represents an overall reduction of 26 percent from earlier cost projections. At Savannah River Site,site manag- ers and employees were asked to re- duce all discretionary expenditures by 30 percent.These savings will come from reducing and limiting things such as non-mandatory and nonessential training,off-site travel,corporate training classes,replacement computer and soft- ware purchases,exempt overtime,mem- berships and subscriptions,and janitorial services. Furthermore,Savannah River is eliminating personal car mileage reim- bursement for on-site travel and non- essential building maintenance. Employees at Rocky Flats have supported cost reduction efforts and during the first six months of FY 1995 had already identified process im- provements totaling $20 million. For instance,a $1.5 million cost avoidance was due in part to a 90 per- cent reduction in required specialized radiation exposure surveys.Previously, specially shielded radiation exposure surveys were taken in each plutonium building to determine exposure result- ing from plutonium in glovebox ex- haust ductwork.Now,the process has been modified and more general area surveys are being used. Most sites have had ongoing cost-saving programs for several years. The Oak Ridge Operations Office and its prime contractor Martin Marietta En- ergy Systems are "seeking a new world” of cost-effective ways of doing business with their Columbus Initiative. The initiative is not a one-time cost-cutting effort,but a process of continuously improving products,pro- cesses and services which has saved more than $260 million since its incep- tion in 1992.Associated activities in- clude streamlining organizations,re- ducing indirect costs,improving work processes and increasing productivity across all business systems. Also at Oak Ridge,three pilot projects initiated in 1994 are demonstrating the ef- fectiveness of using innovative manage- ment and contracting techniques to per- form environmental restoration work.Cost savings are expected to result from unique incentive arrangements,use of qualified specialty contractors and better assignment of authority and responsibilities.+ Daughters see accelerator first-hand Hue-Anh Pham,an electronics specialist at the Relativistic Heavy Ion Collider,points out a fea- ture of the collider to daughters of employees from Brookhaven National Laboratory. More than 200 daughters participated in the lab's first "Take Our Daughters to Work Day,”a national event designed to increase girls'self-esteem and give them exposure to a variety of career options. The collider is Brookhaven's newest and largest accelerator,now under construction and scheduled for completion in 1999.More than 800 physicists from more than 60 institutions are expected to con- duct experiments at the collider,with the goal of creating and examining a form of hot,dense matter that hasn't existed since moments after the Big Bang. June 1995 O'Leary chairs IEA meeting on critical issues For the first time since Charles Duncan,Jr.in 1980,a U.S.Secretary of Energy chaired a ministerial meeting of the International Energy Agency.Sec- retary Hazel O'Leary presided over the May 22 meeting in Paris,which in- cluded senior representatives from 23 IEA member countries and the Euro- pean Union. Strengthening global cooperation was discussed,since developing economies are playing an increasingly important role in global energy secu- rity and environmental trends.O'Leary noted that 65 to 75 percent of the in- crease in energy demand by 2010 will take place outside IEA,with Asia rep- resenting nearly half of the increase. Ministers called for efforts to pro- mote dialogue,technology coopera- tion and investment in these countries to advance sustainable development. At the forefront of this effort,O'Leary led presidential missions to China,In- dia and Pakistan which resulted in $20 billion in projects for U.S.companies. "Cooperation with developing and transitioning economies benefits real Save dollars with new Electronic Sharing Program With growing budget restraints, you're under pressure to do more with less.You have to find ways to cut costs and give the taxpayers a better return on their dollars.And so far, you've been on your own,devising new cost-saving measures,struggling through the paperwork,working hard to keep things moving. Now there's an easier way:ESP. No,ESP doesn't refer to extrasensory perception.ESP is the Electronic Shar- ing Program-your electronic on-ramp to the superhighway of DOE savings initiatives.It's an electronic database of the best practices and cost reduc- tion know-how from all the govern- ment-owned,contractor-operated sites. ESP is an expansion of the Saving through Sharing program Westing- house has used successfully at its GOCOs since 1991.The brainchild of Westinghouse senior executive Jim Gallagher,the program began as a way to achieve efficiency and synergy among Westinghouse's geographically dispersed GOCOs. After four years,a lot of fine tuning, and more than $100 million in cost savings,the system is now available to all GOCOs via the Internet,through the DOE Home Page.And ESP can help you achieve real savings,real fast. The Waste Isolation Pilot Plant, Hanford,West Valley and Savannah River electronically share supplier evaluation information.This saves time and cuts supplier evaluation trips.The Waste Isolation Pilot Plant alone saved $150,000 last year through immediate use of pre-approved vendors. ESP gives you instant access to such cost-saving programs already up and running at other sites.For ex- ample,the Waste Isolation Pilot Plant has a corrective/preventive mainte- nance zone concept that represents the best practices in the industry.By adopting this process,Westinghouse Hanford Company improved mainte- nance productivity by 40 percent,dra- matically cut overtime hours,and saved $2.5 million in 1994. Through ESP,you can find people at other sites with operations or needs similar to your own.By pooling re- sources,you can meet your needs for a fraction of the cost.For example,en- gineers at Savannah River and West Valley both needed new inspection technology for high-level waste tank wall surfaces.Through sharing their ideas,they developed,funded and tested a remotely operated robotic tank crawler that can access 100 percent of tank surfaces.And they saved $1.5 mil- lion by ending duplicate development costs. These are only a few examples. Next month,we'll report how you can tap into the power of ESP,and give your ideas electronic flight throughout the DOE complex.* people,”O'Leary said."It creates jobs in both nations and deploys technolo- gies which reduce local pollutants and global emissions.” With carbon dioxide emissions ex- pected to rise by 30 to 40 percent by the year 2010,and increases in non-member countries more than dou- bling,ministers endorsed innovative approaches to advance their environ- mental goals,including voluntary part- nerships and joint implementation. Ministers agreed cooperation with non-member countries was essential. Pree, Hands-on John Smith,engineering techni- cian,shows a respirator to Jennifer Wilkerson,clerk,and Sam Moore, engineer,at the Hanford Safety and Health Expo held in April.The Expo gave 5,500 employees and family members an opportunity to learn from fellow work groups' safety successes,become informed on home safety,and see the latest in safety equipment from vendors. The Expo was a grassroots effort initiated by employees and planned by a cross-contractor team."The unions are glad to be a part of the Expo,”said Keith Smith,president of the Machinist's Union and secre- tary of the President's Accident Pre- vention Council at Westinghouse Hanford Company."This was a worker-driven event.It's our chance to show how safety-conscious we are and reinforce our behaviors.” 6 DOE This Month steel. high savings in energy consumption. hicles. Cuenca,Argonne,708-252-9175. Showing gas guzzlers the door Assistant Secretary for Energy Efficiency and Renewable Energy Christine Ervin demonstrates how lightweight alu- minum is with a door 40 percent lighter than one made of The door comes from a Ford Mercury Sable 400 pounds lighter,thanks to extensive use of aluminum in both exte- rior panels and structure.The car was on display April 27-28 outside the Forrestal Building.Its reduced weight re- sults in increased fuel economy and,if mass produced, Due to the difficult and costly forming techniques used for aluminum parts,DOE is working with Ford,Alcoa Alu- minum and Argonne National Laboratory to develop cost-effective,mass-production "stamped-sheet”techniques. The car is one of 40 experimental Aluminum-Intensive Ve- hicles Ford is building.Argonne is testing the car to mea- sure fuel economy and performance.The lab will operate it for 3-1/2 years as part of its staff fleet of evaluation ve- For more information,contact James Eberhardt,Of- fice of Transportation Materials,202-586-9837,or Roy Education vou: Secretary Hazel O'Leary transferred $1.5 million worth of excess security equipment from DOE nuclear weap- ons plants to District of Columbia Schools to improve safety.The equip- ment---metal detectors,x-ray ma- chines,video monitors and cameras- is being installed in 18 city high schools.O'Leary and Superintendent Franklin Smith signed a memorandum of understanding May 15,formalizing the transfer. K?ue The Washington Science Teachers Association has recognized Pacific Northwest Laboratory's Science Edu- cation Center with an award for out- standing contributions to the advance- ment of science education-such as providing science teachers and stu- dents with research experiences at the Laboratory,teacher workshops and training,curriculum reform,and class- room equipment and materials.A sec- ond award came from the Washington State Association of Supervision and Curriculum Development,which hon- ored PNL for its work in the WISE-STEP Prep Project,a collabora- tion among five institutions designed to improve elementary science teach- ing by increasing professional devel- opment opportunities for elementary teachers. o> Students from 15 Iowa high schools showcased their achievements in supercomputer programming at Ames Laboratory's 1995 Adventures in Supercomputing Expo.Goal of the program is to spark interest in math and science by allowing students to use the same powerful computers that professional mathematicians and scien- tists operate.DOE supports the pro- gram in five states:Alabama,Iowa, Colorado,New Mexico and Tennessee. o, Twenty-five teacher/student re- search teams in 18 states will share $5.3 million in federal funds this year to explore key issues to advancing the science of coal and how it affects the world environment as part of DOE's annual University Coal Research Program,now in its 16th year.+ Hearings end on draft tritium PEIS During April,the Office of Recon- figuration,Defense Programs,con- ducted public hearings in Las Vegas, Nev.;Washington,D.C.;Pocatello, Idaho;Oak Ridge,Tenn.;Amarillo, Texas;and North Augusta,S.C. The purpose of these hearings was to receive comments on the Draft Pro- grammatic Environmental Impact State- ment for Tritium Supply and Recycling, released March 1.About 700 people participated.A new interactive work- shop format was used instead of the formal five-minute testimony format. Public response to the new format was very positive. The comment period on the draft document ended May 15.Comments were also received by telephone,mail, fax and electronic bulletin board.All comments are being compiled and will be published along with the depart- ment's responses in a Comment Re- sponse Document.The Final PEIS will be modified,as appropriate,based on the comments received.Both docu- ments are scheduled for October re- lease.For more information,contact the Office of Reconfiguration at 1-800-776-2765. June 1995 15 SRS outreach educates future scientistsYoungvisitorstotheSavannah River Site can classify plants and ani- mals,determine soil characteristics,as- sist professional scientists in solving real-world environmental problems and even use state-of-the-art technol- ogy to identify an individual snake im- planted with a coded microchip. "Students may not remember a spe- cific math or science lesson,but they'll remember everything that happened on their field trip to the Savannah River Site,”said parent Wesley Carter of Aiken,S.C. Savannah River has long been in- volved in efforts to educate students, teachers and the public. Several SRS organizations,all funded in part by DOE,contribute to these efforts,reaching 400,000 people each year through field trips,talks,ex- hibits and printed materials. Savannah River Archaeological Research Program relates its research about people and their cultures from earliest prehistoric times to the historic 20th century. TheEcology Laboratory'Ss outreach division sets up large animal and plant exhibits at events such as the Palmetto Sportsmen's Classic in Columbia,S.C., attended by 70,000 visitors. "Our program places a priority on teaching children directly about ar- chaeology,”said spokeswoman Mary Inkrot."All of the presentations in- clude hands-on activities.”Activities range from a week-long summer camp for students to a dig for the public at the Late Archaic/Early Woodland Tinker Creek site. Savannah River Ecology Laboratory's Environmental Outreach and Education Division teaches stu- dents,teachers and citizens about ecology and its real-life applications. "By using live animals such as snakes,we try to spark people's inter- est in the rich biodiversity of our area,” said Coordinator Tony Mills.Classroom talks focus on local and U.S.ecology. In 1993,the Savannah River For- est Station initiated the Natural Re- sources Science,Mathematics and En- gineering Education Program.Students visit nine habitats and apply math,sci- ence and engineering principles to solve natural resources and environ- mental problems.Local teachers help develop the program's curriculum. In 1994,the program reached more than 40 schools and 6,000 students.Teacher workshops,sum- mer camps and a graduate course Elementary schoolchildren love to get hands-on experience with animals introduced to them by staff members of the Savannah River Ecology Laboratory. are planned for 1995. Westinghouse Savannah River Company reaches students and teach- ers at all levels."Our initiatives focus on developing partnerships with the education community to improve teacher and student skills,”said Educa- tion Director Lynn Bertsch."Our inno- vative initiatives also provide a highly skilled,marketable employee base that aids in attracting new industry and jobs to the area.” For instance,the School-to-Work Program pairs high school seniors with professional mentors in computer elec- tronics,electricity,heating,ventilation and air conditioning,better preparing students for the job market. In an innovative attempt to encour- age early public involvement in the Environmental Impact Statement (EIS) process,Westinghouse and DOE rep- resentatives conducted classes at high schools and colleges.Instructors taught students the EIS process and laws and regulations driving opera- tions at the site.Students toured SRS facilities,held mock public meetings and developed a computer-based multi-media project for stakeholders to use as a quick,informative and fun reference.Jane Sanders, 803-725-9724) 14 DOE This Month Rural electric co-ops join Climate Challenge In May,more than 200 rural electric cooperative utilities joined DOE's vol- untary Climate Challenge program to reduce greenhouse gas emissions in the U.S.effort to fight global climate change. "I'm so pleased with this broad support from America's heartland,” Secretary Hazel O'Leary said. The voluntary,cost-effective actions to reduce greenhouse gas emissions are being carried out by virtually the entire utility industry,O'Leary said, with economic and environmental ben- efits to the utilities,their customers and their local communities."But the ben- efits don't stop there-they also help our nation meet its responsibility to clean up the global environment,too.” "This is the appropriate response to global climate change concerns,rather than expensive regulatory programs,” said Glenn English,executive vice presi- dent of the National Rural Electric Coop- erative Association,whose members signed accords with DOE."Our mem- bers are taking cost-effective actions to reduce overall costs to their consumers and contribute to the goal of reducing greenhouse gas emissions.” NRECA represents rural consumer- owned electric utilities established to provide at-cost electric service for 25 million people in 46 states,accounting for about 7 percent of total U.S.elec- tricity use. Twenty-one systems,representing 202 cooperatives in 20 states,pre- sented their plans to O'Leary.The plans include enhanced demand-side management programs,improved fossil-generation efficiency,and in- creased use of natural gas and renew- able energy,including geothermal heat pumps. So far this year,285 members of four major utility organizations have signed commitments estimated to re- duce greenhouse gas emissions by the year 2000 by more than 44 million metric tons of carbon equivalent.The NRECA projects will add another 400,000 metric tons of reduction. The other utility signatories are the Large Public Power Council and its 15 members,the Tennessee Valley Au- thority,the American Public Power As- sociation and 204 of its members,and the Edison Electric Institute and 66 of its members. NEWS BRIEFS WASHINGTON,D.C.-The U.S.and Ukraine governments and environmental research center at Slavutich near Chernobyl.The center is the result of collaboration be- tween DOE,the State Department,the Nuclear Regulatory Commission and Ukranian nuclear and environmental agen- cies and organizations.The center is intended to improve the safety of nuclear-energy generation in Ukraine,and reduce risks posed by Chernobyl reactor operation,said Secretary Hazel O'Leary.The center also will serve as a focal point for international research in environmental con- tamination and site restoration. RICHLAND,Wash.-The Richland Operations Office com- pleted an Environmental Assessment on plans to sell and transport slightly radioactively contaminated nitric acid to British Nuclear Fuels,a public limited company,of Great Britain,DOE issued a Finding of No Significant Impact, meaning that an Environmental Impact Statement is not required and the proposed action can proceed.The first of 52 planned shipments left Hanford by truck on May 22 and departed from the Port of Portsmouth in Virginia on May 29. AIKEN,S.C.-Savannah River Ecology Laboratory research- ers have found at the Savannah River Site a deformed screech owl and five owlets,three of which had visible birth defects. The cause of the defects is not yet known,but these deformi- ties can occur naturally in domestic animals.However,re- searchers are testing the birds for various contaminants. WASHINGTON,D.C.-Christine Ervin,assistant secretary for Energy Efficiency and Renewable Energy,honored a dozen companies with the "Energy Pioneer”award for successfully commercializing new energy-efficient technologies.These technologies are already producing tremendous benefits for have agreed to establish an international nuclear safety: the American taxpayers.The companies received the award for working in partnership with DOE to develop and market 10 new products ranging from electric cells and wind generators to ce- ramic auto engine parts and control systems that save energy in steel and chemical manufacturing. LIVERMORE,Calif.-Lawrence Livermore National Labora- tory engineers and computer scientists are developing a pro- curement information system and participation forum as part of the National Performance Review project set up by Presi- dent Clinton to "reinvent government.”The idea is to provide hypertext access to Federal Acquisition Regulations and allow government agencies and vendors in private industry to com- municate more directly by allowing them to participate in an electronic "collaboratory”on procurement reform.The labo- ratory is developing the software for a World Wide Web inter- face and addressing issues of security and integrity of infor- mation.A graphically organized method of categorizing the information will also be built into the system. NEW YORK,N.Y.-The American Institute of Chemical Engi- neers'Design Institute for Physical Property Data has signed a four-year,$200,000-per-year cooperative research and devel- opment agreement with DOE.DOE will match $50,000 per year in funds put up by DIPPR industrial sponsors,with work on two projects to be conducted by the Thermodynamics Group at the National Institute for Petroleum and Energy Re- search in Bartlesville,Okla.DOE will also match $50,000 per year's worth of "in kind”contributions-chemicals,data pro- cessing,literature references and professional advice. WASHINGTON,D.C.-Resolution of a 78-year-old land dispute will net $180 million for California's State Teacher Retirement Fund if Congress approves DOE legislation allowing the sale of Elk Hills Naval Petroleum Reserve near Bakersfield,Calif.The legislation earmarks 7 percent of the anticipated $2.6 billion in proceeds from privatization for cost-of-living increases for re- tired California public school teachers. June 1995 Special Section:SAVANNAH RIVER SITE How has the change to an environmental cleanup mission affected DOE sites around the country?To explore the answer to these questions,an ongoing series in "DOE This Month”focuses on each site in the DOE complex. On the next four pages,we visit the Savannah River Site,which has adjusted its post-Cold War role as the nation's supplier of nuclear defense materials while pursuing environmental restoration goals. itHArea: Coed ¥ a ad'or \iat cae ,part of the Savannah River Site's 310-square-mile facility,is home to the H Canyon,the predominant facility in one Aw via"a":cities Ritts a of two chemical separations areas.H Area also houses the site's new Replacement Tritium Facility,the receiving basin for off-site fuels and HB Line,where plutonium-238 is manufactured for the nation's space program. Prepared for the future For almost 40 years,the primary mission of the Savan- nah River Site in Aiken,S.C.,was to produce nuclear mate- rials for the nation's defense.Today,SRS is still fulfilling necessary defense missions,such as tritium recycling to maintain the nation's nuclear weapons stockpile. But SRS missions are also expanding.Those additional missions-building economic alliances,pursuing environ- mental restoration and waste management activities,all while enhancing operations through diversity and cost- effectiveness-are built on the infrastructure and expertise already established at SRS.The bedrock for all work at SRS is safety.In 1994,SRS celebrated another nearly injury-free year,ranking as the safest DOE facility-and one of the saf- est places to work in the country. And that's just one example of SRS's unique qualities. Meeting U.S.needs While SRS delves into important environmental restora- tion work,it hasn't turned its back on other opportunities to fulfill U.S.needs.SRS,through the past 40-plus years, has integrated capabilities that can effectively support exist- ing and new DOE missions,said Mario Fiori,DOE manager at SRS. "The site has demonstrated production performance and high-quality environmental safety and health programs,” Fiori said."In addition,SRS has a modern infrastructure with plant capabilities,applied technology base,industrial know-how for integrated project management and a cost- effectiveness focus that produces results.” Today's emphasis on cost effectiveness means employ- ees understand being good stewards of tax dollars is an op- portunity to show how well they can manage the workload,consistently striving to accomplish more with less funding-and finding ways to save money through See FUTURE page 11. DOE This Month Research Digest (Continued from page 12.) refrigeration to scientific instrumentation. The system reduces vibration pro- duced by the motorized compressor with microprocessors which produce a counterforce that cancels most of the movement.Less vibration makes the motor more efficient and uses less en- ergy.Small amounts of helium serve as the coolant rather than environmen- tally harmful chlorofluorocarbons. (Gordon Yano,510-423-3117) %- Lawrence Livermore National Labo- ratory has eclipsed the $500 million milestone in industrial partnership work with the signing of a $12 million package of high-performance comput- ing agreements with nine major U.S. companies.The goal of this partner- ship package is to use multiple com- puter processors running in parallel in a tightly coupled network to solve some of the most complex prob- lems facing industry today. These machines can solve problems 10 times larger than those running on conventional supercomputers.Industry partners include ALCOA,Arete Engi- neering Technologies,AT&T Bell Laboratories,Boeing,Cray Research, Haliburton Corp.,Hughes Aircraft,In- ternational Technology Corp.,and Xerox Palo Alto Research Center. (Stephen Wampler,510-423-3107) %% Pacific Northwest Laboratory is us- ing its nuclear fuel expertise to help DOE solve one of Hanford's most urgent problems-safely storing more than 2,300 tons of highly radio- active spent nuclear fuel stored in the K Basins,40-year-old facilities near the Columbia River.The fuel,some of which is severely corroded,is left over from Cold War reactor operations. "PNL has beguna series of destruc- tive and nondestructive analytical tests of the fuel to determine its physical con- dition and corrosion characteristics,”said Paul Turner,PNL's manager of the spent nuclear fuel project.DOE will use the data to help develop a strategy for re- moving the spent nuclear fuel from the aging K Basins and storing it safely else- where at Hanford.The plan is to re- move the fuel by 1999. money and phony stones. (Kathy DeLucas,505-665-9201) Finding funny money A tool used at Los Alamos National Laboratory for characterizing plas- tics and rubber in radioactive waste can be used for identifying funny Researcher Don Burns uses near-infrared spectroscopy to analyze and characterize the contents of decades-old barrels filled with radioactive waste bound for storage or further study.Burns has successfully demon- strated this technology can also determine the authenticity of American currency and turquoise stones found in Southwest jewelry. Because of optical scanners and better computing technologies,coun- terfeiting is becoming harder to detect.According to Secret Service spokesman Carl Meyers,American money is the most desirable currency in the world and the most easily counterfeited.In 1992,$30 million worth of counterfeit money was seized overseas.In 1993,federal agencies con- fiscated $120 million worth of overseas counterfeited currency. Another popular American item,Southwestern Indian jewelry,has gained so much public favor that unscrupulous jewelry makers sell plastic turquoise as genuine stones.Unfortunately for anxious tourists,some of the plastic turquoise is such a good fake it can sometimes fool even an experienced jeweler.Burns has applied for a patent to use near-infrared spectroscopy to distinguish the genuine from the fake. Near-infrared spectroscopy requires very little setup.The technique is nondestructive and can be nearly instantaneous.Light,just beyond the visible spectrum,shines through a fiber optic cable onto a sample that re-flects the light back to sensors that feed the information to a monochro- mator,then to a computer.The monochromator acts like a prism and breaks up the light into many wavelengths.The makeup of every material creates its own reflectance pattern,much like a fingerprint.The computer then analyzes the "fingerprint,”matches it against stored patterns and pro- vides an analysis of the material's composition. In order to recognize a pattern that relates to a particular material, Burns has built a software computer library stocked with information gathered through experimentation.Once an item falls within a known pattern,there's almost no doubt about the item's makeup,said Burns. Tritium purification system increases safety at PPPL New technology that recycles trittum at the Princeton University Plasma Phys- ics Laboratory is expected to substan- tially decrease tritium shipments be- tween New Jersey and South Carolina. The laboratory has installed the Tritium Purification System-a closed- loop system for purifying and reusing tritium-at the Tokamak Fusion Test Reactor site. Pure tritium is shipped from Savan- nah River.The tritium is injected into the Tokamak where a small fraction is converted into helium,a neutron,and energy.Before installing the new sys- tem,tritium not burned in the Toka- mak was converted into oxide and shipped back to Savannah River, where it was reprocessed and returned to elemental tritium. "With the Tritium Purification Sys- tem,we essentially cut a large number of the tritium shipments in and out be- cause we are able to reuse the tritium already here again and again,”said Paul LaMarche,head of the TFTR Tri- tium Systems Division. Using the system increases safety by reducing tritium shipments on the highways and keeping tritium in its least hazardous,elemental form.About 40 grams of tritium have been shipped to and from the Laboratory since tri- tium first arrived on site.* June 1995 13 Research Digest A new era in x-ray research began at 7:13 a.m.March 26 when the first x-ray beams were produced by Argonne National Laboratory's Ad- vanced Photon Source. "We are now ready to generate beams powerful enough to see the molecular structure of the most complex materials that nature or man can produce,”said David Moncton,associate Argonne laboratory director for the project.Moncton said the achievement is the most significant in a series of technological successes that will culminate with the creation later this year of extremely high-bril- liance x-ray beams for frontier materi- als science.The Advanced Photon Source has produced first light nearly a year ahead of schedule,while re- maining within budget.(Catherine Fos- ter,708-252-5580) Brookhaven National Laboratory has expanded a multi-patient clini- cal trial of an experimental treat- ment for brain tumors-boron neu- tron capture therapy.The treatment is being tried on an especially virulent type of brain cancer known as glioblastoma multiforme. Initially,the clinical trial begun in February with FDA approval was lim- ited to patients age 50 and over.Now, patients under 50,down to age 18, will also be considered for therapy. Brookhaven is the only location in the U.S.where researchers are conducting clinical trials of this boron treatment on brain tumors.Interested patients and physicians can call 516-282-3684. c- The level of damage caused by Hurricane Hugo in September 1989 will increase forest diversity in South Carolina's Congaree Swamp Na- tional Monument,according to Savan- nah River Ecology Laboratory research- ers who have studied the area for the past six years. The Congaree-which before Hugo contained several national and state record-size trees-is one of the best examples of old-growth cypress-tupelo swamp forests in the Southeast.Much of the Congaree has never been logged,while other parts hadn't been disturbed for more than 100 years be- fore Hugo hit.Hugo added plant litter and debris to the ground by uprooting and snapping trees.The changes pro- vided opportunities for many different plant species to become established. The finding coincides with the theory that if an ecosystem occasionally expe- riences moderate disturbance-such as every 100 or 150 years for a forest-it helps increase species richness.Jane Sanders,803-725-9724) oa The National Renewable Energy Laboratory has signed partnership agreements that will move the nation closer to solving widespread soil and groundwater contamination problems.The agreements are with IT Corporation of Knoxville,Tenn., and International Fabricare Institute of Silver Spring,Md. The cornerstone of both agree- ments is a photocatalytic oxidation technology that uses ultraviolet light and photocatalysts to destroy hazard- ous contaminants in air and water.The light,supplied by sunlight or electric lamps,activates the catalysts,creating a reaction that destroys contaminants. (Mike Coe,303-275-4085) A breakthrough advance in cool- ing system design promises to cut costs,protect the environment and open up a new field of portable cool- ing systems.Designed by scientists from Lawrence Livermore National Laboratory,the portable system uses low power and exhibits very low vi- bration.It was developed with help from industry for use in a portable, fieldable radiation detection system,but lab researchers believe it has applica- tions in a wide range of areas,from food See RESEARCH DIGEST page 13. Up on the roof Oak Ridge National Laboratory re- searchers are finding ways to dry a wet roof and significantly extend its life at one-third the cost of replacing it.They are also identifying methods of building new low-sloped roofs that dry easily and can be re-covered later to make them last longer.The techniques will save energy and money. At right,Phil Childs checks the mois- ture content in roof insulation for Build- ing 2518,ORNL researchers David Kyle and Andre Desjarlis have written an "as- sessment of technologies for constructing self-drying low-slope roofs”which evalu- ates currently available technologies for removing water from flat roofs.(Frank Juan,615-576-8540) or years,SRS has served a single customer,but thingsF:.different now. "One of our biggest priorities is to use the site to en- hance the nation's competitiveness and the development of the country and the region,”said Mario Fiori,DOE's man- ager at SRS."The nation has invested billions here and,as a result,we've developed technology and talent that are unmatched.The only thing has been that nobody's known about it.That's what's changing.” SRS is focusing on ways of offering industry a range of options for gaining access to site technologies and people. For example,a recent Cooperative Research and Devel- opment Agreement pairs Westinghouse Savannah River Company with Atlanta's Bearehaven Reclamation,Inc.to improve and discover methods for cleaning up soils,slud- ges and landfills.Both companies have experience using naturally occurring soil microbes and microorganisms to clean up pollution in soils and groundwater.Products of the agreement could apply not only to landfills,but could help clean sludge accumulation in certain harbors and canals. Another way SRS is matching technical experts with business is the SRS Industrial Assistance Program,which makes technical people and resources available to local businesses or governments for up to five days to help solve problems,or at least get a good start on them. The site is also a key financial and technical player in the Southeastern Environmental Resource Alliance,a pro- gram that makes resources available for small-and medium-sized manufacturing companies to cope with envi- ronmental challenges they might not have the resources or know-how to deal with.+ A barbed-wire fence between the Savannah River Site and property owned by Chem-Nuclear in Barnwell,S.C.,was ceremoniously cut by DOE Savannah River Manager Mario Fiori (right)and Savannah River Ecology Laboratory Senior Ecologist Whit Gibbons.The fence ran through a large Carolina Bay wetland,which will now be used byChem-Nuclear and SRS as a site for environmental education. Savannah River Site at a glance Employment:About 20,000 people;80 percent are em-products from waste.After refinement,some nuclear materi- 12 DOE This Month ployees of management and operations contractor West- inghouse Savannah River Company and its prime sub- contractor,Bechtel Savannah River,Inc.DOE employees represent 2 percent of the SRS population.The rest are other Westinghouse and DOE subcontractors. Budget:$1.6 billion site-wide. History:SRS was constructed during the early 1950s to produce basic materials used in the fabrication of nuclear weapons,primarily tritium and plutonium-239.Five re- actors were built on site.The reactors produced nuclear materials by irradiating target materials with neutrons.Sup- port facilities built include two chemical-separations plants, a heavy-water extraction plant,a nuclear fuel and target fab- rication facility and waste management facilities. Irradiated materials were moved from the reactors to two chemical separations facilities,where irradiated fuel and tar- get assemblies were chemically processed to separate useful als were shipped to other DOE sites for final use. Mission:Today,to meet changing defense requirements, all five of the original SRS production reactors are perma- nently shut down.While production of new tritium will not be necessary for many years,recycling and reloading of tritium to keep the nation's supply of nuclear weapons ready is a continuing site mission at the Replacement Tri- tium Facility. Capabilities:The 310-square-mile site has modern sup- port facilities and utilities,full transportation capabilities, state-of-the-art systems and facilities for emergency re- sponse,and analytical chemical and metallurgical labora- tories.The Savannah River Technology Center is an ap- plied research and development laboratory. The Savannah River Ecology Laboratory,operated by the University of Georgia,studies the environment,ani- mal and plant life at SRS. June 1995 Special Section:SAVANNAH RIVER SITE Tests continue at unique vitrification facility”Ae:major milestone has been reached at the Sa-vannah River Site's Defense Waste Processing Facil- ity-the nation's first facility of its kind,designed to vitrify high-level liquid radioactive waste. SRS has started "waste qualification runs,”the third phase in a four-part testing program. SRS crews will pour more than 70 canisters of glass to verify that the facility can consistently produce borosili- cate glass to environmental,design and operational re- quirements. Last summer,SRS filled the first 12 canisters with test glass made of non-radioactive chemicals,simulating liq- uid radioactive waste now stored at SRS. Each of the new canisters will be sliced open and its glass quality examined with the help of a special tracer element. Reaching this milestone means that the facility is now out of construction and testing and into an operational mode,a significant step for DOE's high-level waste man- agement program. SRS anticipates starting the initial stage of radioactive operations later this year.During this phase,simulated waste will be spiked with a radioactive isotope and put through the vitrification system. An SAS employee checks oneof the canisters that will beusedtoholdvitrifiedwastefromtheDefenseWaste Processing Facility. Once that process is complete and appropriate re- views conducted,SRS will begin processing actual radio- active waste in mid-1996.+ SRS moves aggressively to save money One key tool that DOE and its operations contractor, Westinghouse Savannah River Company,are using to con- tinue to improve cost effectiveness at SRS adds an element 'of creativity and incentive to cost cutting.The tool is hard-dollar savings. Westinghouse'ssJ.Stuart Roberts,left,and Robby Crumpton helped reduce radiation exposure and cut $250,000 in taxpayer costs at SRS.They suggested using this six-wheel all-terrain vehicle to clean SRS retention basins,eliminating a protective liner from the project. "We are in the midst of a continuing restructuring effort to drive down the cost of doing business at this site,and the hard-dollar savings program is one that clearly works to do that,”said Westinghouse Savannah River President Ambrose Schwallie."I think DOE's renewal of the program demonstrates that we're on the right track.” Hard-dollar savings,simply stated,are savings that al- low funds to be returned to DOE. Although not all proposals submitted have met all offi- cial approval criteria,the program remains a powerful tool for empowering and encouraging employees. The reason?Employees can receive up to 25 percent of validated savings,if ideas are approved by DOE. To be validated,the savings must demonstrate innova- tion and creativity and must go beyond accepted good management practices. Savings for performing the activity can't adversely affect safety or quality and must maintain full performance of workscope. Suggestions have come from throughout the site, ranging from the innovative use of prefabricated radio- logical huts to the reduction of security guards in certain areas. Since the program's inception in 1992,employees have received more than $300,000 from approved ideas. Westinghouse submitted a company record $206 million in hard-dollar savings proposals last fiscal year. 10 DOE This Month Containment huts put safety and waste reduction first The Savannah River Site has taken an aggressive ap- proach to continuously emphasize safety and cost-effec- tiveness and improve overall waste management by mak- ing use of a prefabricated radiological containment hut. These radiological containment huts were a special project proposed by a site-wide team.The team sought to address the growing need to safely perform regular environmental restoration job maintenance,cleanup or assessment. The hut's design not only provides stronger structural integrity,but also reduces the potential for the spread of contamination while reducing waste.So far,the project has saved more than $7 million.And there have been no external contaminations during 200 operations. The containment huts come complete with airlocks, floors,walls and roofs.They are also flame-resistant. The frame is lightweight and reusable,but the unit itself is strong enough to withstand wind and water damage. Easy to assemble,the multiple floors in these huts also provide for easy decontamination.However,the biggest advantage is that when a job is finished,the hut is cut free from the support frame,allowed to collapse and is easily and safely packaged for disposal to reduce overall waste. SRS's success with these huts shows they may be use- ful to other DOE sites.# Future (Continued from page 8.) productivity improvements. SRS also has established quality environmental manage- ment and protection programs.While recent DOE reports show that cleanup at the site will be a long-term activity, stakeholders will help guide the decision-making process, Fiori said. Also,the site is a leader in the complex with a fully in- tegrated waste management system and extensive environ- mental monitoring systems. The site-some 300 square miles-has modern support facilities and utilities,full transportation capabilities, state-of-the-art systems and facilities for emergency re- sponse,and analytical chemical and metallurgical laborato- ries. Tritium recycling On the production side,the site has a strong capabilities base because of fissile-material experience and available facilities. One of the vital components of SRS's work,tritium recy- cling,is now being handled at the new Replacement Tri- tium Facility.This state-of-the-art facility enhances safety and security,better protecting workers,the public and the environment by greatly reducing operational releases while meeting the requirements of the reduced nuclear stockpile. The site also has a recognized applied technology base. SRS is the home of the Savannah River Technology Center, SRS's applied research and development laboratory. In 1972,the site was named the nation's first Environ- mental Research Park.The Savannah River Ecology Labora- tory,operated by the University of Georgia,studies the en- vironment,animal and plant life at SRS. People an important resource At the heart of all the work conducted at SRS-from en- vironmental cleanup to technology transfer-lies the site's core values exemplified by all the site's entities:DOE, Westinghouse Savannah River Company,Bechtel Savannah River,Inc.,Wackenhut Services,Inc.and the Savannah River Forest Station. "At SRS,people are the most important resource,”Fiori said,"demonstrated through the commitment to providing a workforce that is ready to take advantage of all its oppor- tunities through the strengths of each individual employee. The site values the richness,experience and imaginative ideas contributed by a diverse workforce.” While diversity continues to be key in the conduct of day-to-day and long-term business objectives,the site also values and promotes other attributes,such as teamwork, leadership,accountability,the highest standards of ethical behavior and a commitment to excellence,he added. Customer orientation is also an important site attribute. Decisions and actions are responsive to customer needs. Stakeholder opinions are sought and considered before making decisions. Changing national needs SRS employees and the public realize that today's new world brings with it many changes.For example,the need for new nuclear material production has significantly de- creased,and the need to properly dispose of existing nuclear materials is key to nuclear non-proliferation goals. SRS is responding to the changing national defense needs,as well as to its Cold War legacy of stored waste and surplus nuclear materials and facilities,exemplified through the Defense Waste Processing Facility.DWPF will convert the high-level nuclear waste liquids stored at the site into a solid glass form suitable for storage. All of these areas -from innovative and caring people to world-class programs to safe and efficient operations - continue to show SRS is serious about working harder and smarter to meet the nation's needs,Fiori said. "The list of important local and national contributions from SRS is long,but no matter what the task,SRS is help- ing shape tomorrow's global community -just as it always has,”he said.# June 1995 11 Inventions program Saves money,energy A federal government program for stimulating energy-related in- ventions has generated commer- cial products that are saving Americans energy and money,cre- ating jobs,boosting tax revenues, and slowing global warming. That's the conclusion of a pub- lished report prepared by Marilyn Brown and four co-authors with Oak Ridge National Laboratory. The report,"Economic,Energy and Environmental Impacts of DOE's Energy-Related Inventions Program,” examines the results of the program, which has been jointly operated since 1974 by DOE and the National Insti- tute of Standards and Technology.The program solicits and selects invention ideas.From 1975 through 1992,the program provided $41 million in grants to inventors to develop promis- ing concepts. Custer's real last stand? A high-tech device developed at the Idaho National Engineering Laboratory for environmental cleanup is being used by the National Park Service to try to find the remains of 28 missing soldiers killed during "Custer's last stand”at the Little Bighorn Battlefield in Montana. The Park Service deployed the Rapid Geophysical Surveyor in Deep Ravine,thought to be where the last of Custer's company was killed during the fight with 1,500 Teton Sioux and Northern Cheyenne tribes in June 1876.The surveyor provides a look '\MAY 1995 underground for evidence of burial sites without disturbing vegetation and soil.Data readouts are being sent to the Park Service for interpretation. The information gathered may verify the historical Indian accounts that Deep Ravine was the real "last stand,”because the last soldiers alive were in that part of the battlefield."It could help us piece to- gether the puzzle of how the battle oc- curred,”said Dough McChristian,Park Service historian."It may be our only chance to search with currently available technology.” Swine-waste powered farm wins award A Virginia farm that uses swine wastes to produce up to 80 percent of its electricity was presented a 1994 Re- newable Energy Recognition Award at the SOLTECH '95 Conference in April. The project was part of the Regional Biomass Energy Program (RBEP),a tech- nology transfer program funded by DOE to promote use of organic materials- including wastes-as fuels. Swine wastes produced at Martin Farms in South Boston,Va.,are di- gested in a covered anaerobic lagoon which produces methane and then fires a generator to produce electricity.The first of its kind east of the Missis- sippi River,the system can generate its electric bills. Broken into five geographical re- gions,the RBEP encourages close relationships with local organiza- tions and the use of local biomass materials.For example,farm owners Debbie and Harry Martin,Carroll's Foods of Virginia,the Virginia Depart- ment of Mines,Minerals and Energy, and the RBEP helped fund the project. ;up to 26 kilowatts and will save 1 Martin Farms $10,000 each year on Rocky Flats ships mixed waste For the first time in five years,the Rocky Flats Environmental Technology Site has shipped mixed waste off-site to a commercial disposal facility.On March 28,about 160 cubic feet of con- taminated soil left the site for Envirocare of Utah's disposal facility. The shipment contained 21 drums of soil contaminated with radioactive and hazardous constituents from the Building 881 Hillside.These "hot spots”were removed in the fall of 1994.The four-day cleanup marked Rocky Flats'first accelerated response action,designed to significantly reduce immediate risks to workers and the public and to be consistent with the site's final remediation goals. "Resuming off-site shipments of mixed waste is a significant milestone in our cleanup efforts,”said Rocky Flats Manager Mark Silverman.Rocky Flats'last shipment was pondcrete sent to the Nevada Test Site in 1990.Sev- eral additional shipments of mixed waste are scheduled this year. United States Department of Energy (PA-5) Washington,D.C. Official Business ZUZZL60405PCnIMF ENERGYAKCUMMUNLTY-xEG AFFAL533WEST41HAVEANCHURAGEAK995U1-244] vuGi 050195 FIRST-CLASS MAIL POSTAGE &FEES PAID U.S.DEPT.OF ENERGY Permit 2707 FIRST-CLASS MAIL 5PAS RS 220 20 DOE This Month GamerantMay 1995 Vol.18,No.§ Alignment message Jrom the Secretary In early 1993,President Clinton and Vice Presi- dent Gore challenged all federal agencies to help create a government that works better and costs less.At the Department of Energy we have met that challenge through an intense period of fundamen- tal rethinking about how we conduct our work. Through a deliberate and phased strategy,we've begun a major organizational transformation that al- ready has saved money and enhanced government performance-two defining commitments of this administration.Working together: ¢We created the department's first-ever Strategic Plan,which provides a framework and shared vi- sion for our missions in National Security,Energy Resources,Weapons Site Cleanup,and Science and Technology. e We initiated a major overhaul of the department's contracting practices,which will yield billions of dollars in savings through increased competition and performance-based contract man- agement. e We commissioned the first independent post-Cold War review of the department's 10 Na- tional Laboratories,and now are aggressively implementing recommendations that will reduce See MESSAGE page 2. Inside DOE This Month: Cleanup to cost $230 billion..8 DOE gains in public trust seeccncepoacsccocees 9 U.S.,Russia try remote monitoring............10 Rocky Flats contract awarded ..........cccccceses 11 Earth Day celebrated with new park .........14 Book examines cleanup challenges............15 oarTae N The long-awaited Strategic Alignment andDownsizingInitiativewasannouncedMay3. Secretary Hazel O'Leary held sessions with the media and employees to present the package and answer questions.Our special section on the Strategic Alignment continues through page 6. THEMonth | U.S.Department of Energy Published monthly at Washington,D.C., by the Department of Energy,Office of Public and Consumer Affairs for the infor- mation of Department employees and af- filiates and available to others by paid :subscription.|: The Secretary of Energy has determined that this periodical is necessary in the transaction of public business as required by law.Use of funds for printing has been approved by the director of the Of-fice of Management and Budget.The con-: "tent is reprintable without permission andpicturesareavailableformediareproduc-: .tion upon request. .Hazel R.O'Leary _Secretary of Energy _Michael G.Gauldin . Director of Public and Consumer Affairs Tracy L.Cozzens "Editor = Lorraine Entwisle Graphic Design SUBSCRIPTION price for 12 issues is $16 domestic,$20 foreign;single issue $1.50 domestic,$1.88 foreign.Subscriptions must be ordered through,and checks made payable to:Superintendent of -Documents,U.S.Government Printing Of- :fice,Washington,D.C.20402. Circulation Office:(202)586-2050 News Office: DOE This Month : c/o Westinghouse Hanford Company ¢ ,Employee Communications é -P.O.Box 1970,mailstop B3-26 »Richland,WA 99352 Phone:(509)376-4639,fax:(509)376-5560 Internet address:Tracy_L_Cozzens@rl.gov Street address:1100 Jadwin Ave. Richland,WA 99352 Deadline for submissions:15th of every . month for the following month. DOE PA-0018-5 DOE This Month és printed on paper containing at least 50 percent recycled materials. Message (Continued from page 1.) the cost of doing business at the labs and help sustain their long record of scientific discovery and technological innovation-essential for long-term economic growth. e We launched ambitious reviews of our $2 billion applied energy R&D program and our complex system of regulating nuclear safety at our facilities.These two reviews are marshaling some of the most sea- soned experts in the nation to assist us in enhancing the productivity, efficiency and cost performance of the department. Finally,in the fall of 1994 we announced our Strategic Alignment Initiative-Phase II of our strategic planning process.This 120-day, employee-driven effort was given the job of identifying better,more cost-effective means of performing the core missions defined in our strategic plan. The package of initiatives includes many of the most compelling ideas developed by the Strategic Alignment team.It also includes sev- eral initiatives developed separately within the department.The result is a major package of organizational reforms,legislative proposals,and cost-cutting measures that will contribute more than $1.7 billion in sav- ings toward our commitment,announced in December 1994,to reduce the department's budget by $14.1 billion over five years. Legislation we are submitting this month would produce an addi- tional $5.3 billion in deficit reductions.The balance of our commit- ment---involving reductions of $4.4 billion from Environmental Man- agement,$1.2 billion from applied energy programs,and up to $1.4 billion from the department's laboratory complex-are being ad- dressed through separate efforts. Throughthe actions in this report,we have made tough decisions about how we perform our work in a fashion that reduces the size and cost of the department.This alignment is a bold action plan to reduce layers of management,eliminate organizational redundancies,and inte- grate activities that historically have operated in isolation.In so doing, we will meet our most important objective,which is to better serve our customers as we deliver on our missions:protecting national security and reducing nuclear danger,enhancing our long-term energy security, advancing the frontiers of scientific understanding,protecting the envi- ronment,and developing technologies that contribute to U.S.eco- nomic productivity. These are the missions which drive the Department of Energy's ex- istence.These are not missions from which the nation can,or should, walk away.While some have discussed dismantling the department- and possibly even terminating further public support for our mis- sions-we have responded with a clear and consistent message:We have a better way.That better way is to perform these vital missions at dramatically reduced cost,while increasing our level of service to the American public.We will achieve these goals through the continued pride,commitment and excellence of our workforce. Hazel R.O'Leary Secretary of Energy DOE This Month |Milestones YEARS OF SERVICE May 1995 Headquarters Office of the Secretary -Carolyn J.Wallace (30 years).Chief Financial Officer -Thomas W. DeHanas (25),John F.Lopez (25).Defense Pro- grams -Dorothy E.Ruby (30),Rose Long (25). Energy Efficiency -Albert R.Landgrebe (35), Anita D.Devine (30),John D.Kern (25).Envir., Safety &Health -Edward M.Podolak Jr.(25). FERC -BernardJ.C.Smith (40),Marc G.Denkinger (30),Leland H.Soltz (30),W.G.Longenecker (25), Sandra L.Weller (25).Fossil Energy -Warren E. Williams (35),Dorothy E.Fowlkes (30).General Counsel -Loy W.Kirkpatrick (40). Human Resources -Robert W.Jones (35),Stephanie P.Chaconas (30),Melvin S.Johnson (30),David Sholtz (30),Joan B.Williams (30),William E.Jackson (25), James L.Martz (25).Inspector General -Judith D. Gibson (25),Richard H.King (25).National Secu- rity -David A.Bourdon (30).Technology Part- nerships -Thomas F.Cornwell (30). Field Albuquerque -Jerry W.Laughlin (30),Diana K. Deese (25),Leo M.Pate (25),Melanie J.Thomas (25).Morgantown ETC -Karan K.Graham (30). Oakland -Gerald R.Acock (25),John P.Zilius (25).Naval Pet.Res.CA -Gary D.Smith @0). Oak Ridge -Joseph W.Parks (30). Pittsburgh ETC -Walter Fuchs (25).Rocky Flats -Diane L.Hauser (25).Savannah River -Mildred A.Westerdale (25),David M.Whetsell (25).South- western Power -Patricia A.White (40).West- ern Area Power -Daniel J.Kerwin (35),Bohdan M.Chopko (25),Edward F,Craig Jr.(25),Karen R. Tallha (25). Bonneville Power -Marlyn J.Lewis (35),James P.Robinson (35),Michael C.Winchell (35),Rich- ard A.Barton (30),Roger B.Bennett (30),Leo W. DeCandido (30),Nancy L.Sweet (30),Vern W. Cimmery (25),James R.Deuth (25),Paul D. Hagewood (25),Kathy Hoffman (25),Michael A. Jeffries (25),David F.Lundeen (25),Neal E.Meisner (25),Linda L.Perkins (25),Ralph C.Ramsey (25), David C.Rubin (25),Barbara L.Zufelt (25). RETIREMENTS February 1995 Field Bonneville Power -Guy M.Hughes (34 years). March 1995 Headquarters Chief Financial Officer -Carole A.Bromley (23). Defense Programs -Richard A.Conaway (33), Marshall B.Dupuie (32),Robbin J.Fulner (25), Frances A.Lewis (37),Richard C.Yates (39).Edu- cation &Tech.Info.-David P.Harrill (29),Dora H.Moneyhun (28).EIA -John L.Albright (39), Virginia C.Bushmiller (28),Manuel Carrales Jr.(32), Marion E.Davis (28),$.Victoria Krusiewski (39), Malek M.Mohtadi (26),Eugene R.Slatick (42), John R.Tower (39),Rodney L.Wright (32). Energy Efficiency -Hilda Ahearn (33),Edward J.Boyle (29),Glenn K.Ellis (34),Nancy C.Holley (29),Martha P.Huff (24),Sadie L.Jenkins (29), Veronica E.Johnson (36),Roland R.Kessler (22), Frederick V.King Jr.(36),Harold Schneider (36), Stanley F.Sobczynski (36),John E.Stacy Jr.(17), Alan J.Streb (18). Energy Research -Joanne E.Dupuie (33),John W.Everhart (29),Carolyn A.Goodfellow (26), Frederick A.Koomanoff (24),Joyce E.Lewis (32), Robert Rabson (33),Enloe T.Ritter (28),Murray Schulman (32),Sylvester Sims (29),Linda M.Staples (27),F.Dee Stevenson (24),Walter N.Thomasson (28),Eileen E.Ward (34). Envir.Management -Mary L.Fleming (31),John J.Jicha Jr.(27),Isiah O.Sewell (33).Envir.,Safety &Health -William W.Kinney (24).FERC -Rob- ertJ.Curry (17),Russell E.Faudree Jr.(32),Robert E.Hildebrand (37).Fossil Energy -Keith N.Frye (28),Duryea De B.Gray (27),David S.Jewett (31), Michael W.Monaco (26),Ronald A.Parent (30), Arvid H.Strom (17),Douglas B.Uthus (29). General Counsel -Theodore Wilson (26). Hearings &Appeals -Dorothy G.Forrest (34), Vernie M.Teasley (27),Max W.Yano (48). Human Resources -Naomi R.Chapman (26), George R.Haymond (35),Nelson D.Lyles (36), John A.Ruatto (32).Inspector General - Bertram B.Adams (24),John A.Chunta (29), Eugene P.Javier (28),Ray F.Kukol (25),Eldon D.Naiberk (32),Juanita H.Walls (26). National Security -Frank L.Buckley (30),Sal- vador N.Ceja (39),Anne M.Cornell (27),Joyce B.Dailey (36),William E.Davis (25),Miles D. Gray (29),Harold L.Hann (10),Theodore A. Hart (28),Robert W.Knapp (10),Joe Lewis (29), Kenneth J.Maher (41),Patricia A.McLaughlin (35),Martin E.Strones (33),Barbara H.Thomas @2),William D.Young (14). Nuclear Energy -Charlotte A.Abell (24),Peter M.Lang (18),Alan R.Newhouse (35),Richard G.Oehl (40),Thomas A.Werner (29).Policy - Robert E.Greeves (35),John R.Morris (25), Dennis K.Taillie (35).Radioactive Waste -J. Bennett Easterling (32),Virginia P.King (31),E. Carol Rehkop (35). Field Albuquerque -Howard K.Buhl Jr.(26).Chi- cago -Donald C.Bogen (29),Cheryl L.Chappell (30),Barbara F.Fitzgerald (37),Gordon F.Giarrante (29),S.Frederic Guggenheim (28),Billy W.Lott (31),Dorothy J.Pitts (20),Douglas J.Thompson (30),Lavonne E.Warner (22).Golden -G.Will- iam Ives (24). Idaho -Christian A.Anderson (32),Darrell G. Hinckley (22),Linda M.Jakubowski (27),G. Roylance McBride (22),Lanore E.Parker (21). Morgantown ETC -Donald M.Evans (34),Gary R.Friggens (26),Steven S.Miller (12).Naval Pet. Res CO/UT/WY-C.Ray Williams (23). Nevada -Frederick H.F.Au (29),Patricia G.Bolz (25),James O.Boyer (27),Diane M.Cahill (30), Lee Davis (25),George C.Hoover Jr.(29),Joseph H.Kitchen (26),Dwain A.Kjos (31),Louella S. Mathews (21),Barbara L.Melvin (30),Shirley K. Mudra (22),Richard T.Ryan (7),William G.Schott (7),Dolores J.Thomas (21),Jo Anne S.Thomas (32),KentJ.Utley (26),Earlean Ventura-Davila (29), Robert J.Wenzel (22),Patricia M.Willmore (22), Mary L.Wilson (29). Oakland -Vernon L.Anderson (30),Willa K. Cauley (34),Alex E.Dong (29),Wayne A.Ollikkala (30),Michael F.Olvera (31),Robert T.Padgett (31), Rodney L.Samuelson (8),Miguel A.Valdes (9). Oak Ridge -Grover A.Smithwick (27).Ohio -V. Wayne Buisman (30),Marcel E.Crettet (33),Paul W.Holliday (18). Pittsburgh ETC -Alexander R.Lucas (42),Charles Melani (35),George E.G.Morgan (27),Richard L. Rohrer (31),Robert H.Thomas (32).Rocky Flats -Emory H.Bull (13),Dorothy L.Gross (21),Joyce B.House (21),Gerald Hunvald (27).Strategic Pet.Res.-Larry J.Rousseau (27).Western Area Power -Virgil G.Romine (21). Savannah River -Mary D.Allen (33),H.Albert Booth (36),Etta B.Bozeman (28),Robert E.Caddell (32),Grady E.Copeland (32),William E.Daniel (38),Robert K.Franks (20),Wilene M.Gilbert (21), Dale A.Losier (21),Robert E.Lynch (35),Paul E. Morgan (24),Joan C.Mullins (29),Steven C.Poppy (25),Harold R.Scott (21),Paulinus S.Shieh (5), Theda W.Shumate (23),Mary L.Smith (31),Mary L.Toole (32),Sally S.Turner (32). Bonneville Power -Kenneth L.Ausk (28),Daniel D.Batterberry (24),Dennis L.Benson (25),Harold M.Black Jr.(25),Harry Boelk (28),Ernest R.Bonner (13),Dallas N.Bouy (35),Charles E.Cathcart (31), Robert K.Christensen (18),Wiley W.Crenshaw G1),Douglas L.Dawson (29),Dale J.Dorcheus (27),Kenneth D.Dumler (29),Jerome A. Eyestone (35),Thomas N.Fleming (15),Rich- ard A.Floessler (31),Robert E.Freytag (33), George E.Gorsuch (34),Robert D.Griffin (28), Kathleen A.Grim (28), Harold W.Grissom (26),Furnon M.Hale (24),L. Kirk Hall (25),Barbara J.Hanson (25),Raemond A.Hellbusch 1),Henry W.Hucke (32),James W.Jarrett (28),James R.Jensen (21),Patricia A. Jensen (32),David T.Johnson (30),Otmar Jonas (20),Steve W.Justice (26),Terrence Kafara (20), Carol K.Kiggins (20),William D.Kiter (29), Bruce R.Knutson (31),James N.Kroenlein (26), Herbert C.Kuhn (27),Larry C.Larson (31), Melvin L.Lay (30), Betty A.Lee (28),Norman L.Linscott (30),James W.Lipscomb Jr.(32),Wayne A.Lofdahl (31),Karla G.Magedanz (29),Robert A.Magedanz (25),Oran B.Manley Jr.(27),Thomas Martin (37),Robert W. Mitchell (38),Larry D.Mork (22),John E.Paisley (12),Stanley L.Peterson (29),Robert L.Porter (26), Jon W.Price (35),Ursula M.Radford (26),Gary L. Ragsdale (24),Delbert F.Ramey (30),James J.Ray (33),Keith V.Rivers (31),Joel K.Sanford (28), Don F.Schied (32),Shirley R.Sealey (16),David B.Shaw (29),Thomas H.Short (29),Ronald J. Smith (26),Donn Smithpeter (29),Gary L.Standfill (13),Jack C.Talmadge (21),Ronald J.Tokarz (29),Donald K.Tubbs (31),Roland F.Umphress (12),Gordon L,Walther (27),Benjamin C.Webb (20),Larry D.Wells (29),Douglas E.Wills (30), Gerald M.Wilson (29),Janet S.Yocom (26),Alvin L.Zielinski (34). April 1995 Headquarters FERC -Constance Y.Terrell (30).Radioactive Waste -Joyce E.Adams (6). Field Western Area Power -Vincent H.Gotte Jr.(34). May 1995 19 People "Michael Saltmarsh has been named di- rector of the Fu- sion Energy Divi- sion and the fu- sion program at Oak Ridge Na- tional Laboratory. Saltmarsh will be responsible for a broad range of re- search and development programs aimed at establishing fusion as a safe and environmentally acceptable energy source for the future. e Alfredo Valdez has been named pro- curement director for the Richland Op- erations Office."I will have the unique opportunity to apply Secretary O'Leary's contract reform initiatives at Hanford,” said Valdez."Those initiatives also match my personal conviction of greater per- formance and productivity by govern- ment contractors to provide the taxpay- ers the maximum value for their money.” e John Wagoner,manager of the Richland Operations Office,has ap- pointed Lloyd Piper assistant manager for Facility Transition.Piper is respon- sible for transitioning Hanford's former defense production facilities to decon- tamination and decommissioning.Pre- viously,Piper was corporate director of facility development for Chemical Waste Management,Inc. 4m Saltmarsh ¢S.Marshall Adams of Oak Ridge National Laboratory has been awarded the annual prize from the Association of American Publish- ers for outstand- ing book of the year in biological sciences.Adams served as co-editor of the book,"Biodiversity of the Southeast- ern United States:Aquatic Communities.” e Jay McDonald has been named vice president of Oak Ridge Associated Uni- versities and division director of the Energy/Environment Systems Division of the Oak Ridge Institute for Science and Adams Education.As division director, McDonald will lead a staff of 80 in con- ducting energy/environmental and safety evaluations and analyses.McDonald has been with ORAU since 1991. e Carl Poppe,a senior physicist at Lawrence Livermore National Laboratory, has been appointed the University of California's associate vice provost for research and laboratory programs.Pope will help oversee activities related to the university's academic and programmatic relationship with Livermore,Lawrence Berkeley Laboratory and Los Alamos National Laboratory. *Sue Clark,an assistant ecologist at the Savannah River Ecology Laboratory, has been appointed to a committee of the National Academy of Sciences.Clark is one of 12 members of the Committee on the Waste Isolation Pilot Plant,a DOE facility being built underground in New Mexico for long-term storage of transu- ranic waste.Clark's role is to provide radiochemical expertise needed to im- prove scientists'understanding of the ability of WIPP to isolate wastes from the environment over the long term. ¢Carl Henning has been named head of the University of California's Labora- tory Administration Office,which works jointly with DOE and the three laborato- ries to administer the university's contract for the management of Lawrence Berke- ley,Los Alamos and Livermore laborato- ries.Henning,a former senior manager at Livermore,will be special assistant for labo- ratory administration."With the prospect of streamlining by the Department of En- ergy and the increasing emphasis on performance-based contracts,we will have both the opportunity and the responsibil- ity for operating the UC-managed labora- tories with greater flexibility in the future,” said Henning. e Jeremy Karpatkin has been named director of Communications and Eco- nomic Development of the Rocky Flats Field Office.Karpatkin most recently served as chief of staff to U.S.Senator Paul Simon in Washington,D.C. *David Brockman has been appointed assistant manager for Environmental Safety and Health for the Rocky Flats Field Of- fice.Brockman was first assigned to Rocky Flats in 1988 as the environmental safety and health site representative,and has since held three deputy director and man- agement positions. Building bridges Eunice Young's path to success hasn't been easy.When she came to Sandia National Laboratories 15 years ago,she says,"I was really an anomaly.I was a young black female engineer,and I had to struggle to find common ground with the people I worked with.” Minorities entering the job market still face these struggles.Community outreach is one way she hopes to change that."Fifteen years ago,I was quoted in U.S.Black Engineer saying that I was part of this new 'transition generation'that would lead the way for other black engineers.I really thought that we would see a signifi- cant increase in the number of black scientists,but that hasn't occurred.In- stead of waiting for it to happen,''m working to make sure it does.” Young was honored with the 1995 Black Engineer of the Year Award for affirmative action for her role in a partnership between DOE and the His- torically Black Colleges and Universi- ties/Minority Institutions Environmen- tal Technologies Consortium.The part- nership strives to teach environmental restoration and waste management to students at minority institutions. Young also tutors minority students and teaches science in her daughter's first-grade class."It was always my dream to be an engineer.I wanted to build bridges.And now,in a way,I do that through these partnerships and with the students I help.”¢% 18 DOE This Month STRATEGIC ALIGNMENT Alignment delivers $1.7 billion to taxpayers Energy Secretary Hazel O'Leary announced May 3 a Stra- tegic Alignment and Downsizing Initiative that will yield $1.7 billion toward deficit reduction.The Alignment and Downsizing package includes closing 24 offices,reducing federal employees by 3,788 (27 percent),and cutting ex- penditures in a variety of other areas. O'Leary also submitted legislation May 3 that would privatize three Power Marketing Administrations and the Naval Petroleum and Oil Shale Reserves.By the end of May,she will submit legislation to transform the Bonneville Power Market- ing Administration into a government-owned corporation and remove the Federal Energy Regulatory Commission (FERC) from the department.Enactment of the legislative package would generate an additional $5.3 billion (see chart). "Today we take a historic step in restructuring the De- partment of Energy for its vital post-Cold War missions.Our downsizing and alignment commitments will enable us to do our work better and at lower cost,”O'Leary said."Our legislative package puts the ball squarely in Congress' court.With their cooperation,we can deliver $5.3 billion more of our $14.1 billion commitment made to President Clinton and American taxpayers in December.” President Bill Clinton said,"For two years,the Depart- ment of Energy has been in the forefront of our Administration's effort to improve service to the American people,reduce costs and open government to the public. Now,the department and the Secretary are building on that outstanding record by cutting the size of government and bringing government closer to the people we serve.” Employees reduced and offices closed:By merging pro- grams,creating "matrix”management structures,moving work to the field and cutting unnecessary work,DOE will reduce employment in headquarters by 2,338 (34 percent) from a 1995 level.This workforce reduction as well as con- solidations and mergers will enable the department to close 12 of 16 offices in the Washington,D.C.,area by 1999. Field office staff will be reduced by 1,450 (21 percent) from a 1995 level of 7,050.Approximately 800 of these reduc- tions will be completed in 1997.In addition,11 field offices and one international office will be closed (see page 4.) Through initiatives announced earlier,contractor workforces are being downsized by 19,000 people or 13 percent through the end of fiscal year 1996. Block grants introduced to states:DOE will consolidate four energy grants into "performance partnership”block grants to states.This approach makes applications easier to submit and allows DOE to consolidate grant administration and technology transfer activities and reduce the number of regional support offices from 10 to five.Services will con- tinue to be provided to customers in the areas where of- fices have closed through "virtual office”operations.These changes will save $68 million over five years. $75 million through asset sales:DOE's Cold War mission left the department with a stockpile of assets in excess of our currently anticipated needs.Assets include more than 10,000 pounds of precious metals (such as gold,silver and platinum),more than five tons of other metals and thousands of tons of chemicals.The department will sell surplus assets to generate at least $75 million in receipts and reduced overhead costs associated with storage,security and handling. Additional savings of $835 million:O'Leary announced travel cuts of $175 million over five years to be realized through better travel decisionmaking,greater use of video- conferencing,and leveraging government buying power on behalf of contractors.DOE spends $365 million annually in travel for federal and contractor employees.Improved infor- mation management systems will generate another $200 mil- lion over five years.Also,DOE will reduce use of support ser- vice contractors for activities such as technical analysis,com- munications and administrative functions.Cuts in these con- tracts will total $460 million over five years. Regulatory reform yields $20 million:DOE has identi- fied ways to speed compliance,streamline approvals,re- form contracting processes and reduce costs for activities related to the National Environmental Policy Act (NEPA). NEPA documentation is required to assess environmental impacts of DOE initiatives.DOE actions will yield $20 mil- lion in savings.More important,the public will have access to environmental impact information in half the time,as DOE reduces the timeline for Environmental Impact State- ments from an average of 33 months to 15 months. Legislation to be submitted:Consistent with the president's FY1996 budget proposal,the administration is submitting legislation to Congress (see page 4.)The pack- age of legislation would take more than 6,700 employees and 80 offices off the DOE rolls,although many individuals will remain in federal employment.¢ Keeping our commitments Program 5-Year Status Savings Alignment and $1.4B $1.7 B package Downsizing announced May 3 Package Power Marketing $3.7 B Legislation to Administration Congress May 3 Naval Petroleum $1.6B Legislation to Reserves ee Congress May 3 Weapons Site $4.4B Savings on Cleanup schedule Galvin Report $1.4B Initial savings Implementation identified Applied Research $1.2B Yergin Report Programs June 1995 Highly Enriched $0.4B Revenues in 1996 Uranium (sale) Total 5-Year Savings $14.1 Billion May 1995 STRATEGIC ALIGNMENT Alignment and downsizing at a glance *Total DOE downsizing:Over the next five years,DOE staff will be reduced by 3,788 employees (27 percent)from our fiscal year 1995 target level of 13,907,resulting in five-year savings of $1 billion.Sixty-seven percent of the to- tal cuts will be accomplished in the first two years.The base level excludes employment of the Power Marketing Administrations (5,227)and the Federal Energy Regulatory Commission (1,463). ¢Headquarters staff downsizing:Headquarters employ- ment will be reduced by approximately 2,340 (34 percent) over the next five years,from a 1995 level of 6,850 (this number includes some staff who are duty-stationed in the field,but are reported as Headquarters personnel.) ¢Field staff reductions:Field office staff will be reduced by 1,450 (21 percent)over the next five years. ¢Field office closings and consolidations:We will close or consolidate 12 DOE field offices around the nation. These include four Energy Efficiency Regional Support Of- fices in San Francisco,New York City,Dallas and Kansas City.In addition,the Denver Support Office will be closed and consolidated with the Golden Field Office.The Fossil Energy Offices in Laramie,Wyo.,and Metairie,La.,will be closed.The Naval Petroleum Reserves offices in Casper, Wyo.,and Bakersfield,Calif.,will be closed with the priva- tization of the Reserves.Offices in Houston and Dallas, which support the DOE Office of General Counsel,will be closed,as will a one-person policy office in Paris,France. ¢Overhead cost reductions;Overhead costs will be cut through many initiatives: -Travel costs will be cut by $175 million over five years,from a current base of $400 million annually (75 percent of which is contractor travel) -More than $75 million in revenues and reduced overhead will be secured over five years through the sale of excess inventories of precious metals, non-precious metals,and rare gases that were needed during the Cold War for the weapons production complex,but can be sold today -Headquarters offices will be consolidated from 16 to four. ¢Office alignment and restructuring:The department's various energy offices will be restructured into a new energy cluster,with matrixed staffing.We will establish a new Administrative Services Center to provide personnel,procurement and administrative services.Six Headquarters organizations that deal with emergency man- agement will be consolidated into one office.Most pro- grams in DOE will be aligned and downsized to remove redundancies. °Legislative package:Legislation will be submitted to Congress to: -establish the Bonneville Power Administration as a wholly-owned government corporation -privatize the Western Area,Southwestern and Southeastern Power Administrations -privatize the Naval Petroleum and Oil Shale Reserves -separate the Federal Energy Regulatory Commission from DOE. Enactment of these measures will result in $5.3 billion in deficit reduction. ($in thousands) Consolidate Headquarters space Alignment -Headquarters administration Alignment -Headquarters program offices Reduce Headquarters support service contractors Integrate Information Management Reengineer Headquarters Headquarters and Program Total Field offices Total Travel savings Asset sales savings National Environmental Policy Act savings Additional alignment savings Less retraining,outplacement and buyout costs Total alignment savings $Savings Employment Percent FY96-FY2000 Reductions of 1995 Staff 17,981 109,285 377 228,587 761 309,525 200,000 247,910 -1,200 1,113,288 _2,338 84% _502,899 «1,450 21% 1,616,187 3,788 |a 27% 175,000 75,000 20,000 50,000 (165,540) 1,770,647 3,788 27% DOE This Month Cars will race with the sun This summer,solar-powered cars from 40 colleges and universities will compete in North America's largest so- lar car race-Sunrayce 95.The solar cars,which run on electricity pro- duced by solar panels,will race 1,150 miles from Indianapolis,Ind.,to Golden,Colo.,June 20-29.Sunrayce 95 is a biennial intercollegiate competi- tion that showcases the country's bright- est young minds and most innovative solar cars.Teams from the U.S.,Canada, Mexico and Puerto Rico will compete. Sunrayce 95 is more than a race-it's a two-year educational program that challenges the ingenuity and creativity of the country's best science,math and engineering students.Thousands of stu- dents receive valuable hands-on training as they help design and build their solar cars.The race also introduces the public to alternative transportation technologies and renewable energy resources that benefit the environment. Each day,the cars travel a predeter- mined distance,70 to 175 miles.The winner is the car with the lowest cu- a3 See uainiitnnenetmteinemnashentennty The California State University at Fresno team entered this car in Sunrayce 93. mulative time over the nine-day race. The nation's first solar-powered bi- cycle race will be held in conjunction with Sunrayce 95.Cyclists from 60 high schools will compete in the inaugural 50-mile Solar BikeRayce USA on June 19 at the Indianapolis Raceway Park. DOE provides funding for Sunrayce 95 through the Office of Energy Effi- ciency and Renewable Energy's Photo- voltaics Division.The National Renew- able Energy Laboratory in Golden is managing the race for DOE.(Michael Coe,303-275-4085)+ _Events May 8-12 The Strategic Value of Fossil Fuels:Chal- lenges and Responses,Houston,Texas.Some 200 policymakers from 29 countries will ex- amine ways the fossil fuels industry can opti- mize its contribution to sustainable develop- ment policies.(U.S.Energy Association,1620 Eye Street NW,Suite 1000,Washington,D.C., 20006;202-331-0415,fax 202-331-0418) 9-10 Industrial waste program review,Oak Brook,Ill.Sponsored by DOE.(Bill Schertz, Argonne National Laboratory,9700 South Cass Ave.,Argonne,IL 60439) 10-12 Emergency services personnel:re- sponding to radiation accidents,Oak Ridge. Sponsored by ORISE.Joseph Kilpatrick,RN, EMT-P,Radiation Emergency Assistance Cen- ter/Training Site,P.O.Box 117,Oak Ridge, TN 37831-0117,615-576-3086;fax 615-576-9522) June 27-29 Advanced coal-fired power systems '95, Morgantown Energy Technology Center, Morgantown,W.Va.(Conference Services, METC,P.O.Box 880,MS-K0O7,Morgantown, WV 26507-0880,304-285-4108) 27-30 Records management conference,Al- buquerque,N.M.Sponsored by DOE. (Margarita Sexson,Albuquerque Operations Office,PAB/IMD,P.O.Box 5400,Albuquer- que,NM 87125-5400,505-845-4826;fax 505-845-4793) 28-30 7th national demand-side management conference:delivering customer value,Dal- las,Texas.Sponsored by EPRI,DOE,Edison Electric Inst.(Electric Power Research Insti- tute,Ms.P.Turner,P.O.Box 10412,3412 Hillview Ave.,Palo Alto,CA 94304;fax 415-855-2041) July 15-20 SOLAR '95 conference,"10,000 solu- tions:paths to a renewable future,”Minne- apolis,Minn.The year's largest national solar energy conference emphasizes cost-effective applications that can improve the nation's economy.Co-sponsored by DOE.(American Solar Energy Society,2400 Central Ave.,G-1, Boulder,CO 80301,303-443-3130;fax 303-443-3212) August 13-18 ER 95 (Environmental Remediation Conference),committed to results,Denver, Colo.Sponsored by DOE.Workshops,oral and poster sessions,tours of Rocky Flats. (Environmental Resources Specialist,Inc., P.O.Box 440112,Aurora,CO 80044, 303-690-4245) October 3-6 1995 DOE Technical Standards Program Workshop,St.Louis,Mo.Sponsored by DOE,EH-31.Theme:"The strategic stan- dardization initiative-a technology ex- change and global competitiveness chal- lenge for DOE.”Workshop goal is to in- form the DOE technical standards commu- nity of strategic standardization activities taking place within DOE and in other gov- ernment agencies,standards developing or- ganizations,and industry.(Becky Harrell, ORNL,615-574-0396) November 13-15 7th annual sustainable transportation and solar and electric vehicle symposium and trade show,Providence,R.I.Largest annual electric vehicle conference in the world,attracts 1,000 attendees a year.Spon- sored by DOE,Mass.Dept.of Transporta- tion,Federal Highway Admin,others. (NESEA,50 Miles St.,Greenfield,MA 01301, 413-774-6051) May 1995 17 Teamwork nets more than $42 million savings They said it couldn't be done. Thanks to continued support from DOE Headquarters,and diligence of the Operations offices throughout the complex,DOE has saved more than $42 million. That was the estimated cost to imple- ment the 10CFR830.120 rule on Quality Assurance for nuclear facilities before the teamwork approach was in place. The Labs that were subject to this first DOE rule estimated that it couldn't be done without additional funding. Defense Programs and Environmental Management Operations approached the task with equal skepticism.But in the process of negotiation,technical representatives,program reviewers and contractors learned the implica- tions of this and upcoming rules,and worked together for the best solution. Mary Haughey,EH-31,put the whole process in perspective."The Quality Assurance Rule contained the earliest due date for a nuclear safety implementation plan.The individuals responsible for writing,reviewing and approving plans had to begin their ef- forts while the guidance was still being finalized.The lessons learned from their efforts will help make the process better for those following in their footsteps.” "This was a very positive lesson,”said Howard Wilchins,EH.Wilchins gave the legal perspective on the rules and orders at a DOE lessons learned workshop in Las Vegas in March."The DOE complex, which uniformly claimed this couldn't be accomplished,had to admit its own lessons learned.It was done with effec- tive communication.Hey,we can do it. It's not an impossible task.It will make us all better managers and ensure nuclear safety in our complex.” At the conference,at least eight of the Operations offices presented their challenges and successes.Common threads were:the need for earlier training,clarification of what is manda- tory and what isn't,establishing one point of contact at Headquarters,and how to budget for this process. Representatives from the national labs shared that this was truly a collabo- rative effort.Due to the short timeframe, no single group could complete its plan without the help and cooperation of the other groups.The Labs said they want DOE to communicate agreed-upon ex- pectations early and more often to their contractor counterparts. "I think that this is the first time we pulled together a successful quality team with the capability to review-under re- lentless pressure-these nuclear safety quality assurance plans for the complex,” said Larry Vaughan,EM-20."I dreaded and enjoyed every minute of it.” Wilchins requested that the lessons learned be applied to all subsequent rules."People have to talk to each other.”(Paul Chimah,DP,301-903-4788, Matt Cole,ER,301-903-8388,Carl Klee, NE,301-903-2964,or Larry Vaughan, 202-586-2523) QualityCORNERTravelerscannow get cash from ATMs DOE Headquarters travelers can now obtain cash advances 24 hours a day,seven days a week,at participat- ing automated teller machines nation- wide,announced the Office of the Chief Financial Officer.This new fea- ture of the travel charge-card contract offers travelers a readily available source of cash for official travel ex- penses.The cash is charged directly to the individual's charge card,eliminat- ing the need to go to the cashier for an advance.American Express is notify- ing all cardholders of the new ATM ser- vice.AMEX will also be assigning per- sonal identification numbers (PINs), with instructions on how to change or personalize the number if necessary.¢& Travel the quality way In a continuous effort to improve the efficiency and timeliness of process- ing local travel claims,the Office of Congressional and Intergovernmental Affairs is the first office at Headquarters to participate in issuing third-party drafts.The checks provide reimbursement to staff immediately for their local travel expenses and can be deposited in your bank.If you are a member of the EFCU,the check can be cashed without a hold. Drema Copeland issued the first check to William Tucker (left)on Feb.9. She was assisted by Robert Goodfellow and Rossana Ballatine,Office of Head- quarters Accounting Operations Travel Audit Section,who provided training. This service will soon be available to other offices within the department. 16 DOE This Month Answers to your questions Why are we doing this? Strategic Alignment is the next step in a process we began two years ago to reshape the Department of Energy to better accomplish its missions and to use taxpayer money more wisely.The Strategic Alignment step began last summer,and is the logical outcome of our prior strategic planning and quality management efforts.These actions will allow us to meet our goals of working more effectively and efficiently. Because we began this effort two years ago,today we have a better way than the recent proposals being floated in Con- gress to equip DOE to perform our vital national missions and cut unnecessary costs. Who made the decisions announced May 3? The Secretary of Energy made the final decisions.She was assisted by the recommendations of a special employee align- ment team,Deputy Secretary Bill White,the assistant secre- taries and outside experts. Who supports this? The effort to improve the department has involved a wide range of individuals,study groups and employees.It may not be perfect but it's the outcome of a tremendous amount of time and effort from a multitude of interested people.And,as with any quality product,it is not static but open to alteration from constructive and persuasive suggestions. Is this supposed to save DOE? It's supposed to enable DOE to accomplish its critical na- tional missions better and at less cost.We began this effort two years before the recent proposals to dismantle DOE and this is a better way:a reasoned,thoughtful approach which is part of an overall strategic plan to better serve the American people.Performing better and more efficiently is the object, not "saving DOE.” Will headquarters employees be moved to field jobs? Yes,some will.To the greatest extent possible,program execution needs to occur in the field.Headquarters person- nel should be responsible for establishing policy,developing metrics and allocating resources.Therefore,some programs will see program execution jobs move to the field. Are most DOE activities being centralized? Whether functions should be centralized or decentralized was decided on a case-by-case basis.For example,business, training and administrative services will be centralized in a new Office of Headquarters Operations and Services rather than be located in program offices.On the other hand,profes- sionals from the Offices of Chief Financial Officer and General Counsel will be co-located with the programs they serve. What is the staying power of the recommendations? As long as they continue to improve the way we do business.Career employees have been intricately involved in developing the recommendations and will be involved in their implementation in order to make this a long-haul im- provement that will last through political changes of admin- istration. DOE workforce Total employees 20,649 Aligned Employees 10,171 (49%) FERG "ndependence1,463 (7%) When does implementation begin?When will it be over? This is the latest chapter of the strategic planning and quality process we began two years ago.Some alignment decisions have now been made;others await further detailed analysis. Many of the changes will occur within the next 12 months, while others will be phased in over five years beginning in fiscal year 1996. How will we learn about implementation? DOE managers have been charged with keeping their em- ployees fully informed of changes within their offices.In addi- tion,DOE This Month and the DOE Homepage on Intemet will carry regular information about implementation progress. What about the Energy Technology Centers? Management and administrative functions at Morgantown and Pittsburgh will be consolidated for a reduction of 90 positions. Further decisions concerning consolidation and cost savings at Morgantown,Pittsburgh and Bartlesville will be made this year. Will everyone in DOE compete for the jobs they now hold? A number of staffing options are being considered.One focuses on selecting the individuals best qualified to staff the new DOE based on performance expectations and competencies tied to the department's Strategic Plan.Under this approach,job skills and competencies are identified for each position and employees would be assessed against these requirements.This approach could be used to help achieve the objectives of the alignment and other initiatives, and to address skills-mix issues. How will DOE seek additional "buyouts?” New legislation authorizing DOE to offer buyouts would require support from the Office of Personnel Management and the Office of Management and Budget prior to being See ANSWERS page 6. May 1995 STRATEGIC ALIGNMENT Teamwork led to alignment packagenDecember1994,40 career employees from throughout DOE were selected to work full-time on the Strategic Alignment Initiative.Under the direction of Deputy Secre- tary Bill White,this team received training in how the pri- vate sector has implemented successful restructuring efforts. During the subsequent four months,the Strategic Align- ment Team conducted interviews and surveys aimed at ex- amining how DOE conducts its business and ways in which DOE can secure better performance at lower cost. This process provided the team with essential input to the Alignment and Downsizing package.Out of 39 recom- mendations that were presented,24 were adopted in whole or in part,and 13 will receive further consideration during the implementation process. Two recommendations were rejected.One was to privatize isotope production,and another was to further re- duce expenditures of the Environmental Management pro- gram by $300 million to $500 million annually. The package also is derived from other analytical work aimed at helping deliver on DOE's commitment of $14.1 billion in deficit reduction over the next five years. Implementation Team formed To ensure that alignment and downsizing actions are completed in a timely fashion,an Alignment and Downsizing Implementation Team has been established, chaired by Don Pearman,associate deputy secretary for Field Management.This team includes several members of the Strategic Alignment Team,as well as representatives from DOE offices. "We know DOE can operate more efficiently,”said Sec- retary Hazel O'Leary."We also know how difficult change can be.Our implementation team will ensure quick The Strategic Alignment Team worked full-time for four months to refocus DOE on its core missions. progress and that workforce reductions are handled with sensitivity.Reductions in force will be our last choice.” The Implementation Team will be responsible for: ©reviewing,coordinating and monitoring detailed imple- mentation plans which will be developed by affected orga- nizations within the department e developing an implementation plan for the FTE alloca- tions for each department office that will be required to meet downsizing targets e identifying major DOE policy and administrative pro- cesses which should be reengineered for the purpose of enhancing performance,cutting costs and achieving the FTE reduction commitments e providing further analysis of opportunities for alignment and downsizing of the department,including additional ex- amination of issues identified by the Strategic Alignment Team. e providing regular progress reports to the Secretary of Energy on all alignment and downsizing commitments.+ Answers (Continued from page 5.) introduced in Congress as proposed legislation.Neither of these institutions currently favors sponsoring further buyout authority for federal agencies.DOE does currently have early retirement authority through FY95 and is requesting an extension through FY96. What rules will apply to Reductions In Force? If reductions are necessary and cannot be achieved through voluntary actions within the implementation timeframe,RIF laws and regulations would be followed to identify placements in remaining DOE positions.The Office of Personnel Managment RIF regulations are derived from the Veterans'Preference Act of 1944 and use the following four factors in releasing employees:type of appointment,veterans preference,length of service and performance ratings. What can I do to protect myself? Stay in touch with your supervisor and personnel expert. A special Implementation Team has been formed to work out the personnel details of this effort (see above.) How do I survive?Succeed? By doing your job well.Each of us has a personal respon- sibility to continually grow and improve in our jobs.Like- wise,our organization must live by the laws of employment as provided by Congress. Will I have to relocate? It's too early to tell for specific jobs.The possibility exists that some people may be asked to move to different jobs as we match skills to locations where they are needed. Will I be retrained for a new job? It's possible.Retraining will be one of the tools used to best match skills with positions.It's too early to tell which specific employees will need retraining. Will DOE offer outplacement?Counseling? Yes.The department will offer the full range of personnel services to those who need them. DOE This Month Secretary Hazel O'Leary has begun to sweep back the veil of secrecy that has shrouded the nuclear weap- ons complex from World War II through the Cold War. To help advance this vital obligation to openness,and to put a human face on the extraordinary work being done to deal with the environmental problems,the de- partment has published Closing the Circle on the Split- ting of the Atom. In plain language and chock-full of photographs taken at the facilities,the 106-page book conveys the scale,complexity and reality of the challenge.Technical topics are presented simply for a broad audience. As Assistant Secretary Tom Grumbly states in his in- troduction,"Where and how will we treat and dispose of the backlog of wastes from nuclear weapons produc- tion?How clean is clean?To foster a sustained and in- formed public debate on these and other critical ques- tions,we created this book.” Authors are Jim Werner,director of EM Strategic Planning and Analysis;Jenny Craig,presidential man- agement intern;and Seattle freelance writer Peter Gray. Many of the photos are by internationally renowned photographer Robert Del Tredici.For a free copy,call Book portrays U.S.cleanup challenge Aboveisa glovebox att Hantord's Plutonium Finishing Plant in 1993.Safety procedures require plutonium workers to wear anticontamination clothing and to handle plutonium1-800-736-3282.through rubber gloves attached to the wall of the box. DOE grantee receives EPA Greenlights award One federal agency recognized the accomplishments of another on April 10,when the Environmental Protection Agency awarded its Greenlights "Gov- ernment Partner of the Year”Award to the Santa Cruz Valley Union High School District of Eloy,Ariz. Santa Cruz Valley received the EPA award for successfully completing a DOE Institutional Conservation Pro- gram lighting-efficiency project.DOE provided Santa Cruz Valley with $102,840. Santa Cruz Valley is now a national model in energy efficiency for rural districts.The school district installed energy-efficient electronic ballasts and lamps in their fluorescent light fixtures, resulting in a an annual $25,000 sav- ings,which will go toward the district's education programs. Since 1979,ICP has awarded 26,300 grants covering 23 percent of the nation's 114,000 eligible school and hos- pital buildings.The total ICP effort has resulted in the retrofit of 69,000 build- ings and the creation of 38,000 jobs. _Publications |Tromorrow's Energy Begins atHome: A Step-by-Step Guide for Developing and Delivering Consumer Energy Ef- ficiency Education is for organizations interested in providing individuals with information about how to conserve en- ergy in their homes.Developed under a USDOE grant,it is available from the Washington Dept.of Community,Trade and Economic Development,Housing Services,P.O.Box 48300,Olympia,WA 98504-8300.Cost is $11.Call Brooke Wickham,360-586-5574. Longwall Mining (March 1995).Available from the U.S.Government Printing Office or the Energy Information 'Administration's National Energy Information Center,Room 1F-048,Forrestal Building,Washington, D.C.,20585,202-586-8800. USDOE Office of Inspector General reports on Inspection of an Intelligence Work- for-Others Project at the Idaho Opera- tions Office (March)DOE/IG-0367;Audit of the Richland Operations Office Site Characterization Program (March)DOE/ 1G-0368;Inspection of Los Alamos Na- tional Laboratory's Systemfor Control- ling Cost Overruns on Work-for-Others Projects (March)DOE/IG-0369;and Audit of Staffing Requirements for the Strate- gic Petroleum Reserve (March)DOE/IG- 0370.Available from Office of Scientific and Technical Information,P.O.Box 62,Oak Ridge,TN 37831. Global Change Research:Summaries of Research in FY 1994 (April)DOE/ ER-0641T.Available from Office of Scien- tific and Technical Information,P.O.Box 62,Oak Ridge,TN 37831. Commercial Buildings Energy Consump- tion and Expenditures 1992 (April)DOE/ EIA-0318(92);Petroleum Supply Montbly, March 1995 with Data forJanuary 1995, DOE/EIA-0109(95/3);Natural Gas Montbly (March)DOE/EIA-0130(95/03).U.S.Govern- ment Printing Office,PO.Box 371954,Pitts- burgh,PA 15250-7954;202-512-1800,fax 202-512-2250. May 1995 15 Ground broken on new Earth Day Parkin D.C.When Earth Day was first cel- ebrated 25 years ago,the radio played a song about paving paradise and put- ting up a parking lot.On April 20,Sec- retary Hazel O'Leary and school chil- dren from Shepherd Park Elementary did the opposite,as they broke ground for a new Washington,D.C.,park to celebrate Earth Day '95. The park,near the Mall at Ninth Street and Independence Avenue, S.W.,will showcase sustainable land- scaping and solar energy. Earth Day Park is a joint effort of DOE,the Department of Transportation, the General Services Administration and the District of Columbia. "This week,the president signed legislation to support the city's future,” O'Leary said."This groundbreaking is a symbol of our confidence and pride in the nation's capital.And we plan more partnerships in the future. "The park also represents a commit- ment to the environment.At DOE,Earth Day is every day.We act on global is- sues,like energy efficiency,waste Secretary O'Leary (right)watches as Cherylynne Williams,deputy director of the Engineering and Facilities Division of Human Resources (left),joins students from Shepherd Park Elementary School and Thurman Davis,regional administrator of the General Services Administration,in breaking ground for a new D.C.park. cleanup and global warming.We also act locally.Turning the empty plot of land next to our headquarters into an ur- ban park meansa lot more than beauti-fication.It's about our relationship with the Earth and each other.” The park features drought-resistant native plants to reduce the need for fertilizer,pesticide and irrigation-driv- ing down costs. DOE will maintain the landscaping and provide technical expertise for so-lar lighting.The effort was approved by the National Capital Planning Com- mission. DOE's support is an extension of the Land Use Initiative announced in December.Construction will begin in June and end in September. higher ground. Energy high for post-flood reconstruction Christine Ervin,assistant secretary of Energy Efficiency and Renewable Energy,visited Pattonsburg,Mo.,on Earth Day April 22 to praise the com- munity for its pioneering work in sustainable development. Pattonsburg,a town of 250 near the Grand River,was devastated by the midwest flooding in 1993.It has suffered 30 floods in the past century. Pattonsburg is scheduled to receive about $11.5 million in federal disas- ter relief.The community plans to evacuate the floodplain and rebuild on Last year,in partnership with the Federal Emergency Management Agency,Ervin's office provided funds for a team of national experts to help Pattonsburg design one of the nation's first "sustainable communities”'- town that will stress energy efficiency,renewable energy and environmen- tally benign design."Pattonsburg is creating a new model for community development-one in which economic growth and environmental health go hand in hand,”Ervin said. Labs get down to Earth with special events Across the country,DOE's national laboratories also hostedEarthDaycelebrations. At Lawrence Livermore and Sandia National Laboratories April 20,more than 40 exhibitors assembled for the Earth Expo'95 celebration on "Pollution Prevention:Reduce,Reuse,Re- cycle.”Expo visitors learned how the labs are working to pre- serve and protect the environment,and how citizens can do the same.Visitors also toured Lawrence Livermore. All of April was considered "Earth Month”at Lawrence Berke- ley Laboratory,with tours,lectures (such as "Bat Conservation'), poster contests,an "Eco-Fair”and a three-day Environmental Spirit Conference at the University of California,Berkeley. The National Renewable Energy Laboratory offered spe- cial tours of renewable energy industries throughout the week topped by an open house April 22 which featured solar-powered music and sun-baked cookies. 14 DOE This Month Energy,Education seek to place America first The Department of Energy and the Department of Education have a new joint mission:to create science educa- tion that will place America "first in the world of math and science”and give the United States a competitive edge in the global marketplace of the future. On May 1,Energy Secretary Hazel O'Leary and Education Secretary Rich- ard Riley signed a historic compact which teams their departments' world-class laboratory systems. "I strongly believe that this combina- tion of expertise between the Department of Energy's Nobel Prize-winning scientists and the Education Department's unique resource for translating complex research into classroom practice demonstrates the vital role government can and must play as a partner with the American people to Science bowl winners announced After two days of fierce competition,the four top high school teams com- peting in the DOE National Science Bowl were selected from a field of 55 teams.In all,300 students competed.Van Nuys (Calif.)High School won the championship.The team was sponsored by the Los Angeles Department of Water and Power.Second place went to Taylor Allderdice High School (Pitts- burgh,Pa.)sponsored by the Pittsburgh Energy Technology Center.Mira Loma High School (Sacramento,Calif.),sponsored by Western Area Power Adminis- tration,took third.Armand Hammer World College (Montezuma,N.M),spon- sored by Sandia National Laboratories,captured fourth place. Each team of four students and one alternate will receive international and domestic scientific research excursions to work hands-on with labora- tory and field scientists in Alaska,Hawaii,New Mexico and Australia. Energy Secretary Hazel O'Leary told the science bowl competitors,"In many ways,this fifth National Science Bowl competition is preparing you for the great race of the 21st century:competing-and winning-in a global economy.The fact is,America's ability to compete is directly dependent upon our effort to attain and sustain preeminence in math and science.” meet the challenges of the future,”Secre- tary O'Leary said.Three hundred students nology training,the two national labora- tory systems,working in tandem,will identify best practices and apply state-of-the-art technology to the teach- competing in the National Science Bowl witnessed the signing. "As we invest in education and tech- ing of K through 12 science in our nation's rural and urban schools,”she said."In that way,we will maximize the public and private investment.”* NREL receives national Small Business Eisenhower award The National Renewable Energy Laboratory was awarded the Dwight D.Eisenhower Award for Excellence, the national award given annually by the U.S.Small Business Administration. The award was presented to NREL on May 4 during Small Business Week activities in Washington,D.C. ognizes large federal prime contractors that excel in guiding entrepreneurs of Steering the course for change "Changes in our country's political agendas and major re- tooling of the Department of Energy are necessitating unprec- edented change for the missions and people of INEL.The only constant in life is change.We can choose to have change carry us along like a flooding river,or we can stick our oars in the water and steer our own course.The INEL Institute of- fers employees the opportunity to drop the oars in the water.” -Frances Grant,director,Idaho National Engineering Laboratory Institute,a source for education and training, organization development,continuous improvement initiatives and management consulting. diverse backgrounds through the com- plexities of government procurement.In |committed to the success of small busi- 1994,NREL awarded more than $85.5 million in purchases and subcontracts to small companies-about 77 percent of its total procurements.Of this amount, 25 percent went to businesses owned by |performance to assure mutual suc- women or minorities.NREL also was Each year,the Eisenhower award rec-named 1994 Corporation of the Year by Minority Enterprises,Inc. "This award is a credit to the many balRostrum - outstanding NREL employees who are nesses,”NREL Director Charles Gay said. "Linking with small businesses is only half the job.The other part is supporting these firms during contract cess,”said Ed Green,manager of pro- curement and small-business liaison. NREL also has spawned 27 spin-off companies.# Helping utilities reduce costs,pollution "The ongoing competitive restructuring of the utility in- dustry has raised concerns that demand-side management programs might be diminished.Demand-side management programs are basic to the economic and environmental benefits of the nation.If consumers use less electricity,it costs them less.If utilities do not have to build more power plants,it costs them less and reduces the potential pollu- tion.I'm particularly pleased that this (IRS revision)will also help our utility partners reduce emission pollutions and continue making their major voluntary reductions in greenhouse gas emissions.” -Secretary Hazel O'Leary,on the Internal Revenue Service revision which allows utilities to deduct efficiency expenditures as ordinary business expenses. May 1995 5 Report puts cleanup costs at $230 billion Cleanup is projected to cost $230 billion and take 75 years. This is the mid-range estimate de- scribed in a report released by Envi- ronmental Management in April."Esti- mating the Cold War Mortgage:the 1995 Baseline Environmental Manage- ment Report”describes the activities and potential costs required to address the waste,contamination,and surplus nuclear facilities that are the responsi- bility of DOE's Environmental Manage- ment program. The report was mandated by the National Defense Authorization Act of 1994,and is the first annual report of its kind.Future baseline reports will change as a result of national and local debate involving the citizens whose lives these decisions will affect,states the report. "What does the nation want to buy? That is the question posed by this analysis,”said Tom Grumbly,assistant secretary for Environmental Manage- ment."What we found was that the fu- ture use of the land and facilities will largely determine if the cost is higher or lower,”Grumbly said."This esti- mate is a reasonable projection given current technologies to stabilize-not completely scrub sites to 'green fields' status,which is not technically feasible in many cases.” Cleaning sites to "green fields” would cost an estimated $500 billion. At the other end of the spectrum is a minimal "iron-fence”cleanup option for $175 billion,where existing con- tamination would be contained in Total $230 billion Alaska -<1% *71%of these costs include technology development costs and program direction costs that will be distributed across environmental management sites. Percent of estimated cost by state Maryland and D.C.-13.07%* place with public access restricted. The $230 billion mid-range estimate assumes significant productivity in- creases,meeting current compliance agreements,and use of existing tech- nologies.The states of Washington, South Carolina,Tennessee,Colorado and Idaho account for $170 billion,or 71 percent,of the estimate.Washing- ton and South Carolina together ac- count for $97 billion,or 42 percent. The most costly sites are the Han- ford Site (Wash.),the Savannah River Site (S.C.),the Rocky Flats Environ- mental Technology Site (Colo.),the K-25 Site,the Y-12 Plant,and the Oak Ridge National Laboratory (Tenn.),and the Idaho National Engineering Labo- ratory. "We want public input into deci- sions on how land will be used at Hanford,where waste from Rocky Flats will be disposed,and how to manage spent nuclear fuel at Idaho, Savannah River and other sites,”said Grumbly."The American people,using technical expertise from this depart- ment and these tools for guidance,can help us make these choices.” For more information,call the Cen- ter for Environmental Management In- formation at 1-800-736-3282. Education. Used,surplus computers,printers,mo- dems,monitors,tools and appliances as well as furniture and supplies amounting to nearly $6 million found their way into classrooms and throughout the San Fran- cisco Bay area and Central Valley last year. Lawrence Livermore National Laboratory's Donation Program provides surplus equipment to schools and some nonprofit organizations. + Idaho high-school students and teach- ers designed and built toy-size operating models of sophisticated remotely-operated buried waste technologies for Idaho Na- tional Engineering Laboratory.With a few ready-made parts,some photos and a lot of trial and error,students created real- istic replicas in just three weeks. The project was funded by INEL's Bur- ied Waste Technology Development pro- gram so it could display interactive repli- cas of the technologies at various trade and technology marketing conventions. > More than 60 students from minority educational institutions nationwide will de- scend on DOE headquarters and field of- fices this June to begin 10 weeks of chal- lenging and rewarding work and experi- ences. These internships are part of the De- partment of Energy efforts to extend and strengthen relationships between DOE and the minority community through institu- tions and universities offering energy- related academic programs. This year,partnerships have been es- tablished through the Hispanic Association of Colleges and Universities,the National Association for Equal Opportunity in Higher Education and the American Indian Science and Engineering Society. 8 DOE This Month Research Digest (Continued from page 12.) of nuclear material and equipment. (Craig Savoye,510-422-9919) > A laser procedure that breaks up arterial blood clots in as few as 90 seconds is being perfected by Los Alamos scientists and Oregon medical researchers. The procedure,laser thrombolysis, could become a practical complement to invasive treatments such as open- heart surgery,balloon angioplasty and clot-busting drugs.According to re- searchers,it may help as many as 100,000 patients a year. Under a cooperative research and development agreement,Los Alamos researchers are developing computer simulations so Dr.Kenton Gregory of the Oregon Medical Laser Center and his team can better understand the in- teraction between laser energy and blood clots.Jim Danneskiod, 505-667-1640) Me" Five DOE national laboratories have formed a consortium to pursue the idea that plants,corn,grain and even wood may be sources of im- portant industrial chemicals.If they prove it true,petroleum now con- sumed in chemical production could be freed up for fuel and other energy uses. Working with industrial partners and through the Alternative Feedstocks Pro- gram,the labs are investigating pro- cesses for making industrial chemicals from agricultural and forestry feedstocks. The consortium members are Idaho National Engineering Laboratory,the National Renewable Energy Labora- tory,the national laboratories at Oak lasting compounds. Juan,615-576-0887) Children's fingerprints don't last long Michelle Buchanan,an Oak Ridge National Laboratory researcher,works with Art Bohanan of the Knoxville Police Department to determine why children's fingerprints disappear from surfaces much more quickly than adults'.The research has found that children's fingerprints contain more volatile chemicals,such as fatty acids,while adult prints display longer- Buchanan used gas chromatography and mass spectrometry,which to- gether provide a very sensitive method of analyzing and identifying chemi- cals.Knowing the gradual chemical differences between children's and adults'fingerprints may lead to a test that will help law enforcement agents secure juvenile suspects'fingerprints for longer periods of time.(Frank Ridge and Argonne,and Pacific North- west Laboratory.John Walsh, 208-526-8646) + EG&G Energy Measurements scien- tists at the Special Technologies Labo- ratory who are developing associated particle imaging technology for waste management programs have expanded the system so it can be used to en- hance underground oil reserves,detect and map uranium hidden in pipes, and possibly even aid in aging studies. Associated particle imaging can create three-dimensional images of unknown materials and analyze their contents even if they are encased in steel or hidden in the human body. (Lisa Story,702-295-5791) The use of more efficient lighting and improved heating and cooling sys- tems could significantly reduce the energy required for the nation's commercial buildings,according to a new study completed by Oak Ridge National Laboratory.A team of ORNL researchers-Howard McLain,S.B. Leigh and Mike MacDonald,all of the Existing Buildings Research Program in the Buildings Technology Center of ORNL's Energy Division-have studied a large office building in Washington,D.C. Using detailed measurements of en- ergy data and a computer program, they analyzed the all-electric United Unions building before and after en- ergy conservation measures,including modification and replacement of light fixtures,and improvements to a heat- ing,ventilating and air-conditioning system.(Frank Juan,615-576-0887) a Chemists with the Lawrence Berke- ley Laboratory and the University of California at Berkeley have produced the first three-dimensional image of an RNA structure that plays a vital role in enabling retroviruses to repli- cate within cells. When a retrovirus,such as HIV,in- vades a cell,it synthesizes three en- zymes that enable it to transform the host cell into a virus replication fac- tory.By revealing an area on the RNA that may serve as the site where key host proteins interact,researchers say designing drugs that bind at this site and block these interactions may be possible.(Lynn Yarris,510-486-5375) May 1995 13 PIR ORCCeINS>en fe sn_Research © _Digest ae The American consumer has saved billions of dollars as a result of energy efficiency technologies de- veloped from DOE research,according to Secretary Hazel O'Leary.The same is true for U.S.industry. "Success Stories:the Energy Mission in the Marketplace”is a 22-page cata- logue of R&D breakthroughs and their market status.It offers a factual re- sponse to questions about whether these R&D programs have had a sig- nificant impact on the energy field or the U.S.economy. "These technologies are successful and they are out there today helping us accomplish our mission,”said O'Leary,"saving energy,finding en- ergy,producing energy,and reducing pollution.These technologies are cre- ating billions of dollars of gross sales, taxable income from high-wage U.S. jobs,and productivity savings.” These R&D successes show the large and positive impacts that DOE's applied R&D programs have had on the U.S.economy,particularly through energy efficiency in areas such as operation of appliances in buildings and homes,generating electricity,oil and gas exploration, transportation and manufacturing.For copies,contact Kim Harley,Office of Science Policy,PO-81,Department of Energy,Washington,D.C.20585, 202-586-3900. + Because smaller is better in the world of microelectronics,the ongoing challenge in the semiconductor indus- try is to be able to pack more memory in less space.As part of the National Lithography Program,Sandia and AT&T Bell Laboratories have devel- oped a new laboratory research tool that can print integrated circuit fea- tures one-thousandth the width of a human hair,about 0.1 micron.This is one-fifth the size of circuit features currently found in mass-produced computer chips. The new lithography tool is based on short wavelengths of light called Laser researc Sandia National Laboratories researchers Kevin Lear,left,and Richard Schneider check records of experiments using a vertical-cavity surface emit- ting laser (VCSEL).A revolutionary advance in these lasers has demon- strated a record 53 percent electrical-to-optical power conversion efficiency. VCSELs,the next generation of semiconductor laser diodes,are expected to make possible the high-speed,high-density optical data links of the fu- ture that should make laser-using electronic products less expensive and more compact.In addition to uses in computers and fiber optic communica- tions for both national defense and consumer applications,the Sandia VCSEL research also could lead to improvements in laser printing and scan- ning as well as applications ranging from chemical detection to image pro- cessing.(Ace Etheridge,505-844-7767) "extreme”ultraviolet.Features are im- printed on a chip similar to the way a photograph is printed on paper.Julie Clausen,505-844-0948) + Pacific Northwest Laboratory has cre- ated visualization tools to help informa- tion analysts evaluate the massive amount of information they review. By applying the visualization tools to large sets of documents,information analysts can quickly see a picture of the content similarities and themes without having to read unneces- sary text. Although the technology was devel- oped for the intelligence community,it can be used by others who analyze large amounts of information including lawyers reading previous cases,doctors reading patients'histories and regulators reading environmental procedures. (Kevin Whattam,509-375-3617) + A team of engineers from Lawrence Livermore is providing two mobile cutting systems designed to enable safe access to warheads and other nuclear material in the event of an ac- cident on the way to dismantlement sites. The cutter's liquid abrasive jet uses a mix of highly pressurized water and finely ground garnet to make high-precision cuts in any material in minutes.The system would be used primarily for cutting into the fuselage of a downed aircraft or the trailer of an overturned truck without creating heat or sparks,enabling quick retrieval See RESEARCH DIGEST page 13. 12 DOE This Month Survey shows DOE gaining in public trust A survey conducted in the last quarter of 1994 by Washington State University shows that DOE efforts to decrease secrecy and increase public participation are paying off in greater trust and confidence among the people who deal most frequently with the agency. The university conducted the first trust and confidence survey in 1992 at the request of DOE.The attitudes of stakeholders toward DOE showed improvements in all categories in the new survey. Trained interviewers from the university's Social and Economic Re- search Center conducted the tele- phone surveys. The more than 300 surveyed stakeholders-those with a stake in DOE's defense programs,radioactive waste and environmental cleanup ment over 1992. handedly,an 8%increase over 1992. department could. missions-included state and local governments,hospitals and universi- ties,industry and environmental groups,and labor unions. "These measurements of our progress are encouraging and vali- date the time and effort we've put into building partnerships with our customers,”said Secretary Hazel O'Leary."What is clear,however,is 1994 survey result highlights: *63%agree DOE provides all relevant unclassified information to the public, an increase of 23 percentage points over 1992. *51%agree DOE can be counted on to do the right thing,a 17%improve- *63%agree DOE makes a good faith effort to treat everyone even- *67%agree DOE tries hard to keep promises,a 7%improvement over 1992. *58%believe DOE manages its functions better than some other agency or that we have a long way to go to de- velop the open,honest and produc- tive relationship with the public that we want and need.I don't want any- one in the department thinking this improvement means we can relax. Instead it means we're on the right track,especially with our openness initiative,site advisory boards and public participation efforts.”+ Progress made in solving Hanford's waste tank problems Safety problems at Hanford's under- ground nuclear waste storage tanks have been substantially solved,accord- ing to Tara O'Toole,assistant secretary for Environment,Safety and Health, who testified before the House Appro- priations Subcommittee on Energy and Water Development. Hanford's high-level waste is stored in 177 aging,underground storage tanks,many of which date back to World War II."We managed to de- crease safety problems by 66 percent, and improved the sampling proce- dures of the tanks,”O'Toole said. John Lee of Westinghouse Hanford Company agrees with O'Toole."We haven't solved all of our safety issues yet,but we have come a long way from where we were 18 months ago,”he said."Our top priority is to make sure the tank waste is safe and stable.”Lee heads Westinghouse's tank waste remediation system operations. Six key safety issues were identi- fied,the greatest of which was tank 101-SY,which used to "burp”large volumes of hydrogen gas.A mixer pump installed two years ago has pre- vented the gas buildup. Also under control is the high-heat tank 106-C.The addition of water keeps the waste cool and prevents the heat from damaging the tank. The issue of an uncontrolled chain reaction has also been resolved."We don't believe the fissionable material is concentrated enough in the tanks to cause a chain reaction,”said Lee. "Enough other material absorbs any neutrons that would cause a reaction.” Other concerns:noxious vapors produced by some tanks,most found not harmful to people;the chemical ferrocyanide in some tanks,which could ignite,has been found to be de- graded;and concern over flammable organic chemicals has been resolved in one tank. "We used every means available to gain the data we needed to answer the safety questions and resolve potential problems,”said Lee. Lee said the tanks will always rep- resent a hazard,which won't be elimi- nated until the waste is removed and treated for disposal. But Lee said excellent progress has been made in identifying new ap- proaches to resolve remaining issues. Olympic traffic to be tracked by smart system Plans are under way for develop- ment of a multi-lane traffic monitoring system expected to help with traffic management during the 1996 Summer Olympic Games in Adanta. More than two million visitors are anticipated for the two-week competi- tion. The Office of Economic Impact and Diversity is funding a cooperative re- search and development agreement between Martin Marietta Energy Sys- tems,Inc.,and a minority- owned company,Supercond Technol- ogy,Inc.Together,engineers from Oak Ridge and Supercond are working to develop "smart structures”for intel- ligent highways by integrating fiber- optics into composites and concrete. During the Olympics,sensors will be in the surface materia!of the high- ways and will measure the number of cars,their speed,and the degree of congestion in the area.These measure- ments will be transmitted to a central facility,where traffic can be monitored throughout the city.+ May 1995 Between U.S.and Russia System monitors nuclear materials remotely The Department of Energy,in col- laboration with Russia's Kurchatov In- stitute,has unveiled an experimental system that could provide remote monitoring of each other's weapons- usable nuclear materials.This break- through would improve security and reduce costs-while helping both coun- tries meet non-proliferation objectives. "This is the future,”said Energy Secretary Hazel O'Leary."With this program,the United States and Russia are demonstrating to the world their shared commitment to reduce the glo- bal nuclear danger.” Two laboratories are involved: DOE's Argonne National ° Laboratory-West near Idaho Falls, Idaho,and the Kurchatov Institute,a research facility in Moscow.Storage vaults containing highly enriched ura- nium at each lab have been equipped with sensors and cameras.These sen- sors are triggered when individuals en- ter the vaults and cameras immediately begin filming.The images are re- corded by a computer and are re- trieved on demand via telephone lines Manufacturing Facility Vault can be monitored in Russia. in Russia and the United States. The system has the potential to greatly improve monitoring and verifi- cation of U.S.and Russian nuclear weapons materials while reducing costs.Widespread use of this system would build global confidence by in- creasing openness and irreversibility in the nuclear arms reduction process. "This is another example of our na- tional laboratories contributing to global peace,”said O'Leary."At a time when Congress is debating DOE's existence and the role of U.S.sponsorship of basic and applied research,this is a clear ex- ample of the important role we play.”# White boosts U.S.business interests in Caspian region Deputy Secretary Bill White re- turned to the Caspian region April 14-24 for follow-up talks with govern- ment leaders in this resource-rich area. The 10-day,seven-nation trip included meetings in Kazakhstan,Turkmenistan, Azerbaijan,Georgia,Armenia,Turkey and Russia. All of the countries are part of the Caspian Basin,the world's most prom- ising location for new oil and gas pro- duction in the next century. For the past two years,White has vigorously promoted the participation of U.S.companies in the region's en- ergy market.Last year he traveled to Azerbaijan for the signing of a historic $8 billion oil deal that includes five U.S.companies.He also has made an official visit to Kazakhstan to encour- age mutually beneficial energy projects with that country. During this visit,White discussed policy issues with heads of state and Visit strengthens bonds with Venezuela Earlier in April,Deputy Secretary Bill White traveled to Caracas to meet with government officials and business leaders to discuss trade and invest- ment in Venezuela's energy sector."South America represents a tremendous growth opportunity for U.S.energy companies,”White said."Oil demand there is soaring,and governments in South America are doing all they can to promote development.Our visit seeks to strengthen the bonds of friendship and collaboration between our nations and create new alliances of support for our energy partnerships.”White is at the forefront of helping U.S.energy companies participate more fully in the expanding Latin American market. other high-level government officials. He also met with business leaders to advance trade,investment and private- sector development opportunities for U.S.energy firms. Joining White were U.S.experts on Caspian Basin energy policy and com- mercial energy partnerships.Also ac- companying the delegation was Con- gressman Greg Laughlin of Texas, co-chair of the U.S.-former Soviet Union Energy Caucus. "The Caspian region,with its wealth of natural riches,represents an enormous growth opportunity for U.S. companies,”White said.He said the meetings would strengthen support for new ventures involving U.S.busi- nesses,which in turn will create jobs in America and help ensure the eco- nomic self-sufficiency of Central Asia's new independent states.# 10 DOE This Month Next step in contract reform Rocky Flats contract goes to Kaiser-Hill In the next installment of DOE's Contract Reform Initiative,a $3.5 bil- lion contract was awarded to the Kaiser-Hill Company for cleanup of the Rocky Flats Environmental Tech- nology Site.Kaiser-Hill is a joint ven- ture between two of America's leading environmental management compa- nies--ICF Kaiser and CH2M Hill. Primary focus of the new contractor will be on plutonium stabilization and storage,environmental restoration, waste management,decontamination and decommissioning,and economic conversion,About 6,000 employees work at Rocky Flats,which is near Golden,Colo. "Kaiser-Hill is the happy marriage between two world-class environmen- tal companies,”said Secretary Hazel O'Leary."Working together,we have a great opportunity to make Rocky Flats a model for effective and efficient cleanup of nuclear weapons materials. And they have pledged to save U.S. taxpayers real money-$1.2 billion over five years.” Kaiser-Hill has committed to a performance-based contract,the con- cept for which was developed in DOE's 1994 Contract Reform Initiative. Under this approach 85 percent of the contractor's fees will be based on per- formance,while only 15 percent are fixed. Consistent with the goals of DOE's Environmental Management program, Kaiser-Hill's contract commits the com- pany to dealing with urgent risks first. These include stabilizing plutonium and plutonium residues by 1998 Corigi- nal target was 2002),consolidating plutonium in a single building by 2000 (original target was 2003)and cleaning up and removing all high-risk "hot spot”contamination by 1998 (original target was 2002.) Rocky Flats is the second major competition for a DOE site under the Contract Reform Initiative.The August 1994 award to Lockheed Idaho Tech- nologies Company of the Idaho Na- tional Engineering Laboratory contract was the first new competitively awarded contract to incorporate performance-based features.However, the Rocky Flats contract goes a step further in fully incorporating performance-based features,and in- cludes penalties for non-performance. Kaiser-Hill has several important subcontractors,including Westing- house Electric Corp.,Babcock and Wilcox Co.,Morrison Knudsen Corp., BNFL Inc.,DynCorp,Wackenhut and Quanterra. Kaiser-Hill will replace EG&G Rocky Flats,Inc.,the contractor at the site since January 1990.The transition phase for the new contract began May 1,with Kaiser-Hill to assume control on July 1.+ NEWS BRIEFS WASHINGTON,D.C.-The 1995 Holocaust Remembrance Day Commemoration was held April 24 at the Cohen Auditorium to remember the victims and remind Americans what can happen to civilized people when bigotry,hatred and indifference reign. The event was sponsored by the Secretary's Diversity Council and other agencies.Gus Goldberger,General Counsel's Office attorney and a Holocaust survivor from Nazi-occupied Den- mark,was the cantor.Keynote speaker was Marion Pritchard. As a young woman in German-occupied Holland,Pritchard res- cued 150 Jews and shot a Nazi while protecting several Jewish children.She stressed the importance of kindness for children. Event organizers were Warren Clayman,Steve Frank,Gus Goldberger,Abe Silverstein and Margaret Batchelor-White. LOS ALAMOS,N.M.-Got computer trouble?Rely on the NERD. NERD,or Network Event Recording Device,is a computer moni- toring program developed by Los Alamos National Laboratory which detects inconsistencies in computer systems and can notify users by paging,phone,electronic mail or synthesized speech. NERD monitors and logs all network events as they happen, providing an audit trail of access from modems and remote sites.(Kathy DeLucas,505-665-9201) KANSAS CITY,Mo.-The Kansas City Plant will soon join an elite fraternity of manufacturers registered with an international quality standard.On April 21,the plant was the first DOE site officially recommended to be ISO 9001 certified,which involves comprehensive grading for management systems,job perfor- mance,work processes and training records.joe Whited, 816-997-7392) WASHINGTON,D.C.-The environmental impacts of a pro- posed U.S.policy for managing spent nuclear fuel from foreign research reactors are discussed in a draft report issued by DOE and the State Department.Many foreign research reactors use « nuclear fuel containing highly enriched uranium or are storing spent fuel containing uranium.The uranium could be extracted and used in nuclear weapons.The policy seeks to remove as much U.S.-origin highly enriched uranium as possible from international commerce and give the research reactors time to convert to non-weapons grade, low-enriched uranium.Jayne Brady,202-586-5806) WASHINGTON,D.C.-In April,DOE participated in a forum in Bucharest,Romania,that will provide greater opportunities for U.S. and international investment in the electric power sectors in Eastern Europe and the countries of the former Soviet Union.Sixty represen- tatives from U.S.companies joined 120 policymakers from the elec- tricity sectors of 15 countries at the third annual conference."America's role in this conference demonstrates our support for the political and economic reforms that have made it possible to increase trade and investment opportunities in the region,”said Jessie Harris,deputy assistant secretary for Science and Technology Policy.(Amber Jones, 202-586-5806) GOLDEN,Colo.-DOE has authorized Rocky Flats to return to full and normal thermal stabilization activities following the successful completion of a lengthy safety program upgrade and review.Ther- mal stabilization reduces the risks of plutonium by changing it to an inert,non-reactive form better suited to long-term storage and trans- portation."We now have proven that we can conduct these opera- tions safely and in accordance with established procedures,”said Mark Silverman,manager of Rocky Flats."This authorization allows us to use the thermal stabilization process as needed to manage these oxides safely in the coming years.”(Kee Liakos,303-966-6285) ATLANTA,Ga.-DOE awarded 24 companies and agencies through- out Georgia Clean Air Vehicle Awards to recognize companies using alternative fuels to reduce air pollution."Natural gas,electricity and propane-powered vehicles are becoming more widely available na- tionwide,”said Jim Powell,acting director for the Atlanta Regional Support Office.More than 2,000 alternative-fuel vehicles are operat- ing in Atlanta.(Kent Igelheart,404-393-7470) May 1995 11 DOE UPDATE Recent Developments and Future Prospects for Energy Efficiency and Renewable Energy ORGANIZATION ie)Strategic Alignment Initiative -Cuts 34%in HQ staff ORM 21%in Field Staff a YeNSG 27%in total DOE staff ' -Eliminate 4 of 10 Support Offices (Dallas,San Francisco,Kansas City,New York)by 3/31/49€ -Shift to block grants sECP Tc P codes -Major change in focus for support offices -from grants administration to customer serviceScizof PMA L Pebrolen, 0 Abolish DOE "Fey vES -In House budget proposal /not Senate BUDGET fe)FY 95 EE/RE budget -$1.2 billion.Major new priority is Climate Change initiatives. )Bill rescinding some FY'95 funds vetoed by President -may be resurrected. Oo FY 96 -Administration requests increase in EE/RE budget to $1.4 billion (see Attachment B).Deep cuts proposed in House;minor reductions in the Senate. fe)Balanced budget proposals in House /Senate reflect deep cuts R&D and minor /no cuts in grants /implementation. fe)FY 96 House Science Committee approves huge in r&d funding.Large cuts also approved by House for state grant programs. )No word yet from Senate on FY 96 budget. CONCLUSION 9)Large cuts /significant change is coming rovonWheoA-Co.byith0.e.When.wheeAVXg.Viam.bEWM ely.a SCE-ALORDekeapbck34 -I ackteeaOst.ineOe )CU | ,_4 ;cien€e and Technology at the /-_Lae ae See ational Renewable Energy Laboratory a t : SELTOIIED PE I ES OTTO .Roleeapoulerard fool detmnaplorad 5040 1aa.37.4 aa Srajefes; Pallaiectete 539668 RICK ROGERSALASKAPOWER AUTHORITY333W4THAVENUE220ANCHORAGE,AX 99501 ey.fe js Spring 1995 Vol.XVII,No.1 ee Features 2 Seeding the Brazilian Market NREL helps U.S.companies enter a multi-billion-dollar market for rural electricity in South America 8 PV Lights the Way Lighting this year's National Christmas Tree is just one of a thousand uses the National Park Service has found for photovoltaics 10 Financing Energy Efficiency Cities and counties find creative ways to finance energy projects with low risk and high returns Departments 1 NRELNews Water conservation saves tax dollars;NREL names new director;defect mapper now on the market;NREL wins national SBA award 5 Partnerships Bringing renewable energy to India;cultivating markets in Chile;solar energy for Saudi Arabia;African and Chinese delegations visit NREL; subcontractor expands production capacity;[X Crystals wins major contract 12.Technical News A new NREL process uses the energy in light to fabricate solar cells and microelectronics 15 Publications 16 Calendar/Technology Transfer Energy design software allows users to evaluate options On the cover -A cleaner,greener worldisreflectedinthemultifacetedheliostatofNREL's solar furnace.Growing world marketsforrenewablesarehighlightedonpp.2-7. @&Printed on paper containing at¢@ least 50%wastepaper,includinga@20%postconsummer waste The National Renewable Energy Laboratory NREL is a national resource committed to leadership,excellence, and innovation in renewable energy and related technologies. Our research is intended for application in the private sector.We - foster cooperation with industry through subcontracts and cost- shared studies.We collaborate with university and industry researchers.Our world-class laboratories are. available for experiments,analyses, and proprietary studies. NREL is a DOE national labora-: tory operated by the Midwest Research Institute. NREL In Review NREL's news magazine is intended to promote the flow of technology from the laboratory to . the private sector.NREL In Review... addresses a readership ranging from scientific professionals to business -- people.It is distributed without charge to those involved in renewable energy and related fields. -Material may be reprinted with proper credit.Mention of product or company name does not constitute endorsement by NREL,MRI,or any agency of the U.S.government. Linda R.Brown Managing Editor/Science Writer Mike Coe,Ann Hansen Assistant Editors Howard Brown,Robert Ebisch, Grace Griego,Lynn King,Mike Marsh, Paula Pitchford,Patrick Summers Contributing Writers. Susan Sczepanski Designer and Typographer Warren Gretz Photographer Warren Gretz,Stacy Lyon, Dick Piekarski Cover Image National Renewable Energy Laboratory 1617 Cole Boulevard Golden,CO 80401-3393 NREL is a DOE national laboratory managed by the Midwest Research Institute. For more information on work supported by DOE's Office of Energy Efficiency and Renewable Energy,contact David M.Blanchfield,Golden Field Office,(303) 275-4797. Key NREL Contacts Technical Inquiries:Steve Rubin,(303)275-4099 Technology Transfer Office:(303)275-3008 Utilities:Gary Nakarado,(303)275-3072 State and Local Governments:Carol Tombari,(303)275-3057 International Programs:Sam Baldwin,(202)651-7500 Media:Kerry Masson,(303)275-4090 Director's Office Charles F.Gay,Laboratory Director Bill Marshall,Deputy Director for Operations Linda Lung,Education Programs Alternative Fuels Division Charles Wyman,Director Analytic Studies Division Thomas Bath,Director Basic Sciences Division Satyen Deb,Director Buildings and Energy Systems Division Steve Hauser,Director Industrial Technologies Division Ralph Overend,Acting Director Photovoltaics Division Anthony Catalano,Director Wind Technology Division Robert Thresher,Director Washington,D.C.,Office Eldon Boes,Manager Calendar/Technology Transfer | NREL-Hosted Meetings 17th Symposium on Biotechnology May 7 through May 11;Vail,Colorado Dori Nielsen,(303)275-4350,FAX (303)275-4320 INTERLAB '95:Second Interlaboratory Information Workshop May 10 through May 12;Copper Mountain,Colorado Jessica White,(303)275-4358,FAX (303)275-4320 13th NREL Photovoltaics Program Review Meeting May 16 through May 19;Lakewood,Colorado Jeri Wagner,(303)275-4317,FAX (303)275-4320 SUNRAYCE '95 June 20 through June 29;Indiana to Colorado U.S.Department of Energy,NREL Jeri Wagner,(303)275-4317,FAX (303)275-4320 1995 DOE Wind Energy Program Review July 10 through July 13;Lakewood,Colorado Dori Nielsen,(303)275-4350,FAX (303)275-4320 2nd Biomass of the Americas August 21 through August 24;Portland,Oregon Dori Nielsen,(303)275-4350.FAX (303)275-4320 PV Performance and Reliability Workshop September 20 through September 22;Lakewood,Colorado Jeri Wagner,(303)275-4317,FAX (303)275-4320 TechView '95 September 20 through September 21;Golden,Colorado Dori Nielsen,(303)275-4350,FAX (303)275-4320 National/nternational Meetings 16 Solar '95 July 15 through July 20;Minneapolis,Minnesota American Solar Energy Society,Becky Campbell-Howe, (303)443-3130,FAX (303)443-3212 Intersociety Energy Conversion Conference July 30 through August 5;Orlando,Florida American Institute of Chemical Engineers and American Society of Mechanical Engineers,345 East 47th Street,14th Floor, New York,NY 10017 1995 ISES Solar World Congress-In Search of the Sun September 9 through September 16;Harare,Zimbabwe The Conference Convenor,In Search of the Sun,1995 ISES Solar World Congress,P.O.Box MP 119 Mount Pleasant,Harare, Zimbabwe Spring 1995 Energy Design Software Architects,designers,and build- ers will be able to incorporate energy-saving measures into their buildings with a new computer tool called Energy-10. Energy-10 is extremely easy to use.The designer inputs floor area, the building's use,the number of stories,and the type of heating, ventilating,and air-conditioning (HVAC)system.The program then creates descriptions for two build- ings:a base case for comparing energy use among various energy- saving options and a low-energy case that can be modified as desired. Users can evaluate more than 15 options ranging from passive-solar heating to insulation.In addition to analyzing these features individu- ally or in combination,Energy-10 ranks the options according to user- specified categories such as mini- mum energy use or fastest payback time. Energy-10 also performs hour- by-hour calculations of thermal, HVAC,and lighting behavior through a complete year of opera- tion.This simulation,which takes only about two minutes to run,is based on information such as the local utility rate,building occupancy schedule,and hourly weather data for the climatic region in which the building will be located. Results of each analysis can be output in a variety of graphic for- mats,such as bar graphs comparing loads and costs or line graphs show- ing daily load profiles. Energy-10 is being developed by DOE,NREL,the Passive Solar Industries Council,and Lawrence Berkeley Laboratory.It is scheduled for release in late 1995.For more information,contact NREL's Doug Balcomb at (303)275-6028.¢ 203/3F4-ZSOF NREL In Review NREL In Review M f> ae Charles F.Gay,NREL's new director NREL News erg NREL wins SBA award NREL's outstanding sup- port of small businesses has earned a coveted Dwight D. Eisenhower Award from the U.S.Small Business Administra- tion (SBA).The award is bestowed annually to federal prime contractors in the catego- ries of research and develop- ment,manufacturing,service, and construction.The SBA rec- ognized NREL's diverse out- reach programs plus a high percentage of procurements placed with small businesses. Last year,NREL awarded 77% of its purchases and subcon- tracts to small companies- a total of about $85 million. About 25%of that amount went to companies owned by women and minorities.For more infor- mation on procurement oppor- tunities at NREL,contact Ed Green at (303)275-2901. NREL names new director NREL welcomes Charles F. Gay as its new director.Gay has an exceptional background in all aspects of the renewable energy industry.He comes to NREL from Unisun,a California-based consulting firm that specializes in financ- ing renewable energy projects. Previously he was president of Siemens Solar Group in California and Germany,and also president of ARCO Solar Inc.Gay holds a Ph.D.in physi- cal chemistry and an under- graduate degree in chemistry, both from the University of California at Riverside.He succeeds Director Duane N. Sunderman,who retired in October 1994. Conserving water to save tax dollars The common office restroom will become a showcase of water conservation thanks to a new government-industry part- nership.Under the recently signed cooperative research agreement,NREL will help ret- rofit three floors of the Denver Federal Center with water- saving technologies such as new sinks with automatic faucets,ultra-low-water toilets, and waterless urinals.Out- doors,a new irrigation control system will make landscape watering more efficient. Improvements such as these could save as much as 3 million gallons of water every year.If the demonstration project is successful,other federal build- ings will be retrofitted with similar equipment.For more information,contact NREL's Bob Westby at (303)275-6021. Defect mapper now on the market An innovative device for ana- lyzing defects in semiconductor material will soon be on the market thanks to a recently signed licensing agreement between NREL and Labsphere Inc.of New Hampshire.The company is modifying NREL's scanning defect mapping sys- tem to produce a commercial laboratory instrument that's compact,sturdy,and easy to operate.Called the PVSCAN 5000,the instrument uses laser light to rapidly identify,count, and map crystal defects and analyze photovoltaic devices. Manufacturers can use this information to modify process conditions affecting the quality of semi-conductors and solar cells.NREL's scanning defect mapper won a 1993 R&D 100 Award from R&D Magazine as one of the nation's top 100 inventions. Baldwin heads international programs NREL's new director of international programs is Sam Baldwin,formerly a senior analyst and project director for the U.S.Office of Technology Assessment (OTA).Baldwin will help coordinate all of NREL's international activities, including rural electrification programs in Brazil,India, Indonesia,and Chile.Baldwin's work at OTA included studies on commercialization chal- lenges and opportunities,inter- national competitiveness of U.S. renewable energy technologies, and the potential of alternative energy in developing nations.¢ Spring 1995 1 | Seeding the Brazilian Market NREL helps American companies enter a multi-billion-dollar market for rural electricity in South America by Robert Ebisch es olarex Inc.had one distribu- tor and no sales of its photo- voltaic (PV)modules in Brazil before 1994.That's the year it became a supplier to NREL's Joint U.S./Brazilian Renewable Energy Rural Electrification Project. Now the Maryland-based com- pany is supplying PV modules and components to four Brazilian states-and reaping benefits that go well beyond the subcontracts themselves. "These projects have given us the opportunity to contact and develop relationships with some key utility personnel with substantial market potential for the future,”says Roger Efird,Solarex's sales manager for the eastern United States and South America."They've given us the opportunity to seed the market with demonstrations to use as references in a potential market that has virtu- ally no experience with this type of technology.” Solarex has established relation- ships with four Brazilian distributors and is rapidly increasing sales of its 53-and 64-watt silicon modules in water pumping. 2 Spring 1995 PhotocourtesyofRogerTaylorBrazil.Shipments during the first two months of 1995 (excluding the NREL projects)have already exceeded total 1994 revenues in that country. "We're still talking small num- bers,but it's a start,and the start is the most difficult part,”Efird says. "The initial hurdle to developing the market is behind us.” Potential market tops $2 billion The potential market for both solar and wind power is tremendous in Brazil,where about 20 million people live without electricity.Line extensions of centralized power are often prohibitively expensive in these areas.Assuming five people per home,and an average cost of $500 per home to install renewable energy systems,rural Brazil repre- sents a $2 billion market for PV manufacturers. Thanks to Phase I of the joint elec- trification project,PV systems now brighten about 750 homes and 14 schools in two Brazilian states.Phase II hardware,including PV and wind power,is being shipped to six addi- tional states this year. Seeding the market of developing nations on behalf of U.S.companies goes hand-in-hand with NREL's efforts to advance renewable energy technologies for highly competive markets. "We're early on the implementa- tion curve here,”says Roger Taylor, senior project manager in the PV Engineering and Applications NREL In Review *SAPs,wd gt tt Publications es NREL In Review Tapping Into the Sun:Today's Applications of Photovoltaic Technology DOE/CH10093-203,DE93000075 First used in the space program,photovoltaic (PV)systems now generateelectricityforwaterpumping,lights,battery charging,communications, refrigeration,television,switches,signals,and utility loads all over the world.This highly informative,20-page booklet describes actual PV sys-tems-small and large,stand-alone and hybrid-now providing reliable, nonpolluting power at ever-lower costs. Another Asset in the Utility Resource Portfolio Utility executives are taking note of the dramatic improvements in the per-formance,cost,and reliability of wind energy systems in the last five years.This attractive,four-page brochure is the eighth produced at NREL for the Utility Wind Interest Group,whose members include electric utilities explor-ing wind power in cooperation with DOE and the Electric Power Research Institute.The brochure explains how cost and market factors are making thiscleanenergyoptionveryappealingtotoday's power market. EREC Fact Sheets Cost-conscious consumers-especially those interested in preserving the environment and conserving energy-will want these practical,thorough,easy-to-read fact sheets.Produced at NREL for the Energy Efficiency and Renewable Energy Clearinghouse (EREC),topics include energy-efficient windows,cooling your home naturally,selecting a new water heater,sun-space basics,and advances in window glazing.For a full list of topics,andtoordercopies,call EREC at 1-800-363-3732. Energized Fact Sheets You know how effective and economical solar energy can be in providingheat,hot water,and light for your home.But did you know that solar tech- nologies are saving a large automotive engine plant about $180,000 a year inenergycosts?Advanced solar technologies are also being tested for manufac- turing low-cost ceramics,cleaning up hazardous wastes in soil and ground-water,making geothermal energy plants more efficient,and dozens of other uses.These informative fact sheets give you the latest information on some of the most interesting R&D projects going on in NREL's Buildings andEnergySystemsDivision. Except for the EREC fact sheets,these publications are available from NREL's DocumentDistributionService,1617 Cole Blud.,Golden,CO 80401-3393. Spring 1995 15 The serendipitous discovery of light enhancement pointed the way toward several low-cost methods for increasing the efficiency of solar cells.But it also opened the door to a whole new area of research in light/material interactions whose complexities and subtleties are as yet poorly understood.NREL researchers will continue to explore this uncharted territory and make use of the results. Large markets await development The potential market for optical procesing could be large,with solar cells making up just one portion. Almost all computer chips and other microelectronic semiconductors require electrical contacts.The low- resistance contacts created by optical processing,plus the energy savings and simplified manufacturing, should help lower the cost of both solar cells and microelectronics. The serendipitous discovery of light enhancement opened the door to a whole new area of research in light/material interactions whose complexities and subtleties are as yet poorly understood. fs Processing at lower temperatures means fewer defects,such as the diffusion of metal from one layer to another.Ultra-large-scale integration circuits,with their submicron fea- tures,will particularly benefit from this aspect of NREL's new process. Other applications of the optical furnace include converting silicon to thin-film silicon oxide.The ability to form this thin-film layer is a key 14.Spring 1995 Technical News ee gravity on this process as well. Solar-cell manufacturing tested on Space Shuttle Astronauts aboard the Space Shuttle Endeavor recently partipated in several NREL experiments designed to study the effects of microgravity on semiconductor manufacturing.Tests were conducted at NREL,in space, and at a NASA laboratory,with results now being tallied. One experiment involved melting and alloying layers of silicon and aluminum to form a back electrical contact for a solar cell with a built-in reflective layer.NREL researchers have used optical processing to success- fully perform this task on Earth,but have run into difficulties when trying to melt the entire thickness of the alloy.This trial will determine if a lack of gravity during recrystallization can improve quality. In the second experiment,researchers and astronauts treated thin films of amorphous silicon and fine-grain polycrystalline silicon to produce large grains at low temperatures.Results will shed light on the effects of The use of robotics on the Shuttle indicates how easily this type of auto- mation could be used for mass production. step in manufacturing microelec- tronic devices.NREL's furnace produces these oxides in very thin films of very high quality. While researchers continue to explore the many uses of optical processing-and to understand the light enhancement phenomenon- the optical furnace is ready now for solar cell and microelectronic manu- facturing.It should quickly develop into a powerful tool for a wide range of semiconductor processes. NREL is seeking cooperative research partners to fully develop the potential uses of both optical process- ing and the optical furnace,and could provide demonstration units to interested parties.For more infor- mation,contact Bhushan Sopori at (303)384-6683. This article was adapted from a four- page fact sheet entitled "NREL Process and Furnace Harness Optical Phe- nomenon”by Howard Brown. Publications and Patents Sopori,B.L.(1994)."Optical Process- ing Involving Photon-Enhanced Interface Reactions.”Paper presented at the Sec- ond International Rapid Thermal Process- ing Conference,Monterey,CA,August 1994, Sopori,B.L.,Inventor (June 1993). "Controlled Metal-Semiconductor Sinter- ing /Alloying by One-Directional Reverse Wumination.”U.S.Patent No.5,223,453. Assignee:Midwest Research Institute. Sopori,B.L.,Inventor (April 1994). "Back-Side Hydrogenation Technique for Defect Passivation in Silicon Solar Cells.” USS.Patent No.5,304,509.Assignee: Midwest Research Institute. Sopori,B.L.(1993)."Simultaneous Formation of Front and Back Contacts on Solar Cells Using Optical Processing.” Materials Research Society Symposium Pro- ceedings,Pittsburgh,PA,Vol.303;pp.369- 374. Sopori,B.L.,et al.(1993)."Optical Processing:a Novel Technology for Fabri- cating Solar Cell Contacts.”Proceedings of the 23rd IEEE Photovoltaic Specialists Con- ference,Louisville,Kentucky,May 10-14, 1993,pp.97-100.@ NREL In Review photovoltaic modules providing power to a rural home in the state of Pernambuco,Brazil. Branch at NREL."There are approxi- mately two billion people in the world without any electricity,and the technology is now at the right place and time to pursue that mar- ket.This is a rapidly growing indus- try,and the companies that win in this game are going to be the ones that get out there and run just as fast as they can.” Companies like Solarex have had a valuable head start in Brazil as a result of the joint electrification pro- ject,which was established by DOE following the January 1992 Earth Summit in Rio de Janeiro.NREL was designated to carry out the research and demonstration projects. NREL In Review NREL lays the groundwork Brazil is the leading model of what NREL tries to do in all its international activities,says Taylor: establish a laboratory-to-laboratory relationship with a key organization in a foreign country,then use that relationship to build project opportunities. "Projects force development of institutional relationships and pro- vide good technical demonstrations,” he says."They also enhance the movement of U.S.hardware into new countries,and establish the in-country training necessary to make these programsa success in the long run.”PhotocourtesyofRogerTaylorThe international nature of NREL's employee base was of par- ticular value in Brazil,as it is in other foreign efforts,according to Taylor. Brazilian native Helena Chum,now director of NREL's Industrial Tech- nology Division,quickly stepped in to fill a key role in the joint project: she visited Brazil four times in five months to establish a partnership between NREL and CEPEL (the Brazilian center for electric energy research). CEPEL provided a necessary cen- tral link with the country's utilities, an arrangement that's proving highly beneficial for U.S.companies as they negotiate the challenges of exporting technology to new foreign markets. Participants agree this is one of the main benefits of the joint project. Once the utilities embrace an energy technology,other potential buyers become more familiar with it and feel more confident about adopting it. Of course,the joint project isn't the only road to Rio for the renew- able energy industry.For example, Siemens Solar Industries of Camarillo,CA,already had distri- butors in Brazil.But the scale of NREL's approach has made a sub- stantial change in the business climate,says Ernie Prokopovych, project manager for Siemens'Phase II contract with NREL. "In my opinion,NREL has opened up the utility door to PV,”he says. Assuming five people per home,and an average cost of $500 per home to install renewable energy systems, rural Brazil represents a $2 billion market for PV manufacturers. ee Spring 1995 3 "They created a large program, which we couldn't have created,nor could our distributors.This went through DOE to its Brazilian counter- part,agency to agency,through the top,and then went down to us.” Like other renewable energy companies,Siemens has had direct _help from NREL in becoming more competitive in international mar- kets-both in terms of funding and technical assistance.Siemens recently introduced a new product line thanks to help received from NREL under DOE's Photovoltaics Manufac- turing Technology Initiative.The company also is working with NREL to develop solar cells based on thin films of copper indium diselenide, an advanced semiconductor material. Wind,hybrids also on the road to Rio Bergey Windpower of Norman, OK,is another Phase II contractor in the Brazilian electrification project. The company previously had sales in Brazil.But president Michael Bergey says the NREL project allows him to install equipment in new Brazilian states where his products weren't represented before.And NREL's efforts have given him the opportunity "This NREL job is relatively unique.It gives us a rare opportunity to work with the people responsible for very large numbers of remote communities.I would guess that the NREL project has probably moved our market exposure efforts ahead by two years.” -Mike Bergey 4 Spring 1995 ieaeLOmnaad";reTt=+H'ersvillage of Cacimba in the state of Ceara,Brazil.Each 50-watt system can run two fluorescent lights for four to six hours. to work directly with utilities as well as private sector customers. "We have equipment installed in over 60 countries,”Bergey says."But this NREL job is relatively unique.It gives us a rare opportunity to work with the people responsible for very large numbers of remote communi- ties.|would guess that the NREL project has probably moved our market exposure efforts ahead by two years.” New World Village Power of Waitsfield,VT,has established a Brazilian office since it received its Phase II contract to supply system controls and power processing equipment for a PV-wind-battery hybrid system on a Brazilian island. Bergey Windpower is supplying four 10-kilowatt wind turbines for the hybrid system,with Siemens providing the PV modules. New World marketing manager George Barlowe says the company would have established the Brazilian office even without the NREL contract. But another company-Arizona- based Photocomm Inc.-found Brazil a "tough nut to crack,”says Steve McCarney,vice president of international sales.Since becoming a subcontractor in the joint project, Photocomm has had additional requests for PV-related equipment from Phase II utility customers.The company is now experiencing a rapid expansion of its Brazilian sales. "With the NREL project,we were contracted to provide 58 individual solar power systems of 13 different types,including homes,agricultural water pumps,schools,clinics and telecommunications,”McCarney says."So we got a little bit ofeverything,and we went into four different states.For us that's great exposure,and a wonderful humani- tarian gesture on the part of NREL and CEPEL.” For more information on government-industry projects in Brazil,contact NREL's Roger Taylor at (303)384-6432.¢ NREL In Review PhotocourtesyofRogerTaylorThe newly formed alloy was incredibly thin-thinner than the wavelength of light,which made it reflective rather than absorptive. Sopori quickly realized that this built- in reflective layer could be used to capture sunlight that otherwise would be lost to the electric conver- sion process.He began designing a simple,compact furnace to harness light energy for semiconductor manufacturing. The optical processing furnace basically consists of a bank of tung- sten halogen lights and a diffuser to make the light more uniform as it passes into a transparent quartz chamber.Semiconductor materials are placed on a grid of quartz "bumps” inside the chamber.A computer con- trols the amount and intensity of optical energy flooding the chamber, as well as the flow of processing gas (usually argon to eliminate contami- nants and oxygen). Light is in the near-infrared range, mostly consisting of longer wave- lengths within that portion of the spectrum.The light heats the entire wafer,but crucial interactions are confined to specific target areas. By adjusting the intensity and duration of light energy,researchers can decrease the thickness of the back contact alloy to less than 100 ang- stroms.Controlling the amount of light energy also influences the tex- ture of the interface alloy.Rougher texture enhances reflection to the overlying silicon layer,so that the solar cell can achieve virtually com- plete absorption of sunlight. Front and back contacts in two steps The optical furnace's ability to selectively heat certain portions of a wafer greatly simplifies semiconduc- tor manufacturing of all kinds.With conventional furnaces,temperature- sensitive elements can't be added until the high-temperature steps are NREL In Review Technical News p-type Sl substrate % ee t>Alloy at 800°C (oxygen <1 pyy Etchck>excessAl> Rinse and dry wafer Deposit Al on front or RTP methods «p>Deposit Alon back __ «Al pm) Sinter 400°C Deposit additional Al on back Conventional furnace n+ Pere ee eH +n+ p-type SI substrate Deposit Al(front apd back)<pi.oe©oe! Alloy and sinter 400°C <p Optical processing CD-SS24-310301 With optical processing,alloying back contacts while sintering front contacts requires only twoprocesssteps.Both conventional furnace alloying and rapid thermal processing require at least seven process steps. finished.The optical furnace can accomplish several of these steps at once. For example,front and back elec- trical contacts made of aluminum can be attached to a silicon wafer all in one step.Optical energy applied to the interface of the back contact and the wafer causes melting and alloy- ing at 400°C (a reaction that would otherwise require 600°-800°C tem- peratures).At the same time,the front contact grid is sintered but doesn't alloy.That's because the interface of the front aluminum grid with the silicon is shielded from the optical energy by the grid itself.(This masking process can be applied to other elements as well.) By simplifying the process of at- taching back electrical contact layers and front contact grids,the optical furnace should significantly increase both the rate at which semiconduc- tors can be processed and the per- centage of devices that perform at maximum efficiency. Exploring new territory Another promising use of optical processing is to treat thin films made of amorphous or fine-grain polycrys-talline silicon to produce large-grain crystals.Polycrystalline silicon must have large grains to produce efficient solar cells.Crystalline silicon is expensive to produce,so any methodofincreasingefficiencyatlowcost holds great potential. Spring 1995 13 Technical News Harnessing Light Energy A new NREL process uses the energy in light to fabricate solar cells and microelectronics REL researchers have come up with a new twist for photovoltaics research: using the energy in near-infrared light to fabricate solar cells that convert light to electricity.Called optical pro- cessing,the new approach simplifies the formation of electrical contacts and,at the same time,improves the electronic properties of the connections. One of the most exciting possibilities for the new process is fabricating solar cells with built-in reflective layers that convert more incoming light to electricity. Optical processing uses intense light to melt the thin region where a semiconductor material meets a metal,explains inventor Bhushan Sopori.The energy contained in infrared light causes reactions that would occur only at much higher temperatures during conventional manufacturing.The result is an 12 Spring 1995 Optical processing uses light in the visible and near-infrared portions of the spectrum to melt and alloy (or sinter)the interface of two different semiconductor materials,A bank of halogen lights provides optical energy in this small furnace designed for in-house research. improved electrical contact produced at a lower cost-a potential break- through for manufacturers of both solar cells and microelectronics. One of the most exciting possibili- ties for the new process is fabricating solar cells with built-in reflective lay- ers that convert more incoming light to electricity.Another possibility is to improve the crystalline structure of thin-film amorphous silicon or poly- crystalline silicon.Other applications are surfacing as NREL researchers explore the distinct advantages of using visible light in semiconductor manufacturing. Melting and alloying with pinpoint accuracy Processing semiconductor mate- rial for either solar cells or micro- electronics normally includes many heat treatment steps.But where conventional furnaces heat the entire semiconductor wafer,NREL's optical furnace can melt and alloy a layer with a thickness of less than100angstroms(one millionth of a centimeter). This highly targeted processing requires about 80%less energy than rapid thermal processing,a common technique that also uses light energy in the visible and infrared portion of the spectrum.But energy savings isn't the only advantage here;because rapid thermal processing applies so much energy (typically 10-30 watts per square centimeter)and heats the wafer so rapidly,optical effects don't play a significant role.As Sopori found out,it's the light energy working at lower tempera- tures that makes all the difference. Sopori discovered optical enhancement while using a thermal processing furnace to develop a thick-graded alloy layer for an anti- reflective backing on a solar cell.To determine the minimum power that could be used,he turned off the underside lights of the furnace and reduced the power of the top lights. The surprising result was the forma- tion of a very thin alloy at a far lower temperature than is usually possible with a conventional furnace. NREL In Review Renewing India The United States and India have stepped up plans for more collab- orative work in renewable energy and energy efficiency since Energy Secretary Hazel O'Leary visited the subcontinent in 1994.As part of this ongoing effort,NREL recently led a trade mission that resulted in major business deals for several U.S.photo- voltaics (PV)companies. Beneficiaries of the recent trade mission include Omnion Power Engi- neering of East Troy,WI,which will supply a complete 150-kilowatt,grid- connected PV power plant for instal- lation in the state of Tamil Nadu. Four other companies-AstroPower Inc.of Newark,DE;Energy Conver- sion Devices of Troy,MI;Solar Cells Inc.of Toledo,OH;and Spire Corp. of Bedford,MA-currently are nego- tiating agreements with their Indian business partners. Additional Indian companies have expressed interest in future business deals with U.S.companies.PV sales in India are expected to reach 7-8 megawatts of system capacity this year,with 9-10 megawatts pro- jected for next year. The Indian PV market has grown by 50%in the past few years.Accord- ing to a recent World Bank report, as much as 140 megawatts of PV capacity may be installed each year beginning in the near future.Similar impressive growth rates have been observed in wind energy:current installed wind capacity in India is about 300 megawatts,with a 100% increase anticipated in the next few years.Similiar growth has occurred with biomass projects. More than 72,000 villages in India currently are without electricity.Gov- ernment support for bringing renew- able energy to many of these villages includes an automatic allowance of up to 51%foreign ownership in joint ventures with Indian companies.The NREL In Review Partnerships NREL's Harin Ullal (second from left)partici- pated in the signing of an international agree- ment that will bring U.S.renewable energy technologies to India.Seated at the left is S.Krishna Kumar,India's Minister for Non- Conventional Energy Sources. Right:PV is being used to pump the water in many wells throughout rural India. Indian government also will provide 55%of the cost of PV modules,100% of the equipment cost for wind- powered pumps,and 50%-80%for biomass gasifiers and biomass-based power generation,among other incentives.Loan assistance for joint ventures is also available. In addition to leading this highly productive trade mission,NREL has signed a memo of understanding with India's Tata Energy Research Institute to promote cooperative ven- tures for renewable energy technolo- gies.Present at the signing was U.S. Energy Secretary Hazel O'Leary, whose recent visits to India have resulted in sustainable energy pro- jects worth about $10 billion. For more information on oppor- tunities for renewable energy in India,contact NREL's Harin Ullal at (303)384-6486,or Jack Stone at (303)384-6470. Cultivating Markets in Chile Imagine a small child in rural Chile trying to do homework at night in a village that's never had electric- ity.This dismal picture may soon change thanks to a recent agreement between the United States and Chile. Under the agreement,NREL will help U.S.companies bring clean, renewable energy to two remote areas outside the cities of Talca and Temuco.Small wind turbines and photovoltaic plants will generate electricity for much-needed lighting, Spring 1995 5 communications,water pumping, and refrigeration for homes,schools, and health clinics. About 190,000 homes in these areas currently are without electric- ity,although many rural people travel to the city each week to recharge batteries or replenish bot- tled gas.Chile's goal is to get electri- cal service to 80%of its rural regions by the end of the decade. NREL staff members recently met with representatives of the Chilean National Energy Commission and the National Rural Electric Cooperative of South America to discuss potential pilot projects and their implementa- tion.NREL also will develop maps of renewable energy resources to show where installations would be most feasible. Chile estimates that $300 million will be required to meet its electrifica- tion goals.This year the country will provide $1 million for planning, resource assessment, pilot projects,and infrastructure. DOE will contribute about $500,000 to the effort.About 70%of future financ- ing for renewables will come from Chile's public sector. If the pilot projects are successful,they will be repeated in other regions of Chile in the near 6 Spring 1995 Partnerships ee NREL's Gene Maxwell (right)and Ahmed Al-Amoudi of the King Abdu'l-Aziz City for Science and Technology prepare a radiometer calibration facility at the Solar Village near Riyadh,Saudi Arabia. For more information on NREL's activities in Chile on behalf of U.S. industry,contact Larry Flowers at (303)384-6910. Solar for Saudis New markets for American renew- able energy technology may soon crop up in a surprising place:Saudi Arabia,home of some of the world's largest oil reserves. As part of an agreement with the Saudi government to diversify its energy sources,an NREL team led by Gene Maxwell recently went to Riyadh,Saudi Arabia.The team spent five weeks helping the Saudis establish a radiometer calibration facility to measure the solar resource at several locations.They also set up the first two stations of a 12-station network for measuring solar radia- tion at the Qassim airport and ata solar village 30 miles from Riyadh. The five-year resource assessment project will continue through 1997. While Maxwell's team broiled outdoors in heat over 100°F (38°C), another team led by John Thornton worked mainly indoors at the Solar Village for three weeks.Tests atthisresearchsiteinvolvedafield ofconcentratorphotovoltaicsystems, several parabolic dishes,and a water desalination system. Researchers used solar simulators to evaluate the performance of vari- ous solar cells and modules.They also helped train the Saudis in cali- brating and measuring procedures. In addition,Thornton's team collabo- rated on the Saudi's first photovoltaic- powered desalination system,which will remove salt from groundwater. Both projects sprang from the SOLERAS program begun in the early 1980s as an agreement between the Midwest Research Institute (NREL's parent company)and Saudi Arabia. For more information on NREL's activities in Saudi Arabia,contact John Thornton at (303)384-6469. African and Chinese delegations visit NREL Increasing global interest in renew- able energy recently prompted visits to NREL by high-level decision makers from both Africa and China. Diplomats from 27 African nations recently met at NREL and discussed ways of using clean,renewable resources to sustain their growing populations.Africa has very little indigenous fossil fuel,but an abun- dance of biomass,wind,and solar resources. NREL In Review contract.Costs are covered by the energy savings and a Honeywell guarantee,which says that the city's savings will at least meet the sum of its lease payments and maintenance payments.If savings exceed pay- ments,the city keeps the extra money.And when the performance contract expires,the savings will revert to either a city general fund or a utility fund. When signed in March 1992,the performance contract was projected to save the city about $600,000.So far Redlands has received more than $100,000 in utility rebates alone. Improvements to a wastewater treat- ment plant are saving the city more than $20,000 a year. Matching grants and loans boost local economy Two other options for financing energy-efficiency projects are match- ing grants and low-interest loans. The city of Ellensburg,WA,is benefit- ting from a combination of the two in Project Rebound,a pilot program created by the Washington State Energy Office (WSEO)in 1988. When signed in March 1992,the performance contract was projected to save the city about $600,000.So far Redlands has received more than $100,000 in utility rebates alone. WSEO's grant to the city was $322,000,which covered project and administrative costs as well as rebates.The local utility matched that amount for a total of $644,000. WSEO also helped Ellensburg obtain funding from other state,federal, NREL In Review and utility programs.Funds were designated for projects that would save energy and stimulate the local economy. Ellensburg then offered several financing options to local businesses interested in making energy improve- ments under the new program. "For a standard matching funds grant,the applicant could receive up to $5,000 or one year's worth of utility bills,”explains Gary Nystedt, an energy analyst for Ellensburg. "Standard projects were selected from a pre-approved list compiled by the city.The project had to have a simple payback of 20 years or less.” Pre-approved projects included roof,wall,and floor insulation;high- efficiency lights;automatic setback thermostats;and heat recovery for HVAC systems. For large projects exceeding the $5,000 limit,businesses could receive special authorization from the city council for up to $25,000 if the pay- back period was 10 years or less. Zero-interest loans were also avail- able.For standard,pre-approved pro- jects,applicants could borrow up to $20,000;repayment was based on the payback period.The loan limit was $40,000 for other projects.All appli- cants were charged a one-time loan fee of 5%(not to exceed $1,000). If an applicant planned to build a new facility,Project Rebound paid any cost difference between the energy-efficient equipment and standard,conventional technology. For retrofits the project paid half the project cost. "Part of the program's success was due to the free energy audit the city offered,”Nystedt says."Wespentalotoftimeeducatinglocalbusinessesbothinhowtheyuse energy and in what technologies are available.They didn't know what kinds of products are out there.” Local governments across the nation agree that energy efficiency gry tits.PhotocourtesyofJuliePratherA walk-through energy audit of the Valley Cafe,performed as part of Washington's Project Rebound,revealed numerous measures that could save owner Greg Beach energy and dollars. makes dollars as well as sense.It also can be a relatively risk-free venturewithhelpfromknowledgeable experts.For more information, contact the National Association of Energy Service Companies,1200 G Street NW,Suite 760,Washington, DC 20005,(202)626-2400. This article was adapted from "Financing Local Energy Efficiency Pro- jects,”a fact sheet in a series intended for city and county governments.NREL has produced about 30 of these four-to six- page fact sheets to explain how local gov- ernments can integrate renewable energy and energy efficiency into their opera- tions.Dollar and energy savings are quantified in a case-study format.For more information,contact NREL's Lynn King at (303)275-3792.¢ Spring 1995 11 Financing Energy Efficiency Cities and counties find creative ways to finance energy-saving projects with low risk and high returns by Lynn King a ost people agree that energy efficiency is a great idea-if you can afford the initial investment.If only there were ways to make low-risk, high-return changes without stretch- ing city or county budgets. Sound too good to be true?Not when local governments pursue crea- tive financing options such as per- formance contracting,matching grants,and low-interest loans. Above:Director of Public Works Ron Mutter explains how Redlands,WA,saves energy under a performance contract with Honeywell Inc. 10 Spring 1995 Performance contracting for guaranteed savings The city of Redlands,CA,cut its energy use by almost 50%in just two years thanks to an innovative idea called performance contracting. In performance contracting,a third party (often a local company) provides the city or county with a service package for financing,install- ing,and maintaining energy-saving improvements.The local govern- ment uses the money it saves in util- ity bills to pay for the improvements. Performance contracts are often struc- tured as a lease,but with a guarantee that payments will not exceed energy savings.This minimizes the financial risk. Performance contracting began in Redlands when Honeywell Inc. approached a city council memberaboutreplacingandupdatingthe city's heating,ventilating,and air- conditioning equipment.Also included in the deal were improve- ments to wastewater pumps,lighting systems,and irrigation systems in various parks. "There were no risks because Honeywell guaranteed that there would be no risk,”says Ron Mutter, Director of Public Works."The equip- ment needed replacing anyway,so we were very interested in the idea. Especially because it wouldn't cost us anything.” Replacements were financed with a municipal lease and maintenance NREL In Review Delegates were interested in the use of photovoltaics for village power, solar thermal systems for hot water, small wind turbines to pump water, and agricultural and forest waste to produce both electricity and clean- burning fuels. In addition to the African delega- tion,NREL recently received a dozen visitors sponsored by the Department of Environmental Protection and Energy in China's Ministry of Agricul- ture.The visit was officially hosted by the Joint Institute for Energy and Environment at the University of Tennessee,with NREL participation. The Chinese delegates spent 21 days in the United States to learn about topics ranging from government policies and legislation affecting the adoption of renewable energy to the operation of individual facilities.The Chinese delegates expressed strong interest in biomass power,waste-to- energy technologies,wind energy, and photovoltaics for both centralized and off-grid use. China recently completed an inte- grated study of rural energy needs in every province except Tibet.The dele- gation's visit to NREL was part of a tour designed to educate key people in renewable energy policy,technol- ogy,and commercialization.Delegates will return to their country better pre- pared to deploy the most promising technologies. DOE's Office of Solar Energy Con- version will help the Chinese Ministry of Agriculture plan a project for rural development in the near future.A recent trade mission led by Energy Secretary Hazel O'Leary has already resulted in $6 billion in commercial agreements,with the promise of more to come. For more information on NREL's contact with African nations,call Ron White at (303)275-4635.Information on the Chinese delegation can be obtained from William Wallace, (303)384-6476.@ NREL In Review Partnerships Siemens expands production capacity by 50% Siemens Solar Industries,an NREL subcontractor in photovoltaic (PV) research and development,recently announced the addition of new manu- facturing capacity to meet growing worldwide demand for its silicon-based PV systems. The company will invest about $3 million to expand its manufacturing plant in Camarillo,CA.Improvements include enhancements to the diffu- sion process used to create electrical junctions on individual solar cells,and a semi-automated "flo-line”where cells are strung together,laminated,and framed to create modules. Siemens manufactures and markets two product lines at its California facility.These include its new ProCharger™module developed with support from NREL. JX Crystals wins major contract Thermophotovoltaic (TPV)devices convert heat energy to electricity using technology similar to solar cells.One of the most active companies in this emerging field is JX Crystals of Issaquah,WA.The company's prototype Midnight Sun™portable TPV generator uses cells made of gallium antimonide to produce electricity from the heat radiated by a natural-gas-fired ceramic emitter. JX Crystals and Western Washington University recently won a five-year,$4.5-million contract to develop TPV for cogenerating heat and electricity.Applications include field hospitals and command centers for the U.S.Department of Defense.The quiet, virtually emission-free operation of TPV also makes it attractive for civilian uses such as rec- reational vehicles and werCrystatshybridelectriccars.nenJXCrystalsandotheree ot major players in TPV development will be attending the second annual NREL-sponsored TPV conference in Colorado Springs,CO, July 17-19.For more information,contact John Benner at (303)384-6496 or Tim Coutts at (303)384-6561. ]X Crystals'prototype generator uses cells made of gallium antimonide to convert heat to electricity. Spring 1995 7 \N one.i att \M4 Lighting this year's National Christmas Tree is just one of a thousand uses the National Park Service has found for photovoltaics by Mike Marsh his year,the cheery glow of lights on the National Christ- mas Tree was powered with the help of the sun.The demonstra- tion proved the potential of photovol- taics (PV)to top agency officials and key decision makers in Washington, DC,with the promise of more oppor- tunities to come. ee The holiday project proved not only that PV can produce reliable electricity, but that government agencies can work together with industry to successfully demonstrate new energy technologies. 8 Spring 1995 More than 100,000 people-includ- ing 3500 VIPs-viewed the solar arrays on the White House Lawn under the direction of the National Park Service (NPS).The arrays helped offset the considerable energy use of the holiday displays by put- ting about 5%of the pageant's total energy use into the local utility grid. "Jt was very impressive,”says NREL's John Thornton,who helped coordinate the project."After we put the PV systems together,I turned around and looked at the White House.Then it really sank in that we were setting a good example for the nation.” Jim McDaniel,NPS White House liaison,agrees that the project was successful.Next year he hopes for an expanded version of the project. In addition to the grid-connected arrays,he would like to power streetlights and other area lights on the Pageant of Peace walkway with stand-alone PV systems. "We want to take the next step,” he said."We're committed to this project,and getting better at it each year.” Providing the power Four U.S.companies loaned solar arrays and inverters for this year's pageant. ASE Americas Inc.of Billerica, MA,provided 10 Mobil GP300DG modules,complete with structure and power conditioning systems. Siemens Solar Industries of Camarillo, CA,loaned 28 M55 modules and sup- porting framework.Solarex Indus- tries of Frederick,MD,supplied two arrays:one with 30 polycrystalline MSX 60 modules,and the other with eight amorphous silicon modules. Omnion Power Engineering Corp. of East Troy,WI,loaned three two- kilowatt inverters. Above:About 100,000 people viewed this 6-kilowatt photovoltaic system on the White House lawn during December.The system offset about 5%of the energy used for holiday displays. NREL In Review PhotocourtesyofJohnThorntonNPS has developed a $28-million,system-wide plan to install solar panels in certain national parks.The agency currently uses 455 PV systems and plans to install another 645 over the next five years. The rated output of the combined PV systems was about six kilowatts, with an expected annual energy out- put of about 8,000 kilowatt-hours of electricity.The systems were inter- connected with the utility grid of Potomac Electric Power Co.(PEPCO). PEPCO issued a temporary permit allowing the use of each array as a mini-cogeneration unit. "The project was intended primar- ily for public education,”Thorton says."But we also gained confidence from the utility.And we were invited back by the Park Service. That wouldn't have happened if there had been problems.” Setting the example The holiday project proved not only that PV can produce reliable electricity,but that government agen- cies can work together with industry to successfully demonstrate new energy technologies. McDaniel says the project began when President Clinton signed an executive order in 1993 to "green the White House”with energy-saving technologies.The order applied only to the fenced-in 18 acres surrounding the White House.The Park Service looked for opportunities for environ- mental projects outside the White House grounds,such as in the A photovoltaic panel at Capitol Reef National Monument provides power for a well pump. NREL In Review PhotocourtesyofNationalParkServicePhotocourtesyofNationalParkServiceBae A small photovoltaic module Mj helps ventilate a restroom BW at Sleeping Bear Dunes National Lakeshore in See Michigan. surrounding 80-acre park managed by NPS.7 Mark Ginsberg,director of the Federal Energy Management Pro- gram,suggested using solar energy for the holiday festivities.But NPS's McDaniel is aggressively seeking other uses for the technology. "We have taken the Greening of the White House provisions and rolled them into our 20-year compre- hensive design plan,”McDaniel said. "Deploying PV technology around the White House is under NPS juris- diction now.This removes the pros- pect of political changes every few years.” NPS has developed a $28-million, system-wide plan to install solar panels in certain national parks.The agency currently uses 455 PV sys- tems and plans to install another 645 over the next five years.These systems will provide electricity in remote locations for resource moni- toring,communications,water pumping,fence charging,and visitors centers. In addition to being a cost-effective,sustainable energy source for these applications,PV will annually acquaint more than 275 million park visitors with clean,renewable energy from the sun. NREL is now completing a study on using PV for lights and power at the Visitors Pavilion,a small building at the entrance of the Washington Mall.For more infor- mation,contact John Thornton at (303)384-6769.¢ Spring 1995 9 Department of Energy Seattle Regional Support Office 800 Fifth Avenue,Suite 3950 Seattle,Washington 98104 SEP 09 1885 Mr.David Lockard Alaska Department of Community and Regional Affairs 333 West 4th Avenue,Suite #220 Anchorage,Alaska 99519 Dear Mr.Lockard: COMMERCIAL BUILDINGS ENERGY CONSUMPTION SURVEY Every three years the Energy Information Administration of the U.S.Department of Energy (DOE)conducts a Commercial Buildings Energy Consumption Survey (CBECS).Information from the survey is compiled into a report entitled Characteristics of Commercial Buildings.This report is used by the public and private sectors to help analyze energy trends and forecast future energy needs in the U.S. Approximately 5,500 commercial building owners/operators will be surveyed between late August and mid-December 1995.In the event that you are contacted by commercial building owners or operators,we request your assistance in encouraging the respondents to participate in this DOE sponsored survey. The enclosed FACT SHEET provides more detailed information about the CBECS. Additionally,I have enclosed a copy of the letter that was mailed in mid-August to each of the building owner/operators in the sample. If you have any questions,contact me at (206)553-2158,or Martha Johnson,the CBECS Manager at (202)586-1135. Sincerely, Fret E Erm -__ Laurie E.Brown SECP Program Manager Seattle Regional Support Office Enclosures (206)553-1004 Federal Recycling Program we Printed on Recycled Paper (206)553-2200 FAX COMMERCIAL BUILDINGS ENERGY CONSUMPTION SURVEY (CBECS)FACT SHEET Sponsored by: Data Collection Contractor: Survey Design: Data Collection Procedure: Typical CBECS Respondent: Type of Information Collected: Confidentiality: Legal Authority: EIA/DOE Contact: Energy Information Administration.U.S.'Deparment ot Energy WESTAT Inc..2 social science reseer2h firm based in Rockville,Maryland National sample survey of 53,500 commercial puilcings over 1.000 sauare fees. Comruter Assisiec Personal Intervie.conducted oy WESTAT Ince.stari at the sampled buiicings.haBuilding owner,tenant or building manager Building size,principal activitv,eners:sources, emergv-using equipment.and conservetion features Names and addresses of respondents 2:2 conficentia! and are not released to DOE. Federal Energy Adminisiration Act of : amended)and the Energy Policy Acre?1992.OMB <Clearsnce Number:1905-014Va.Ali artha Johnson,CBECS Manager,Te.'ephone:(202)5386-1135 or Internet:mjonnson@eia.cce.gov. Authorizing Legisiation: Energycy research in the Commercial sector is authorized aces the Federal EnergyAdminisrationAc:of 197+,Public Law 93-275,as amended,and the Enerev Policy Ac:ofTheCommercialBuildingsEserzyConsumptilexSurveyDanECS),conducced by the Energy Information Administration of the U.S.Decanmenr:of z5out energy use in U.S.buildings.biwe oe 1992 (Public Law 102-486).1992 (CB nergy collects information= Respondent Confidentiality: All information,collected by the Energy Information Administration for the Commerciai Buildings Energy Consumecen Survey,that would permit identification of ressondents or their buildings is conidentz:and will be used for statistcal purposes only.Di:32that identify indivi"cual tTesponcen:s will not be disclosed or released to anyone (inctuding ¢Deparment 0of Energy.) Public Reporting Burden: Public reporting burcen for :his collection of information is estimated to averizz between3C and 50 minutes per response.Se:nd comments regarding this burden estimate or any cther aspect ofthis collection of information,including suggestions for reoti ducing this Durden,to: Energy Information Admini sationtliceofStatisticalStandards,EI-1000 Independence Avenue,SW. Washington,D.C.20385 and Office of Informarion and Regulatory Affairs Office of Management and Budgetaas Washington,D.C.20503 Dear Building Owner or Manager:. I am writing {0 ask vou (0 Dacticipate in a maior national study that will gather information neeced to beter understancAmerica's enerzy neecs.The Energy Information Adminiscration (EIA)of the U.S.Departmen:ofEnergy conducts a survey every 3 years on how enerev jsusedinnonresidential!buildings.Using STAtist rca!sampling methods,the buiidingg idennifiedontheoutsideofthislexer's envelopewas selected for the 1995 Commercial BuildingsEnergyConsumptionSurvey(CBECS). ecause CBECS is the only xnaconal survey of energy consumption in commercial buildings,ecaus it is used extensively by decisionmakers in Doth the public and private sectors :o help them emsanalyzepastenergytendsandforecastfutureenergyneedsinthe U.S. We have asked Weszat,Inc..2 survey research firm,to help us collect this intommazon.In the next few weeks,an interviewer will contact you foran aprcininent.The interviewshouldtakebetween30anc50minutes,Cepending on how the duilding uses energy.During the computer-assisted interview,vou or someone vou delegate.wi asked 2 provide information about general energy-related characteristics of the selected b To assist in answering some of the queszicns,we have enclosed a Worksheet as a guideline to the types of questions in the survey.The interview wil proceed more quickly and smooth.y if you have this information available at che time of the interview. ant3 ota the 'ater.Your perdcipation is voluntar-,however,your support will conmlDute greatly io the success of the CBECS and you are encouraged to respond.Because onlv a semole of tuildings' across the county are selec:ed.each selecced building represents approximate:+800 butidingsofsimilarizeanduse.Pleasesee the back of this letter forinformation regzccingauthorizinglegisiation,respe-dent confidentiality,and public reporingcurder. Thank vou very much for your he f . call Lee Harris at 1-800-9270289 or Marche Jonnson,the CBECS Manager 2:.202)38é-18ilmjacs!mile (202)386-001 y Markers anc Enc;UsetAgmi Enclosures we tes es hes i"FREatNEWS MEDIA CONTACTS:FOR IMMEDIATE RELEASE Hope Williams,202/586-5806 _January 24,1995 Keith Holloway,202/586-5806 CUSTOMER SERVICE CENTER OFFERS INSTANT ACCESS TO ENERGY EFFICIENCY INFORMATION 'The Department of Energy (DOE)today unveiled a CustomerServiceCenterthatprovideseveryonemoredirectaccessto advice on saving money on energy.costs.The center offers industries,utilities,small businesses and individual consumers easy access to the DOE's energy efficiency and renewable energy programs. "EREC"and "EREN",two information hotlines,will deliver the latest information and advice ranging from home insulation to developments in bringing solar technologies to market. Supported by specially designed computer and information services technology,the center's trained service professionals provide assistance and advice promptly and efficiently. Information offered through the center varies from brochures topersonal,technical consultations. EREC,the Energy Efficiency and Renewable Energy Clearinghouse,is accessible by calling toll-free 1/800-DOE-EREC, 9 a.m.to 7 p.m.(EST.).The hearing impaired may call 1/800- 273-2957.The EREC online bulletin board may be accessed through 1/800-273-2955.During 1994,EREC fulfilled approximately 45,000requests.se EREN,the Energy Efficiency and Renewable Energy Network,is an Internet site providing information in the form of maps, images,video and text.It is accessible to anyone with a moden,: full Internet access and a computer with at least 286-based capabilities.FREN can he accessed through the Uniform ResourceLocator(URL)http://www.eren.doe.gov.A year ago,DOE established an office in Washington known as the "Green Room"to offer consumers,businesses and utilities energy efficiency and renewable energy information.The Customer Service Center allows DOE to streamline its operations by closingtheGreenRoom. (MORE) R-95-005 .:®Printed with soy ink on recycled paper a U.S.Department of Energy e Office of the Press Secretary Ld Washington,DC 20585 a - 2- "The Customer Service Center allows us to offer a virtual Green Room accessible to every business,factory and home,"said Christine Ervin,assistant Secretary for Energy Efficiency and Renewable Energy."It will offer state-of-the-art customer service and help individuals and businesses to save money by saving energy,while also contributing to competitiveness, economic growth and job creation.” Over the next 60 days,several energy efficiency and renewable energy initiatives,called the Energy Partnerships for a Strong Economy,will be announced.The initiatives feature technical assistance,information,and education programs co- created with partners in business,industry and state and local governments.In addition to boosting economic productivity, increasing profits and creating jobs,the initiatives also benefit the environment.Information about these initiatives may be obtained through the Customer Service Center. "We are now working with over 850 partners in American businesses --large and small --on these initiatives,and they are already seeing the benefits,"said Ervin."Industries are improving performance,housing is becoming more energy-efficient, and utilities are employing energy efficiency options that are fueling their futures." The Energy Partnerships for a Strong Economy programs areguidedbytheEnergyPolicyActof1992(EPACT). - DOE - R-95-005 <-Calendar October 11-13 _. 1995 Affordable Comfort West 1995 Conference Orange,CaliforniaPhone(708)864-5651, October 17-18 Iowa's Pursuit of Energy Efficiency,8th Annual Conference,Davenport,Iowa.Contact Mary Holz Claus,Iowa Association for Energy Effi- ciency,(515)386-8423,fax (515)386-3778. November 7-8 ASHRAE Seminar,Complying with Standard 90.1 Call (404)636-8400, fax (404)321-5478. D.L.Painter (address corrections) Pacific Northwest Laboratory PO Box 999-MSIN KS5-02 . Richland,Washington 99352 o Setting the Standard November 7-10 HERSC-FREE Financing Renewable Energy Efficiency Conference,Desmond Hotel,Albany,New York.Contact CynthiaGardstein (202)638-3700. December 4-8 BETEC,Thermal Performance of Exterior Enve-lopes of Buildings,Sheraton Sand Key Hotel, -Clearwater Beach,Florida.Contact Pat Love, Oak Ridge National Laboratory, (615)575-4346,fax (615)574-9338. Let us know... ..about your codes/building organization's up- coming codes and standards-related meetings, seminars,conferences,etc.We'll distribute the | information to DOE and other interested readers through the quarterly Setting the Standard calendar. Send information (please include dates,place, contact person's name and phone/fax)to K.M.: Shoop,fax (509)375-3614,Pacific NorthwestLaboratory,P.O,Box 999 MSIN K5-16,Richland,Wasninigton1 99352 : OAC"Battelle Pacific Northwest LaboratoriesBattelleBoulevard P.O.Box 999 Richland,Washington 99352 DL Painter K5-02 Address Correction Requested David Lockhard Alaska Division of Energy333W.4th Ave.,Suite 220Anchorage,AK 99501-2341 A-1900-042(5/89) oO.U.S.DEPARTMENT OF ENERGYgBUILDINGSTANDARDSANDGUIDELINESPROGRAM Energy Partnerships for Better Buildings » U.S.DEPARTMENT OF ENERGY > BUILDING STANDARDS AND GUIDELINES PROGRAM PERAAHERERERAE__Setting the StandardDOEproposesVoluntary Home Energy Rating _3rd Quarter Volume 4 1995 ;Issue 3 System Guidelines To encourage uniformity among systems for rating the annual energy efficiency of new and existing residential buildings,the U.S.Department of Energy (DOE)isproposingvoluntaryguidelinesforhomeenergyratings systems.As directed by the Energy Policy Act of 1992_(EPACT),the voluntary guidelines call for -®auniform rating method ¢procedures for certifying the technical accuracy of building energy analysis tools used to determine energy efficiency ratings | ¢training for personnel conducting energyefficiencyratings. e data collection and reporting _©quality control '®monitoring and evaluation. The voluntary guidelines would be used by state and | local governments,utilities,builders,real estate agents, _lenders,agencies in mortgage markets,and others to assign residential energy efficiency ratings for residen-tial buildings and develop criteria for financing energy_efficient homes. What's the purpose of a home energy rating system? The principal purposeof a home energy rating system istocalculateauniformmethodforratingtheenergy performance of a residential building.As of 1993,a _ number of states had developed their own unique home ©energy rating programs.According to the National Association of State Energy Officials,14 states have statewide or citywide scaled home energy rating pro-grams for new and existing homes.Thirty-three states have utility-run home energy rating certification pro- grams for new homes in at least some areas of the state. In some areas,both state and utility rating programs .have been used.This variation in home energy ratingprogramshasimpededtheimplementationofenergy-. efficient mortgage programs because federal mortgageagenciesandlendershavebeenuncertainastothe "reliability of the ratings.A uniform rating method Energy Partnerships for Better Buildings would provide a reliable technical basis on which to underwrite energy-efficient mortgages.When finalized, the proposed guidelines are expected to help establish a _ market-based system that encourages homeowners to improve the efficiency of new,reconstructed,or existinghousing, How were the proposed guidelines developed? The proposed guidelines were developed in response to the provisions in EPACT and are based on work per-formed by the Home Energy Rating Systems Council __(HERS Council)at the request of DOE's Office of Build- -ing Technologies.The HERS Council is a not-for-profit corporation with a 19-member board representing stakeholders in home energy ratings.Members include builders,mortgage lenders,HERS providers,consumer groups,state energy offices and organizations,utilities, real estate agents and appraisers,and product manufac- turers.The HERS Council worked with representativesfromelectricandgasutilities,utility trade organizations,home energy rating providers,software developers, builders,product manufacturers,and the heating, ventilation,and air-conditioning industry.Using aconsensusprocess,the HERS Council formulated their recommendations to DOE.DOE provided technicalsupportfromtheNationalRenewableEnergyLaboratoryandPacificNorthwestLaboratory. How will the proposed guidelines work?. The proposed guidelines call for a single method ofratinghomesthatisconsistentwiththerequirements ofEPACT.The HERS Council considered several existingratingmethods,many of which use a 100-point scale butspecifytheextremes(0 and 100 points)inconsistently.To promote consistency among providers,the proposedscaleusesasinglefixedreferencepointfromwhich energy efficiency is measured.The reference point is-fixed at 80 points,and the proposed method assumes zero purchased energy at the top end of the 100-point -scale.The top of the scale (100)represents a 100%im- 'provement over the reference point.Therefore,each point above 80 represents a 5%reductionin energyconsumptionfromthereferencepoint.Conversely,at a (continued on page 2)- (continued from page 1) 5%increase in energy consumption per point,zero represents purchased energy that is five or more timesgreaterthanthepurchasedenergyconsumedatthereferencepoint.By selecting the energy efficiency of ahypotheticalbuilding(reference house)that remainsconstantasthereferencepoint,the rating scale becomesbothuniformandconsistentovertime.The proposed guidelines also include the use of a "star”rating system.This system uses a one star to five stars-plus scale,andthereferencehomelocatedat80pointsisawardedfour stars. A public hearing on the proposed guidelines was scheduled for October 17 as we went to press.Written comments may be submitted by October 23 to VoluntaryResidentialEnergyEfficiencyRatingGuidelines,Docket Number EE-RM-95-202,Buildings Division,EE432, Office of Codes and Standards,U.S.Department of Energy,1000 Independence Avenue SW,Room 1J-018, Washington,D.C.20585.For more information,contactRobertMackieofDOEat(202)586-7892. Update on MECcompliancematerials New compliance materials have been developed to make the 1992 CABO Model Energy Code (MEC)easier to use.These materials (collectively referred to asMECcheckTM)were developed to simplify the builder's or designer's task in demonstrating compliance and to assist the U.S.Department of Housing and Urban Development (HUD),the Rural Economic and Commu- nity Development (RECD,formerly Farmer's HomeAdministration),states,and local jurisdictions with enforcing the MEC requirements. The MECcheckTM materials include three products:a compliance and enforcement manual for all the MEC requirements,prescriptive packages,and software tohelpcomplywiththethermalenveloperequirements.The materials are based on a whole-house U-value x Area (UA)calculation that allows building components to be traded off against each other,thus allowing a wide variety of home designs to comply with the MEC. Requirements are given from the user's perspective.For Setting the Standard is published quarterly for the U.S.Department of Energy by the Building Standards and Guidelines Program at the Pacific Northwest Laboratory.Its purpose is to encourage information exchange among buildings industry professionals and organizations,state and local code officials,and researchers.The goal is to facilitate timely development and early adoption of the building energy conservation standards.We welcome reader comments and contributions. Editor:Rosalind Schrempf *Layout:Sharon Daly Hotline:1-(800)270-CODE Energy Partnerships for Better Buildings example,building shell requirements are given in terms of the insulation R-value,not the component U-value. _The software approach is the most flexible of the threecomplianceapproaches.The MECcheckTM software is designed to run on most DOS-based computers and allows trade-offs between all envelope components and heating and cooling equipment efficiencies.The software automates the trade-off approach,so minimal user input is required.The software allows the user to quickly compare different insulation levels to select a package that works best for their proposed building.For ex- ample,the user can select greater ceiling insulation levels to offset lower slab insulation.The software automati- cally generates a report that can be submitted to demon- strate compliance. Version 2.0 of the MECcheckT™M software was completedinAugust.Most registered users of Version 1.0 willreceiveanautomaticupgradeinthemail.MECcheckIM users in states that have adopted the 1993 MEC will not receive an automatic upgrade but instead will receive acopyofMECcheckT™M developed specifically for the 1993 edition of the MEC when it becomes available. The version 2.0 software includes the following enhance- ments and modifications: ¢High-Efficiency Cooling Equipment Trade-off.Themethodologyusedforthehigh-efficiency heating equipment trade-off in Version 1.0 was modified to allowconsiderationofadditionaltradeoffssuchascooling equipment,so there are also some differences in the heating equipment trade-off. ¢Revised Basement Wall UA Calculation.In response to input from users and reviewers of the version 1.0materials,the software now requires two additionalinputsrelatingtobasementwalls:the wall height and the depth below grade. ¢Crawl Space Wall Trade-Off.Craw]space wall insulation is now offered as a trade-off for unventilated crawl spaces (i.e.,not directly vented to the outside). ¢New Software Report.The software now generates an inspection checklist in addition to the compliancereportgeneratedbytheversion1.0 software. ¢Definitions.The User's Guide has two new appen- dixes that give definitions of frequently used terms and a _table of building elements and how they are classified(i.e.,as ceiling,wall,or foundation components). Version 1.0 of the MECcheckTM software has been available since November 1994.Over 3,000 copies have been distributed to builders,designers,code officials, and state and federal agencies.It is currently used locally or statewide in over 16 states. 'calculation procedures necessary for demonstrating .beta testing scheduled to begin in May 1996. Commercial code compliance software available Two computer programs,ENVSTD (envelope standard)and LTGSTD (lighting standard),are currently available through the Building Standards and Guidelines Program(BSGP)to assist designers in complying with commercialbuildingenergycodes.These programs implement the compliance with the system performance path (i.e,theintermediatepathbetweenprescriptiveandperfor-mance)for envelope and lighting sections of the federalcommercialbuildingenergystandard(10 CFR 435)andASHRAE/IES Standard 90.1-1989 (Standard 90.1).Both of these DOS-based programs have been updated periodi- cally since their creation in the late 1980s. ENVSTD was most recently updated in May 1993(Version 2.4),and LTGSTD was updated in September 1995 (Version 2.4.1).Both updated versions differ only slightly from previous versions.For example,the up-dates incorporate Canadian weather data,use updatedglazingassumptions,correct or reinterpret details of thecalculations,and provide more consistent and intuitive user interactions. In response to requests for assistance to the states,BSGPhascreatedafewcustomizedversionsoftheLTGSTD program.One such version includes an option to use thelightingpowerbudgetvaluesthathavebeenproposedfortherevisedfederalstandard.These proposed values correct recognized problems with a number of the 1993federallightingpowerdensities.The version of LTGSTD containing this option will be made available for generaldistributionaftertheproposedstandardisreleasedfor public review. Additional compliance software for commercial build-ings will be available in the future.In conjunction withongoingworkontherevisionstoStandard90.1,ENVSTD Version 3.0 has been developed.This Microsoft Windows application,developed by Eley Associates,is intended to be used with Standard 90.1R.The software will be made available as part of the public review materials.In addition,software for demonstrating compliance with performance-based energy codes isbeingdevelopedbyRegionalEconomicResearch,with Readers can obtain the latest released versions of ENVSTD and LTGSTD and documentation via the Internet from the BSGP worldwide web site at http://www.ased.pnl.gov:2080/bp/besp,or by calling 1-(800) 270-CODE. Energy Partnerships tor Better Buildings at eg Boks Se > oak U.S.Department of Energy&Dy Regional Support OfficestJossSVANwea¥Ny SEATTLE a 7 sv DENVER co (Includes American Samoa,Guam, Palau,and Northern Marianas)1 (Includes Puerto Rico and the Virgin Islands) FL Primary GlasfManufactupérs Council Pp G M YesENERGYREPORT Volume XIll -Winter 1996 A Newsletter Published by PGMC To Promote Awareness of State and Federal Energy Codes The proliferation of activity in the area of energy regulations,code development and state and utility programs has made it particularly important that the glazing industry and affiliated groups keep up-to-date on current energy issues.It is the purpose of this ENERGY REPORT to facilitate communication between the private and public sector,to encourage industry participation in governmental and utility programs and to promote energy efficient building products and practices. FEDERAL AND STATE ACTIVITY 'Rebuild America -is a multi-year program sponsored by the U.S.Department of Energy that works with regional and community partners to improve the energy efficiency of commercial and multi-family buildings.The program should save some $650 million dollars a year in energy and create over 25,000 new private sector jobs.In the next 4 years the Rebuild America Program will create 250 partnerships to retrofit more than 2 billion square feet of building floor space spurring economic activity in communities,saving energy and reducing pollution. As noted in the last issue of the ENERGY REPORT,6 pilot partnerships have already been awarded.In addition,8 consortium groups and 12 cities and states will be receiving funds or have been offered technical assistance.For more information on this program,contact the Energy Efficiency and Renewable Energy Clearinghouse at 1-800-363-3732. Energy R&D:Shaping Our Nations Future in a Competitive World -is a 500 page report that was delivered to the 16th Congress of the World Energy Council in Tokyo,Japan.The report analyzed global trends in energy use and efficiency in both energy intensive industries and in commercial and residential buildings.|Of special interest is the tremendous growth in energy use in developing countries,for example,energy use in buildings has tripled in these countries in the past 25 years.For a full copy of the report contact the U.S.DOE Public Inquiries Office at 1-202-586-5575.An abridged version is available on the World Wide Web (URL:hhtp://eande.Ibl.gov/EAP/WEC/wec.html).. 3310 SW HARRISON ST ¢TOPEKA KS 66611-2279 ©(913)266-3666 *FAX:(913)266-0272 cp It Greenhouse Gas Emissions -A natural byproduct of increased energy usage is an increase in the emissions of carbon dioxide.A recent study by the Energy Information Administration showed that total greenhouse gas emissions increased annually by 0.6 percent from 1990-1993.(Copies of the report are available from the U.S.Government Printing Office ph#202-512-1800).In. order to mitigate the increase in global emissions,the United States and other industrial countries are considering adoption of a United Nations Framework Convention on Climate Change.If adopted,the U.S.would be committed to reducing emissions from many sources,including industrial energy use.How this may impact energy cost and the competitiveness of the six most energy intensive industries (including glass)is a concern for the United States. Argonne National Laboratory is managing a project to discern the potentialimpactfromarestrictiveemissionspolicy. NICE®(National Industrial Competitiveness Through Energy,Environment and Economics)-is a DOE cost-sharing grant program that provides financial assistance to states and requires industry as an active partner to foster energy efficiency and reduce pollution.A cost-sharing solicitation of $400,000 was distributed this past December.If you have questions regarding this program, please contact Sheila Edwards at 404-347-7145 or call the National Information Hotline at 800-DOE-EREC.U.S."DOE Officce "of Codes."and Standards --sponsored:four regional , workshops last year to assist state officials,building code commissions and energy offices with energy code implementation and enforcement.A summary report giving the highlights of these workshops is available from Pacifi cNorthwestNationalLaboratory(ph:503-331-2626). UPDATE -ENERGY POLICY ACT Foreword -The Energy Policy Act of 1992 mandated that states adopt energy efficient building standards for commercial buildings equivalent to ASHRAE 90.1.In addition,the states were to consider adoption of the 1993 CABO MEC (Model Energy Code)for residential construction.The following actions were taken by states in 1995 in response to this initiative: Alabama -Has recommended to the local governments (county and city)that if residential building energy codes were to be adopted,those governing bodies must adopt the 1993 CABO MEC or equivalent.Florida -Held hearings and certifi ed to the U.S.Department of Energy ththat the:state provisions for residential and commercial construction do meet or exceedthe1993MECorASHRAE90.1 respectively. Georgia -The state has certified to DOE that its energy codes meet or exceed the appropriate standards. Idaho -Has made some changes upgrading its energy code,_however,it hasnotyetcertifiedtoDOEitmeetstheappropriatestandards._ Maryland -Reports that the state code officially adopts the latest version 'of theBOCAcodeasitbecomespublished.Since the BOCA code references the Model Energy Code,the state will automatically adopt the latest version of MEC. New Jersey -Reports the same as Maryland,however,allows for some revision by the Department of Community Affairs. North Carolina -Adopted ASHRAE 90.1 as the energy code for commercial buildings effective January 1,1996.Discussions as to whether or not to adopt the 1995 CABO MEC will begin this year. North Dakota -The 1993 MEC was officially adopted last October (also includes ASHRAE 90.1 for commercial buildings). Rhode Island -The 1993 MEC officially became law on January 1st of this year.| Utah-Has adopted Appendix Chapter 13 of the UBC (Universal Building Code)with a sole reference to the MEC and ASHRAE 90.1. TECHNOLOGY UPDATE PowerDOE is a building simulation /energy analysis use computer tool being developed by Lawrence Berkeley National Laboratory (LBNL)for release in April of this year.The new program combines the energy evaluation tools of DOE2.1 (for commercial buildings)with a user-friendly windows interface.For more information on this powerful new software package,contact Kathleen Ellington at510-486-5711. Infrared Thermography is an instantaneous technique for qualitative evaluations of the heat transfer of building envelope materials.By mounting a test specimen to the opening of a cold chamber and scanning the room-side surface of the specimen with an imaging infrared camera,LBNL has been able to create an infrared image or thermograph that is a visual representation of the energy radiating through the test specimen.Window manufacturers have found this process especially helpful in evaluating the heat loss through window frames and through the "edge”(where the glass.and sash/framing system meet); because it can identify hidden thermal bridges that conduct the heat through thefenestrationsystem.For more information on this technology contact BrentGriffithat510-486-6061. ORGANIZATIONAL ACTIVITY ASHRAE (American Society of Heating Refrigeration and Air-Conditioning Engineers)-is holding it annual winter meeting from February 17 -21,1996 inAtlanta,GA..For more information contact ASHRAE at 404-636-8400. ASHRAE 90.1 -"Energy Efficient Design of New Buildings Except Low-Rise Residential Buildings”is being revised and will go out for public review shortly. The proposed revisions have been held up for almost a year due to conflict | between the natural gas industry and the electric industry.The same conflict is responsible for a difference of opinion with regards to the proposed new Home Energy Rating Standards (HERS). ASHRAE 90.2 "Energy Efficient Design of New Low Rise Residential Buildings” is being revised to provide for a simplified fenestration compliance component. It is hoped that a revised 90.2 will go out for public review later this year. Building Energy 1996 -Is a coalition of three conferences,a trade show and workshops promoting resource efficient building and renewable energy generation.This conference is sponsored by the Northeast Sustainable Energy Association (NESEA)and will be held March 3-6,1996 at the Copley Plaza Hotel in Boston,MA..For more information call NESEA at 413-774-6051. GLASS WEEK '96 is scheduled for March 3-6,1996 in Palm Springs,CA.. Glass Week is the annual meeting for the GANA (Glass Association of North America)and SIGMA (Sealed Insulating Glass Manufacturers Association).For more information call GANA at 913-266-7013. NFRC (National Fenestration Rating Council)holds it annual spring membership meeting in Boston,MA (April 17-20,1996).For more information call 301-589- NFRC. The 21st Passive Solar Conference will be held April 13-18,1996 in Asheville, NC in conjunction with the 25th American Solar Energy Society and the Solar 96 National Solar Energy Conference.For more information call 303-443-3130. JESSICA S.LEFEVRE ATTORNEY AT LAW 908 KING STREET SUITE 200 ALEXANDRIA,VA 22314 TELEPHONE (703)836-3515 FACSIMILE (703)548-3181 March 18,1996 Mr.David Lockard Community and Regional Affairs 333 West 4th Avenue Suite 220 Anchorage,Alaska 99501-2341 Dear Mr.Lockard: I am writing to request information regarding energy efficiency and performance based contracting in your state.Would you please forward to the above address any information you may have on this topic including marketing materials,information on financing and copies of relevant legislation. I also would request that you please indicate below which public facilities in your state are authorized to utilize energy efficiency and/or performance based contracting and return this letter with your package of information. Schools Colleges Cities and State Please check all that apply. Thank you in advance for your response to this request. Sincerely, Deasen 4 LoaferJESSICAS.LEFEVRE JSL/ad N AESC? NO -forded hardthoek fe Leilit v2Archerhite,bap ©E- Keret Native Corp owns an ESCO! fotey -7/26 Do you be ow G F ony |leg al vy ON Espo No- \Wear Ye ve SuneProposalsfrownThestewCemwotie<Vn Hers ree? Final 8/16/95 REDEFINED REGIONAL SUPPORT OFFICE MISSION AND FUNCTION STATEMENT Background 'On May 3,1995,Secretary O'Leary announced,as part of the Departmental Strategic Alignment Initiative,a streamlined Regional Support Office (RSO)operation consisting of six rather than the current ten offices.This major change results from a fundamental rethinkingabouthowworkisconductedintheDepartmentandisdesignedtocreateawayofoperatingthatcostslessandworksbetter.The Energy Efficiency and Renewable Energy (EE) organization has truly "reengineered”its grant-making functions by both consolidating and streamlining the applications process,and by giving grantees much greater flexibility in-choosing how to best achieve the goals of increased deployment of renewable energy and-energy efficient technologies and practices.This reengineering will free up resources and - allow the RSOs to fulfill their new mission,which is more explicitly tied to technology deployment activities and the idea of partnering with customers and stakeholders in the field.”'This is a further step in the paradigm shift from grants administration to marketing of EE technology and practices.The following statements outline the major new mission and function of the Redefined Regional Support Offices: - 1 As mutually negotiated with EE Program Managers,provide project managementorlogisticalsupporttoselecttechnologydeployment,technical assistance,¢or programdeliveryactivities. 2.Serve as catalysts for technology deployment partnerships.Act as EE customers' "broker"to facilitate partnerships with other parts of DOE,State agencies,other , .Federal agencies,utilities and the private sector,especially at the regional level. 'Coordinate/communicate efforts,keeping sectors and other interested parties fullyinformedofcontactsintheir.area. 3.Facilitate and promote regional energy-related planning efforts. 4:Communicate EE customer needs and opportunities to Headquarters.Work withStatesandothermajorpartnerstoensureeffectivetwo-way communications between°EE Programs and their partners.Keep EE Programs informed of regional,state andlocaliissues,actions and opportunities of significance to those programs.5.In conjunction with the Golden Field Office,which has oversight of the contractofficerfunction,use streamlined procurement procedures to develop and execute,in "an expeditious manner,the contracts,grants and other procurement instrumentsnecessarytoadvanceEEprogramactivitiesassignedtotheRSOs. 6.Provide limited technical assistance for State Consolidated Grants.States will beassumingmuchgreaterresponsibilityforthemanagementandoversightofprogramsunderStateConsolidatedGrants. 7.Represent EE interests through participation in such activities as Regional FederalExecutiveBoards.Regional Energy Boards,Energy Councils,and other groups - having an interest in energy issues.In coordination with EE End-Use Sectors,reach out to other Federal agencies to promote the interests of EE and its partners. 8.Provide collateral support for key headquarters elements (e.g.Secretary's Office) on an as-requested basis.This includes advance work/logistical support for VIP -visits,support for public affairs events including conferences,workshops and public_hearings. INTRODUCTION TO THE CONCEPTS OF SERVICE QUALITY SEATTLE REGIONAL SUPPORT OFFICE March 20,1996 A. C. D. Contents WHAT IS SERVICE QUALITY? WHO IS INVOLVED IN SERVICE QUALITY? WHY IS SERVICE QUALITY IMPORTANT? WHAT ARE THE KEY SERVICE QUALITY CONCEPTS? WHAT ARE THE KEY STEPS TO PUT IT IN PLACE? A.WHAT IS SERVICE QUALITY? o Customers today expect more accuracy,responsiveness, personalized treatment,and flexibility.Organizations and individuals need to look for new and better ways to meet these expectations. o _SRSO has decided to focus on service quality to meet these expectations.Service quality means providing core service (the reason customers come to us)that meets customer needs,and customer services that exceed expectations. Service quality seeks to improve both core service and customer service.It seeks to provide positive experiences for its customers and strives to improve the work processes that create the experiences B.WHOIS INVOLVED IN SERVICE QUALITY? O Every member of an organization -- AS2. RIE QA v Gene a OQ Focus Shift In-Focused Organization GEESEarie -Sow SeeWeyWfo- Customer-Focused Organization OQ The Disney Model WHY IS SERVICE QUALITY IMPORTANT? 0 Executive Order requires it. DOE/EE are committed to it. We have competitors,and: -more than 90%of customers who are unhappy with the service they receive will never "buy”from that company again. -over 95%of unhappy customers will never tell you they are unhappy with the treatment they received. -while unhappy customers won't tell you,they will tell others.Unhappy customers will tell at least 9 other people about their experience.More than 13%will tell at least 20 people how poorly they were treated. Most jobs in this country are service related.Customer service skills are transferable from job-to-job. We can apply what we learn in our day-to-day activities as customers. D.WHAT ARE THE KEY CONCEPTS OF SERVICE QUALITY? o Customer Report Card O Customer Moments of Truth o Cycles of Service o _Customer Service Strategy CUSTOMER REPORT CARD A Experience Customer Grade enact \/L nocks - Their Socks ee AYYCcOff U Dazzied S qT Exceeds (39 B@)ExpectationsPp M Pleased or Happy E R ------Yue.AS -__e -C --j-S 4)Expected E Satisfied R : V Fails,|Customer Not D ,c Cc Dependent | v EO Irritated or Anary R .E Fails,Customer FDependent Y Outraged ©1992 Kaset International Concepts of Service Quality 7 MOMENT OF > TRUTH Any experience customers have that gives them an opportunity to form an impression about your service quality. Kaset International ,Concepts of Service Quality CYCLE OF SERVICE | The complete set of experiences customers go through trom the time they identify a need until that need is fulfilled. Cycle of Service Example Need Fulfilled Need Identified Leaves office Parks car \ The internal processes «<-thatsupporthe --» moment of truth cre invisible fo customers "|* Conducts :Enters officebusiness Asks forWaitsinline.;information Directed to proper person 10 ©1992 Kaset International Concepts of Service Quality E.WHAT ARE THE KEY STEPS TO PUT IT INTO PLACE? fe)Understand customers and needs o Complete a service strategy o Chose the right focus cycle of service/moments of truth o Develop standards o Empower staff o Implement and reinforce i] AGENDA SEATTLE REGIONAL SUPPORT OFFICE CUSTOMER MEETING MARCH 20,1996 Meeting Objectives 1)Provide an opportunity for participants to network and get to know each other,2)Provide a forum for participants to share information on current developments and opportunities in their organizations,and 3)Identify ways that we can work together as a regional energy network. 8:45 Registration (Coffee and bagels provided) 9:00 Welcoming remarks KATHY VEGA 9:05 Participant introductions and identification of expectations for the day.ALL 9:25 Brief update on developments at DOE HQ ERIC THOMAS 9:30 New structure and focus for the Seattle Regional Support Office -The vision and new mission KATHY VEGA -New structure and staff responsibilities KATHY VEGA -Multiple site locations KATHY VEGA -New relationship with DOE End Use sectors.(Task Order Agreements)JULIE RIEL -New program developments/initiatives JEFF JAMES -Customer service and marketing PAUL JOHNSON o The new Customer Focus )Account Representatives fe)Marketing Group feedback and discussion on these changes and suggestions to ensure a smooth transition ALL 10:30 BREAK 10:45 State,territory,Navajo and Lab participants (by organization)provide brief (about 5 minute) updates on latest developments and accomplishments in their organizations. 12:15 12:30- 2:00 2:00 4:00 Recap the morning's discussion and identify topics to discuss in-depth later in the afternoon. LUNCH Small group discussions (Topics to be determined on the morning of March 20th.) ADJOURN PAUL JOHNSON US DOEMte 7/29feJ |Nee NEFYO =Felow,LyinMeneses,_CoemUBPAZilyEMP,fA Fa-SEP ctf Pek:mety ics 0.por dl ving 7 ”Lean Rreh.Heen Ma bovs Ron Torgen se?ASHRAE FO] Dele Sertov-LB)Bly.Teck. |wsnnle-Bblic Zyfe. BD boe De-vo*(OTEA >0ffe of Hey.Teel?Mery frobr_(ene VasVlerdven."INT:of OfoF FHyher Gren On. _PragvensZ.4 %Lnson -R-A. SEP-F250 Jey pitg_LhgveerWX#10 im td ' . on .B ° |- x - i .: 1 i '..o ....:\ \ + .r . . : .\. ve .* +oe, . 1 i ,. t --4 Ne_v O 7%Ze Lt):|7 f Ay v_y¥-ont -|Cop CcJ0»\ae -P poet H ) Meet _fee o>fv2.Lnref gore ists +o totes Co aee t_sterdarvad $=neg yr Alb.£;De kk >clear eV}egpre g LE =4)Rortip emer 7 44projec"5|GSA,Mv1,W Enexgy EFL.Chere\|r et.mo Loy cd ante to Yo A CKader ,I |ied Pert ner Pog vam IC]; Che te pl ph otblk got Coa -Clinde lvaWhee /Cfellergo CE PA SDE)OR =_p:|ae | -- U_=p rn __¥ O -- -<f Ls4,-on -yy Us _- os a ._ 3oPel-Coker +DA.' Gx ent boy codes sv hime,4.w/0 ded!SneTA.available 4,RP.A / Sustatrable Develop mut -Denver. &,lo,energy Tim ae:they,T-T. Us pirded mada _<act wy 1 BE rensued k NEF OCSporwloctve$|locat ong,types pF Prep Kevvews,SEO pet.epprenal OF Sevmmear)ze OOF j nTo__ToOurc'es e Pi |=AK WARM -r D_enexgy privet Lanes. Cc £2 [ec.vehicles LA Yowem'pe'Bo bhe.sector /gen__progvems.-py 1g At |S heels, |Pp al°F YON,EE ewgy-lee hoy Joa Cte,7PV£E loens.4 AZ 7 neve ne bord oem ome lage - yh!I Melvale bldg.stordacds,Searerty 7 AO.AK conss ls wv Qe _;HAs WY to ob LoD'ebatenath 2 nT,Jen a LT D ech.bDwsy-shite wide»nLN »20a ee.bye -A ese!Exexey Loon Pra OVEZF ptWhehpVy0gEmsnestbe.Ss opritedl byDEP PO Foopermony used for bitdges "poade.BAmn[2-245 iy ciate bly.vebcolthtlmlh.Ql.<filiSuch.ev.-syd Ff;OVS adits +pel cf tsatoxcreditforalt,feel vehielesOFZotdoelec.f-e/*Lb stitpersiitEebogQQaneTele .-Cdnar,Se ners hepv 'Foote -WX Ce KingUyaklenbetypieg,ode lodejoclete,«Leahjotlefoecety COoaw =Comp.F nora )P)2, WA Pobhe pidge Chellenge CFEmpl)Precodet_jRoOoPe __Cov.csonteslg PVE.JPolyps-ipa ryemprodves7 etlerelVOW,fe.IF lvraéw- _Grosidettel)(ae Te tech real tyrl yp &reg lon i] \ ; fo ° |!4a||i|| | !| i : ; H | !:| \ ; | !i | : |i Py . ,|||| ! | | | i | Z | | fo. ne |+ | { Le pS_lidey!ig hing,y Ad.bsezes,.-ufrdArws DOK ABrEkSy.TEIN Bewor \[ersbe yevey tah,_ ferguaser!4a fgue SF.Prestd\o ,eppp hence.herdlecds,-cenmrilly EEC,ing L)a :iE Dewey Confer!systems,R.A.oa ihedoo!bits -conctor'ney rec-commlssjonihg,nig. 5 hee bese ly}Quo killy Conlon bee filly.Severe MaltheOK-oa Alnee hep,yee,pong lecftneelCons2zry”edtn seROKI]-_2==p ordled le<eetdl Bode,Vey vu.homes,var CoOMmMmmnvtt.OR Offhee of Fnongy Mr (PWN)$00)_e mphyets _kfl 60%DOE Sod).30 L of buy Fetes JO To pvi vite sacterfeo -O rgenizatijon,Orxhy slotted Tesh Bes)'CodP28KTellFoye|-éD0-wie COVE Coren:WNL1SAS ech}1 Co ohStedade,ior]Work!i Jip - felas-PV lig Ey may [FO slr fi he masouditeof.FON -kg Et lanl ateola nd hee wel. , r ne abepone nee L.Ly L web_eaeppt aa)|aostailedleyadetgyOeSodsGHoil,(eZ2T#t:AK 3)507 36%of?tnports_vee es,y atef-flewmats)4asa ed Sper 4 §eens!'Models,6.0.8__;veer fouse FSESHKReportpodpeetfet!)|Foe eset eyvan Sren4'y hulem y3Cordectedrenewable»DSH pedis isLrenspovkeLina.<ff ix .Vo hovabiltyKLseLfparkZ:SeeT PY ponebrasGap_pertep hf MEC1ev-OW MLIne ano|By gear hn TRP processqhTeekhntlogyYahtatsCc]:Lp a +s 0D 4A HEpO jn rhe cheeupe_Energy 100 On.PromedeCEML-PEP VSZOnh.rrodel Tuc. VREL-renewed!yy hed Cela.owt|cub"V toad Leh ney,Moevdlin,FE ek,”(Olea,tpebrommb<alh brabien,sodrelysls-he nome ¥pe gouree Sh _Brengy _detoxitice pee ste P-sus tech C64 Y __pain CUE sehal_hosesSTEP-QR: \| |_a A_$LO0,000 Fn On."ft ot ley tech a Wind 1 by S07 Std [eb Connondcatioy, Codec Loyhil Sélence _”Cntysro Ann oe,=Cub <3 S&L Ln Koduk H swail pet Name Pege Ask Lear eS ntey nel presentation Use ERIC J Use aee't neps *Clowie)_ AVION NZ Oa k ptagej---BarRel "y}PNL S K ndian,UREL All.States -7 NASEO ity CBiloy,MS is, |Avo.)Lob nerd:©energy on ¢ed'Ss ul 5 ee Lice.6 i.-Z i Apyeas an 7™_seyzyaa aa pe S ECP 7pier itayritisrtWd ay ng tyVe yy US3[SPORot.S39 Y= - SENT BY:DCRA,DO ;8-19-96,i,6°57 +DCRA DIV OF ENERGY?807 269 49eRm PS ee ee wee Wind bt ws bod BL SSE §we Department cf Energy Seattle Regional Support Office 800 Fifth Avenue,Suite 3950 Seattle,Washington 98104 March 14,1996 Dear Colleague: UPDATED INFORMATION ON THE SEATTLE REGIONAL SUPPORT OFFICE CUSTOMER MEETING ON MARCH 20TH Attached you will find the updated program for next week's customer meeting in the Seattle Regional Support Office.We've been extremely pleased with the level of interest expressed inthismeetingandthenumberofpeoplewhohaveregisteredtoparticipate. Please note that a major purpose of this meeting will be to exchange information about the latest energy-related accomplishments or developments in our region.To accomplish this,we have scheduled some time on the agenda to talk about what's new with DOE and the Seattls Regional Support Office.In addition,we'ye set aside about 90 minutes on the agenda for states, territories,the Navajo nation and DOE laboratories to update participants on their latest accomplishments.Because of the size of our group,we are asking that each of these organizations limit their remarks to about 5 minutes.To supplement this information,I encourage you to share written materials with your colleagues.Please bring copies of these materials with you and we will see that they are shared with participants, One final note.We have triade reservations at a local seafood restaurant for lunch.Just let us know on the morning of March 20th,if you can join us. We're looking forward to meeting with you next week.[f you have any questions,please give me a call on 206-553-2154, Attachment SENT,BYDCRA,DOE |, a >§-19-96 ;8:58 ;DCRA DIV OF ENERGY-Pein MW.CUUUIVECUYUwesvietalweRndTASLNB MARCH 20,1996 907 269 4685:#3r.97 U4 SEATTLE REGIONAL SUPPORT OFFICE CUSTOMER MEETING Expected Attendees About 50 people,including staff of the Seattle Regional Support Office and representatives from 1)state,territorial and Navajo energy and weatherization offices,- 2)national laboratories,and 4)DOE HQ. Location The meeting will be held in the Seattle Regiona)Support Office conference room,38th Floor,800 5th Avenue,Seattle WA 98104, Objectives This meeting should provide an opportunity for participants 1)to network and get toknoweachother,2)to share information on current developments and opportunities in their organizations,and 3)to identify ways that we can work together as a regional energy network. Agenda 8:48 9:00 9:05 Registration - (Coffee and bagels provided) Welcoming remarks Participant introductions and identification of expectations for the day. Brief update on developments at DOE HQ New structure and focus for the Sestile RegionalSupportOffice -The vision and new mission -New structure and staff responsibilities -Multiple site locations -New relationship with DOE End Use sectors.(Task Order Agreements) -New program developments/initiatives .Customer service and marketing °The anew Customer Focus °Account Representatives rs)Marketing Group feedbackand discussion on these changesandsuggestionstoengureasmoothtransition KATHY VEGA ALL ERIC THOMAS KATHY VEGA KATHY VEGA KATHY VEGA JULIE RIEL JEFF JAMES PAUL JOHNSON ;-BBB:-B5:#4SENT,BY :DCRA,DOE |'Tw uw wus 3-19-96 ina 4 8 :58 ,DCRA DIV OF ENERGY':907 269.468°Ud 10:30 BREAK 10:45 State,territory,Navajo and Lab participants (by organization)provide brief (about §mimute) updates on latest developmerns and accomplishments in their organizations. 12:15 Recap the moming's discussion and identify topics to discuss in-depth later in the afternoon.PAUL JOHNSON 12:30- 2:00 LUNCH 2:00 Small group discussions (Topics to be determined on the morning of March 20th.) 4:00 ADJOURN FAX NO,2065532200USDEPT.OF ENERGYMAR-06-96 WED 14:02 tjv/osbdmeat" vst | ° i =.:| laywari % a<{ ous} S & o od = » Says aneAYYizt is -- RISERS fopayss :$Ay »>-on mereaWa rts A eeteYs "a. wsHOW =e 4 WANG ARab ndsAh 0 >P= eA ARNey;ol Cc Sad __|s fflay pspasey _- yporsyAcg |. Nw AY jUqwiey5ENlaafetehe ; okae pleimesa " £ 9 Ay bnagyeg eg > = --/! E , : 4 me 3| = nsez Ny i\a | aw jeA Ay ans Dbef juog |___Ry 'y > Sit 0 i 2 K) Yo OT ywis " vy 4 ”ba ng v sRy-be 4%or -- = Ay) "n S$ o0g) yg 4%e, eVxs Ly; a V7a/ Frys . Ky gh ' OK4 : ™ MAR-06-96 WED 14:02 US DEPT.OF ENERGY FAX NO,2065532200 \uCa {0 Ce *FAX #:(206)553-2200 P,01/02 FacsimileCoverSheer -ReelOne 800 Fifth Ave.,Suite 3950]Seattle,WA 98104 pe Zhis transmission consists of 2page(s),triclating das cnver sheet.Call theoriginatorofthisdoeumentifyoudvnolreceiveaclearundcumpleletransmissionofthisdocument, TO:David Lockard FAX NO.907-269-4645 DATE:3/6/96 ORGANIZATION:AK Department of Community &Regional Affairs FROM;Paul Jolson PHONE NO.(206)553-2154 MESSAGE; thank you for confirming your attendance at the Seattle Reyional Support Office meeting on March 20,1396.We iook forward to meoting with you and sharing information and ideas of mutual interest tu all the energy grantees.Wa currently anticipate staff attendance from the States of Alaska.Arizona,California,kawaii,Idaho,Nevada, Oregon,and Washington.We elev have confirmations from Guam,and the Republic of Palau. We have attached a map detailing tke locations of the Mayflower rark Hotes and the seattle Regional Support Officel «a walk oS seven biocks). Please let us know if we can be af any other assistance to you.You may call me at 206-553-2154,Laurie Brown,at 206-553-2158,or Richard puraam at 206-553-2168, Paul Joboson L begionO:\WPDATA\MFSD\BLKEFORM\SSOFAX.FRM April 19,1995 you an enjoyable visit to our Welcome to Seattle! Welcome from all the citizens of Seattle.We wish attractions include the waterfront,Pike PlaceMarket,Pioneer Square,Woodland Park Zoo,andthewonderfulSeattleCenter.We know you willenjoyourNorthwesthospitalityatallofourbusinessesandattractions.Enjoy your visit andcomebacksoon.GorFe beautiful city.Seattle's ttle University 'lorman B.Rice,Mayor = M951.1990»NickolasDamascus,.tteaches'a*at'"Seattle "University,yand..is.-now »Professorritus.2:4, 38aS "ida Par :'LSALISUBAINNWanGINtapusMASONASONW OPER otaJERRYAVE. cz.|(386-4320). 3sc-]I-hour narrated loop tour of Seattle's top attractions.On &off priveleges 2/1 Home of Pyramid Ales and Thomas Kemper Lagers.Tours and tastings,gift35Suites o=Jewellers:4 Cavanaugh's ° aauuw INN Open 6/96 «=ore:fete)pt.NeighboreeGFtSsoprass,ar +aS AVE ERR4,”ORREG a3Newmark&Center Mall Sogees AINESET °CLOTHING |FHINESE).;GENGHIST +Be R=|KRANffEWATCHES ..oeattle Art... eum - Bistro ryrare%2.BAY PAVILION °F Bors <es pes Bp tam 56 eg 4 ARGOSY echnology iin the production of these colorful Tourmaps.-gael cad Ta i:Sorrento Hotel>a Restaurant .2nd AVE.°--.--oa .rare mee :py Warshal's.:Bical"SS Poe Le Sportin =.G ery tes Goods Co.* .Restaurant *ag .'2 pe PDcali+'S"en Secs. 9th AVE. Things FORA VISITOR TO DO &Take a 4-hour trip to TILLICUM VILLAGE &Blake Island Marine State rk for an indian-baked salmon dinner &entertainment.443-1244.- Visit THE BAY PAVILION and enjoy year round festival shopping,an [= exciting variety of restaurants,and ride on the majestic carousel. Alaskan Way &University Street,Pier 57.623-8600. PURE FOOD FISH MARKET in Pike Place Market cold-packs fresh salmon &seafood for airline carry-on or Federal Express.622-5765. On Pier 59,see Mt.St.Helens erupt at the OMNIDOME (622-1868). At the SEATTLE AQUARIUM,explore fascinating exhibits of marine life Cruise the Locks,a 21/2-hour cruise of the famous Ballard locks fromPier57,or an exciting one hour narrated tour on Elliott Bay fromPier55.Year round Departures,623-4252. BONUS 1:SEATTLE TROLLEY TOURS.Interesting &educational at each stop.Board at waterfront or downtown booths.626-5212.iBONUS2:See specialty Lagers &Ales made at HART BREWERY &PUB,{ shop,and full service pub.Just south of the Kingdome.682-3377. BONUS 3:Enjoy the view of Elliott Bay and Seattle's skyline whilediningoutsideatLEOMELINARISTORANTE.io£.,,Medical Cente wedese ints Restaurant wee gies ."Vintage Park "LSONIUdS|;Cortina Restauran «Alexis Hotel:Ricemineesinde cBAA etdPOSTAVE.-szo*.Rama ThaiRestaurant yep WESTERN AVE. Shopping Waterfro 7eyLandm7 Blake tsland==.|Marine State Park |-a -- ARGOSY Page =4see heiae**a eejeeteats+'LSVIGINNI0D1979TheSeattle-sy pe $sg.d000..espresso.coffee.'bar craze starts|fin Tn Area)>here at Pegasus,-:the city's oldest,-.Sin.the-Dexter :"4gsame=Horton..Building <3 "a,Alki Homestead »Restaurant ». ilosidcf 8 4 5 5 5 B 6 oe\OwmPAWANADWOWue5 5 4 5 a4 Welcome to Seattle!ox tue cover Discover Piers 55 &56,Seattle's Central Waterfront,where you'll find harbor tours,15 unique shops and a variety of restaurants.Visit Trident imports,Seattle's largest import store open every day 10-9,take a boat trip to Blake Island's Tillicum Village for a salmon dinner and explore the site of President Clintorr's APEC Economic Summit. Us poe Me On)fifth -Gefween mariont 1]basColu™'4 -COMMODATIONS ALEXIS HOTEL European luxury hotel.1007 1st Avenue.624-4844. CAMLIN HOTEL European boutique style hotel.Downtown locale.1619 9th Avenue.682-0100;(800)426-0670. CAVANAUGH''S INN ON FIFTH AVE.Seattle's newest hotel.Dazzling city & sound views,full svc.Open 6/96.1415 5th Ave.442-5555;(800)THE-INNS. CROWNE PLAZA SEATTLE City Views restaurant,Sax on Seneca Lounge, Health Club.415 Rooms.6th &Seneca.(206)464-1980;(800)521-2762. DAYS INN TOWN CENTER 2205 7th Ave.448-3434;(800)225-7169. DOUBLETREE HOTELS SEATTLE At Southcenter.575-8220. THE EDGEWATER Seattle's only waterfront hotel on Pier 67.728-7000. FOUR SEASONS OLYMPIC HOTEL 411 University Street.621-1700. GREEN TORTOISE Guest House.715 Second Ave.N.282-1222. HOMEWOOD SUITES 6955 Fort Dent Way.433-8000;(800)CALL-HOME. HOSTELLING INTERNATIONAL-SEATTLE 84 Union St.622-5443. HOTEL SEATTLE 81 Rooms in the heart of the city.315 Seneca.623-5110. HOTEL VINTAGE PARK 1100 Fifth Avenue.624-8000;(800)624-4433. INN AT QUEEN ANNE Studios.505 Ist Ave N.282-7357;(800)952-5043. INN AT THE MARKET French country hotel.Pike Place Market.443-3600. INN AT VIRGINIA MASON English country style hotel with fireplace suites, Rhododendron Restaurant.1006 Spring.583-6453;(800)283-6453. KINGS INN 70 units,heart of downtown.Free parking,HBO.Near Westlake Center,Monorail.2106 5th Ave .441-8833;(800)546-4760. THE MADISON HOTELA Stouffer Renaissance Hotel.553 rooms,spectac-ular views.Roof-top restaurant and pool.Sixth &Madison.583-0300. PANEL (B =BACK) ig MARRIOTT RESIDENCE INN Extended Stay Suites on Lake Union.624-6000. MAYFLOWER PARK HOTEL 173 ms.Prime location at Westlake Center.Covered access to 80 stores.Elegant hotel with crystal chandeliers,fresh flowers,gleam- ing brass.Clippers Restaurant /Oliver's Lounge.4th &Olive.623-8700. MEANY TOWER HOTEL 4507 Brooklyn N.E.634-2000;(800)899-0251. Sy PACIFIC PLAZA HOTEL Historic European hotel.Free continentalbreakfast,cable TV.Comfortable rates.Red Robin restaurant.F<)Ath &Spring.623-3900;(800)426-1165. PARAMOUNT HOTEL Downtown Seattle's newest hotel.Featuring 148spaciousguestrooms&suites,restaurant,valet parking and a fitnesscenter.Opening summer 1996.Corner of 8th &Pine.(800)426-0670. PLAZA PARK SUITES Next to Convention &Trade Center.193 spacious suites with separate bedroom,living room,kitchen &balcony.Fireplace &Jacuzzi avail-able.Yearround outdoor heated pool.Pike St.at Boren Ave.(206)682-8282. PIONEER SQUARE HOTEL &SALOON Newly renovated,small,elegant boutique hotel.Very affordabie.Heart of Pioneer Sq.77 Yesler.370-1234.- QUALITY INN CITY CENTER Free bike use,parking,cont.bkfst.24-hr.hot '§tub/sauna/fitness.Wyland whale murals,museum.2224 8th Ave.624-6820. RAMADA INN Located in the heart of downtown.Walking distance to WestlakeCenter,Seattle Center &Space Needle,Pike Place Market,Waterfront, Convention Center.2200 5th Avenue.441-9785;(800)228-2828. ROOSEVELT HOTEL Located in the heart of downtown.Steps away from Westlake Center,the monorai!to Seattle Center &Pike Place Market.150 guestrooms with parlors &jacuzzis.1531 7th Ave.621-1200;(800)426-0670. SEATTLE HILTON 237 rooms/downtown.6th &University.624-0500. SHAFER-BAILIE MANSION Bed &Breakfast.907 14th Ave.E.322-4654. Ja ek,13 COINS Seattle's favorite for 28 years!24-hr.daily.Over 130 menu(Qs)items.Breakfast/Lunch/Dinner/After theater.Cocktails,free park.x Amx/DC/MCNisa.Sea-Tac-live entmnt.nightly.In Seattle,125BorenAve.N.682-2513.At Sea-Tac,18000 Pacific Hwy.S.,243-9500. % to Ew,onenessa ENR,Se REO ete ee REN Ab OE AT yg ee gee. i SHERATON SEATTLE HOTEL &TOWERS 35 luxury floors in mid-city, 1 block to Convestion &Trade Center.Pool,health club,dining,entertainment.Dine at Fuller's,Schooner's and Pike St.Cafe.1400 6th Ave.621-9000. SILVER CLOUD INN 144 mms.,indr.pool,cont.brkf.,Univ.Dist.(800)205-6940. SIXTH AVENUE INN 2200 6th Ave.441-8300;(800)648-6440. SORRENTO HOTEL4 Star,4 Diamond luxury hotel.Award winning HuntClubrestaurant&chef.900 Madison.622-6400;(800)426-1265. UNIVERSITY INN Near the Li.of W.4140 Roosevelt Way N.E.632-5055. UNIVERSITY PLAZA HOTEL 135 large rooms.Non-smoking restaurant &jazzlounge.Meeting Rooms to 300.400 N.E.45th.634-0100;(800)343-7040. VAGABOND 58 units.Cable TV.Free coffee &cont.breakfast.Jacuzzi & pool.325 Aurora Ave.N.441-0400;(800)552-3353;Fax 448-3353. THE WARWICK Downtown,230 rm.4-diamond luxury hotel.Free 24-hr intownvan.Pool/health club.Liaison Rest /Lounge.4th &Lenora,443-4300.SORwnro)in Citta Italian restaurant.620 Stewart St.441-4200;(800)426-0670.nonmnomMMKNSeattle.200 attractive rooms,state-of-the-art fitness facilities and fully- appointed locker rooms for men and women.909 4th Avenue.382-5000. SEATTLE METROPOLITAN MOTOR INNS 2 BEST WESTERN CONTINENTAL PLAZA HOTEL Spectacular Lake &Mtn.§ view,near Space Needle,Seattle Center,Downtown,UW,SPU,&Zoo.Htd. pool,free cnt.bkfst.,kitchens.2500 Aurora N.284-1900;Fax 283-5298.& 2 BEST WESTERN EXECUTIVE INN Seattle Center.123 new units,convention jfandmeetingfacilities,cocktails,dine in Christie's Restaurant.Suites, covered parking.200 Taylor N.448-9444.2 BEST WESTERN LOYAL INN 91 rooms,Sauna,Jacuzzi,free a parking &cont.brkfst.4 blocks to Seattle Center.2301 8th.682-0200. 5 CITY CENTER TRAVELODGE 73 units,near Convention Center &shopping, free coffee,non-smoking rooms,air cond.2213 8th.624-6300.2 SEATTLE INN Indoor pool,Jacuzzi,covered parking,inexpensive shuttle,i continental breakfast.97 rooms offering affordable comfort plus a 62 roomBudgetAnnex.225 Aurora Ave.N.at John St.728-7666. 2 TRAVELODGE BY THE SPACE NEEDLE 88 units,air cond.,Showtime,free cont.breakfast,24 hr.tea/coffee,park free,outdoor pool/spa,2 biks.to Seattle Center &downtown Monorail.200 6th Ave.N.441-7878;(800)578-7878. IN &AROUND PIKE PLACE MARKET CRUMPET SHOP Breakfast,lunch.On 1st at Market Entrance. EARTH WIND &FIRE Uniquely eclectic handcrafted jewelry,wood,®clothing &ceramics.Pike Place Market.1906 Pike Place #4.443-0367. LE PANIER VERY FRENCH BAKERY Baking all day on premises.Croissants,baguettes,light lunch,cafe au lait.Stewart House.Open 7am.441-3669. MARKETPLACE PHOTO1 hr.processing,film,enlargements.441-0658. 5 6 6 5 5 MERRY TAILS Gifts for people who love animals.Mugs,jewelry,T-shirts.Cats,Dogs,Frogs,Rabbits,Fish &more.1409 First Ave.623-4142. 5 6 5 5 PSYCHIC READER Mrs.Ruth,Astrologer,Tarot.1617 2nd Ave.728-1965. PURE FOOD FISH MARKET Fresh seafood &salmon packed in odorless,leakproof cartons.Airline OK to hand carry for 48 hrs.Pike PI Mkt.622-5765. RADISHES Take back memories of the Market.Gifts in the shape of fruits,vegetables,flowers,cows,and pigs.1407 Ist Ave.624-3504. SEATTLE SHIRT CO.Largest selection.Best prices.Across from Public Market.Greatest T-shirt store you've ever seen.103 Pike.621-7330. 5 SIMPLY SEATTLE Local arts,food products,shirts.Ist &Pine.448-2207. 6 UNDERCOVER QUILTS Largest selection of new &antique quilts in the PNW.Books,supplies,gifts,quilted dolls &animals.1411 Ist Ave.622-6382. 6 ZAMBOANGA Exotic gifts,clothing,jewelry &artifacts.448-9345. west,Regularly scheduled Lunch,Brunch,Dinner &Jaz?Cruises!223-2060 9 YE OLDE CURIOSITY SHOP World famous waterfront attraction since 1899.&This unique store will amaze,amuse and delight you.A Must See!&Open 7 days.Pier 54,Alaskan Way.(206)682-5844. WESTCOAST VANCE HOTEL Downtown location.165 renovated rooms,Saluté THE WESTIN HOTEL 865 rooms,spectacular views,ideal shopping location, restaurants,poolfitness cntr.,business services.1900 5th Ave.728-1000. YMCA DOWNTOWN HOTEL International crossroads in downtown ® cor ste & is,a+JEAI LE VLENICKNR "The Preeminent Gathering Plage” Seventy-four acres of year-round entertainment,arts,3 eelsSiTee,shopping,dining,educational and cultural adventuresCERTER'for everyone.Seattle Center hosts the Symphony,Ballet,ANE Opera,theaters,Children's Museum,Pacitic Science"is4"ACD:Center,Space Needle,Fun Forest AmusementPark&Seattle Center Monorail connecting to downtown Seattle.684-7200.3 PACIFIC SCIENCE CENTER Enjoy robots,dinosaurs &5 buildingstof hands- on fun.Experience the planetarium,laser shows &IMAX@ films.Even play basketball in virtual reality.Open daily.Cail 443-2001. |2 THE SPACE NEEDLE For an unequaled panoramic view,visit theSeeoFwor,Observation Deck.Gift shops.Your choice of two restaurants:The SpaceNeedleRestaurantorTheEmeraldSuite.443-2100;(800)937-9582. DISCOVERING SEATTLE 6 BAY PAVILION 1890's PIER.Food,shops,old-tyme carousel.623-8600. 3 CAFFE APPASSIONATO A working coffee roasting factory.Free sample.Manycoffees,beverages &light foods.By Fishermen's Terminal.Daily.281-8040. A,1 CHRYSLER AIR Scenic Flights.Seaplanes on Lake Union.329-9638.45 >GRAY LINE OF SEATTLE A name you know &trust.City &water*tours,Mt.Rainier,Tillicum Village,San Juan Islands/Victoria,and Vancouver,B.C.tours daily.Free pickup most dwntwn-hotels.626-5208. 9 y HART BREWERY AND PUB See how the Northwest's famous;2-.Pyramid Ales &Thomas Kemper Lagers are made.Daily tours &tast-vase ings.Pub.Short walk from Pioneer Sq.Tour times:682-3377. nw KENMORE AIR Fly off the water.Victoria &San Juan Islands only+m,45 min.from downtown Seattle's Lk.Union by seaplane.Stunningviews.Daily scheduled flights,economical packages.486-1257. KINGDOME TOURSA behind the scenes walking tour.$4.00 adults;$#.00seniors&kids under 13.Start at Gate D.For times:296-3128. METRO TRANSIT See the sights on the Waterfront Streetcar.553-3000. MUSEUM OF FLIGHT 50 full-size aircraft,films,tours,gift store,Wings Cafe,A MUST!Exit 158 from 1-5.Open daily.764-5720. MUSEUM OF HISTORY &INDUSTRY Discover Northwest history.Fun for the whole family.Open daily.South of Husky Stadium.324-1126. 8 PEGASUS COFFEE&PASTRY BAROldest espresso bar.711 3rd,682-3113. B RAINIER BREWERY Visit the 8th oldest business in Washington. 1-6pm,Monday-Saturday.Enjoy hospitality of the MountaingRoomandtour.Free.Visit our gift shop.Take Airport Way S.,exitfromI-5.3100 Airport Way South.Information call,622-2600. ii 8 &RUBY MONTANA'S PINTO PONY "Quite possibly the most interestingE y i \ variety store this side of the Mississippi.”1000's of S&Ps,collectibles "”&classic kitsch.Daily 10-6.603 2nd Avenue.621-PONY. 5 SEATTLE ART MUSEUM Open Tuesday-Sunday.Call 654-3100. 4 SEATTLE-KING CO.CONVENTION &VISITORS BUREAU Info/brochures. Events/hotel-motel/tours/sightseeing.Level 1 Gaileria,Wash.St.ConventionCenter,461-5840;Sea-Tac Airport,433-5218,Japanese 433-4679. m)5 SIMPLY SEATTLE Local arts,food products,shirts.1st &Pine.448-2207. B|8 THE UNDERGROUND TOUR Guided walking tour.Humorous view of Seattle's 8 colorful past.Open all year.682-4646 (Reservations). WALTER'S WAFFLES ETC.'Gaufres'snack,breakfast,lunch.382-2692. MEDICAL 5 VIRGINIA MASON FOURTH AVENUE No appointment necessary.Open M-F,7am to 5pm;Sat.10am to 1:45pm.4th &University.223-6490. 4 VIRGINIA MASON MEDICAL CENTER Call 223-6600 for an appointment at the clinic between the hours of 8:30am and 5:30pm.The emergency room of the Virginia Mason Hospital is open 24 hours a day.583-6433. at a a ee While holding your Tourmap®this way,thePSA'PANEL NUMBER"corresponds to each foldedi\section.'B'refers to map on back. Board of Directors Chairperson Larry Bean (lowa) immediate Past Chairperson Carson D.Culbreth (North Carolina} Vice Chairperson Judy Merchant (Washington) Treasurer Chester Smith (Mississippi) Secretary Charles R.Imbrecht (California) Richard Sedano (Vermont) Robert Chilton (New Jersey) Charlie Smisson (Delaware) John Stapleton (Kentucky) Mitch Beaver (Illinois) Sherwood Washington (Oklahoma) Cher Stuewe-Portnoff (Missouri) John Nunley (Wyoming) Amanda Ormond (Arizona) John Savage (Oregon) Thomas Dreessen (Affiliate's Chair) Executive Director Frank Bishop Counsel Jeffrey C.Genzer Duncan,Weinberg,Miller &Pembroke 1615 M Street,N.W. Suite 800 Washington,D.C.20036 (202)467-6370 Telephone 202-546-2200 Telecopy 202-546-1799 National Association of State Energy Officials February 13,1996 Dear Colleague: On behalf of the U.S.Department of Energy and NASEO,|would like to invite you or your representative to attend a workshop on New Opportunities and Trends in Energy Programs and Markets. The workshop is sponsored by the U.S.Department of Energy and coordinated by the department's Seattle Support Office,the Washington State Energy Office,and the National Association of State Energy Officials. The Seattle workshop is one of six regional workshops to be held over the next several months and is an important opportunity for state,local,and federal energy officials,managers,and business leaders to get to know one another and to learn about trends and changing federal programs. The objective of the first day of the workshop will be to introduce participants to various state,local,and federal programs and officials,as well as to discuss new opportunities in federal programs and expected changes.In addition,the first day will allow participants to gain an understanding of what others in the region are working toward. The second day of the workshop focuses on how utility deregulation and restructuring may affect various constituents.For example,presentations and discussions will provide information on where utilities'energy prices and finances are headed and what major activities and trends to expect in the near-to-mid term. Additionally,the second day of the workshop will include a demonstration and presentation about on-line information sources,as well as a brainstorming session to identify things that the Seattle Support Office can do to assist the states and others. The workshop will be held on March 21-22,1996 at The Mayflower Park Hotel in Seattle,Washington.The workshop will run from 9:00 a.m.to 5:30 p.m.on Thursday,and 9:00 to 11:30 a.m.on Friday.You are invited to attend the entire workshop or pick the session(s)which are of most interest to you.An agenda is attached. 1615 M Street,N.W.,Suite 810,Washington,D.C.20036 2 We hope you can join us for the workshop.The registration fee is $50.00 and a registration form is enclosed.Room reservations can be made by calling the hotel at (206)382-6996 or you can use the enclosed reservation form.Please note that in order to secure the conference guest room rate at $84.00 for a single room or $94.00 for a double room,hotel reservations must be made by February 28,1996.Registration forms are also due on this day. Thank you for your attention to this invitation,and please feel free to circulate the information to others who might benefit from the workshop.If you have any questions,please contact me at 202/546-2200. y rank(Bishop Executive Director Enclosures Seattle Regional Energy Workshop 1996: New Opportunities and Trends in Energy Programs and Markets March 21-22,1996 Draft Agenda,March 21 8:00 a.m. Opening Remarks and Introduction -National Association of State Energy Officials -Washington State Energy Office Seattle Regional Support Office 8:30 a.m. New Opportunities With the Office of Building Technologies (OBT) -DOE headquarters presentation -Presentation from grantees in the region receiving funding from OBT (e.g.,Rebuild America,etc.) 10:00 a.m.Break 10:15 a.m. Office of Industrial Technologies (OIT) -DOE headquarters presentation -Marsha Quinn,U.S.DOE -Presentation from grantees in the region receiving funding from OIT (e.g.Climate Wise,NICE3,etc.) 11:45 a.m.Lunch 1:00 p.m. New Opportunities with the Office of Transportation Technologies -DOE headquarters presentation -Marcy Rood,U.S.DOE -Presentation from grantees in the region receiving funds from OTT 2:15 p.m. Federal Energy Management Program State Initiative -DOE headquarters presentation -Mark Ginsberg,U.S.DOE -Presentation on regional activities 3:30 p.m.Break 3:45 p.m. Office of Utility Technology Programs and New Initiatives (OUT) ” °. DOE headquarters presentation -Presentation from grantees in the region receiving funds from OUT 5:00 p.m. Adjourn 7:00 p.m. Reception Seattle Regional Energy Workshop 1996: New Opportunities and Trends in Energy Programs and Markets March 21-22,1996 Draft Agenda,March 22 8:00 a.m. Electric Utility Restructuring and its Impact on Energy Efficiency and Renewable Energy in the Region -Presentation on a comprehensive review of Pacific Northwest Utilities -Presentation from the Northwest Energy Efficiency Council -Presentations on residential,commercial and industrial consumer trends 10:00 a.m.Break 10:15 a.m. Demonstration of On-line Sources of Existing Information on Local,State,Federal,and Laboratory Energy Efficiency Activities 11:15 a.m. Meeting the Challenges of Changing Priorities in the 1990s:A Brainstorming Session to Identify Realistic Things That the Seattle Support Office and Others Should do: -Share information on successes and opportunities -lmprove communication with and among states -Address State issues and concerns 12:15 p.m. Adjourn NATIONAL ASSOCIATION OF STATE ENERGY OFFICIALS March 20-22,1996 HOTEL REGISTRATION The Mayflower Park Hotel,Seattle WA Pleuse Print or Type Name: Address:: City/State/Zip.Phone: Single Ocenpancy (1 person -|hed)$84.00 Double Occupancy (2 persons -1 bed)$94.00 Double Occupancy (2 persons -2 beds)$94.00 Sharing Room With:(if you are sharing a room,please submil onc form only) Non-smoking rooms are available at check-in. Please indicate your preference below and inquite at check-in.Hotel Check In:3:00pm ___Smoking Non-Smoking Hotel Check Out:12;00n00n Arrival Date:Departure Date: Arrival Time:Departure Time: All reservations must be accompanied by a deposit cqualing one night's room and tax (currently 15.2%),You may use your American Express,Diners Club,VISA,Master Card or Discnver credit card to guarantee your reservation. Deposit Amount Enclosed:$ Method of Payment:Check |.____Money Order Discover Master Card VISA ____Diners Club Amcrican Express Credit.Card Number: Expiration Date:Card Holder: Landes stand that am responsible for one night's 100m and tax which will be deducted from my deposit,o¢billed through my credit card upon the hotel's receipt ofthisfam.{0 the event |cancel this reservation hy 4:00pm on my arrival date,a credit will be applicd or refunded in the umount of the deposit. Sipnature: Please send or fax reservation form to: The Mayflower Park Hotel 405 Olive Way Seatde,WA 98101 Altn:Reservations Department Phone:(206)623-8700 US &Canada:(800)426-5100 Reservations Only Fax:(206)382-6996 Reservations should be received by February 28,1996.Keservations after thix date are subject to availability. ENERGY PARTNERSHIPS FOR A STRONG ECONOMY WORKSHOP: THE MAYFLOWER PARK HOTEL SEATTLE,WASHINGTON March 20-22,1996 REGISTRATION. Workshop Fee:$50 -REGISTRATION DEADLINE IS FEBRUARY 28,1996 REGISTRATION INFORMATION NAME TITLE ORGANIZATION ADDRESS CITY/STATE/ZIP CODE TELEPHONE FAX PAYMENT INFORMATION {]Enclosed is my Check for $ {]Payment Forthcoming {]Payment Upon Arrival CHECKS PAYABLE TO:NASEO SEND FORM AND PAYMENT TO:NASEO 1615 M Street,N.W. Suite 810 Washington,D.C.20036 ATTN:Melanie E.Sequeira FAX:(202)546-1799 FOR INFORMATION:Frank Bishop (202)546-2200 Department of Energy Seattle Regional Support Office 800 Fifth Avenue,Suite 3950 Seattle,Washington 98104 FER 2 2 inns Mr.Percy Frisby,Director Alaska Department of Community and Regional Affairs 333 West Fourth Avenue,Suite 220 Anchorage,Alaska 99501-2341 Dear Mr.Frisby: MEETING INVITATION The National Association of State Energy Officials (NASEO)will be hosting a workshop in Seattle, Washington on March 21-22 to showcase new opportunities to support energy efficiency.We expect that this workshop will draw a large and diverse audience from our expanded region.The Seattle Regional Support Office (SRSO)would like to use this opportunity to meet separately with our state energy and weatherization offices on March 20,1996 to discuss the changes we are all going through and how we can best work together during this period of great uncertainty.Representatives from the DOE Headquarters offices and the National Labs are also being invited. We would like to invite you and your staff to attend this state meeting on March 20th in our 38th floor conference room at 800 5th Avenue,Seattle,Washington 98104.(Our office is located in downtown Seattle, about 5 blocks from the site of the NASEO workshop.)The format for the meeting is flexible,but we expect it to last from 9:00 AM to about 4:00 PM. In the morning session,we would like to meet as a group to: 6)Introduce state,DOE and Lab representatives in our region fe)Discuss the new roles and responsibilities of staff in the recently reorganized Seattle Regional Support Office. fa)Discuss new DOE initiatives and how we can best carry them out in our region oO Provide a forum to briefly highlight State,DOE and Laboratory initiatives fe)Identify state issues and concerns that need to be addressed in our region In the afternoon we would like to break out into small groups to have more in-depth discussions on topics of mutual interest.These sessions could focus on current status and future prospects for individual programs - such as the State Energy Conservation Program,State Energy Program,Institutional Conservation Program, and the Weatherization Program.Other topics could include ways to improve communications and share information amongst our offices.The selection of topics to be discussed will be based on feedback from you before or during the meeting. This meeting will provide a great opportunity to meet your peers and formally begin a process to exchange information and ideas on how we can best function as a regional energy network.Since space is somewhat limited in our conference room,we would like to know in advance who will be able to attend this meeting from your office.Therefore,please complete the enclosed registration form and fax it back to our office by Monday,March 1Ith. oor” (206)553-1004 Federal Recycling Program oe )Printed on Recycled Paper (206)553-2200 FAX Mr.Frisby -2- If you have any questions about this state meeting,please call Laurie Brown of my office at (206)553- 2158 NASEDO is handling all arrangements for its workshop separately.If you have any questions about the NASEO workshop on March 21-22 or would like to register for it,please call NASEO at (202)546- 2200. I hope to see you in Seattle next month. Sincerely, Kal.Mesa Director Seattle Regional Support Office Enclosure ce:David Lockard Peter Crimp oe _Lan mele Boon 5,lA3 Unobhgsked Lard 3 v .No-cost oxfters!ors ong vot Man.wy Sed not decided y of Week wp WASE 0° FochJspolitcal SEP _butlt ot Ll.4.Ec 0 {I Next uaof -pveltm tery fed by-Aptos g]Lids (a){-eth prequimr edgy Dealt ne LRA weeks _ So mmth Cl And nate. S¥ite path )4 AO hy,MK 5_O %r 98°. _Td y Dp eanlieit aay revs A she. dB!Conschdated grant ®1 -onsclidatedmi __@9-deG,-ye" Metwresl Req ey S&P A Ilo valle progveme:-S¥cp [doa ISECR F265 5m.WAL WICES,erdes=JADU i } 1 { | ' een Oa a _ a 1 -a a wie?STATE OF ALASKADepartmentofCommunity&Regional Affairs INTRA-DEPARTMENTAL ROUTE SLIP |Office of the CommissionerL_J Municipal &Regional AssistanceoOAdministrativeServicesCcCommunity&Rural DevelopmentLJriscat|Personnel CJ Energy Attention:D J Ya |:\;WIwetterNOVO=BI CJ Initial &Return £2)Please Cbmment (see Me CI Draft Reply [Your Information CJ puplicate/Copies Cc Reply Direct For Your File C Please Distributea (J Sign/Approve [[]Action Required [2 Postor Circulate OCOAsRequested Please File oO Remarks: From:Date: Location:Division: 21-205 (Rev.9/94) Department of Energy Seattle Regional Support Office 800 Fifth Avenue,Suite 3950 Seattle,Washington 98104 May 31,1996 Honorable Tony Knowles State Capitol Building 124th Street Juneau,Alaska 99811-0001 Dear Governor Knowles: 2ND REQUEST FOR DESIGNATION OF LEAD AGENCY In our letter dated May 3,1996,we requested your assistance in designating a lead agency for the U.S. Department of Energy's State Energy Program (SEP)grant.The purpose of this letter is to request that we be notified of your decision on the designation as soon as possible.State applications for the special projects portion of the SEP are due in our office no later than June 28,1996.There will be no extensions on this date.If we are not in receipt of an application and special projects proposal from the designated agency in Alaska by June 28,1996,the State of Alaska will lose their opportunity to utilize these funds for energy efficiency and renewable energy in FY96. We have enclosed correspondence which provides additional information on the SEP program requirements and timelines.If you or your staff have any questions or need additional information,please feel free to contact me at (206)553-1132,or Julie Riel of my staff at (206)553-2875. Seattle Regional Support Office Enclosures (As Stated) cc w/encl:Jim Ayers,Chief of Staff,Governor's Office Dan Fauske,Director,AHFC Mike Irwin,Commissioner,ADCRA cc w/oencl:Percy Frisby,Energy Division Director,ADCRA Peter Crimp,Development Specialist,ADCRA David Lockard,ICP Manager,ADCRA Robert Brean,Director of Rural Research &Development,AHFC Phil Kaluza,SECP Manager,AHFC J.VanVlandren,DOE-HQ (206)553-1004 Federal Recycling Program we Printed on Recycled Paper (206)553-2200 FAX FROM KPMG FED SVCS (THU)06.06°96 07:26/8T.07:25/NO.3560969058 P 1/4 JAOLLP Public Services Telefax (202}293-5437 2001 M Street,NW Washington,DC 20036 FacsimiLe Cover SHEET Date:October 15,1995 Time:No.of Pages (Including Cover Sheet):4 Please deliver the following pages to; Name:Daud loc aBA of Company /Department: City: Telephone No.:Telefax No:YOR -267 -1 2 v.2©2 @ €£ From:_Peter Stahl Company/Department:KPMG Peat Marwick Telephone No.:__(202)467-3866 If not well received please contactPeteStahl immediately at:(202)467-3866 The Infarmation contained in this facalmile message {s priviiaged and confidential information Intended far use of the addressee listad above.If you ara najther the intended reelipiant nor the employee or agant reepansibla for delivering this message ta the intended recipiem,you are hereby notified that any disclosure,capying, disibution,or the taking of any action [n reliance on the cantante of the telecopiad Imformation is strictlyprohibited.If you received thia telacopy in error,plaase Immediately notify us by telephone at the abova number to arrange for the return of the original document to us, «=-Ma8sSagerrcece wemeuena Peake nwonaeaamnnane ee ee eee ee ecow Please find enclosed Department of Energy Commercialization Ventures Program Information. FROM KPMG FED SVCS (THU)06.06°96 07:26/ST.07:25/NO.3560969958 P 2/4 1 J Peat Marwick LLp 2001 M Street,N.W. Weshington,DC 20036 |June 2,1996 Dear State Energy /Economic Development Official: KPMG Peat Marwick is currently under contract with the Department of Energy Headquarters,Office of Energy Outreach.We are currently supporting DOE in issuing the Commercialization Ventures Program (CVP)solicitation.We would like to provide you with some background information regarding this upcoming technology commercialization partnership opportunity. The CVP seeks to faster commercialization by focusing on the latter stages of product development and market penetration.While other government programs offer assistance for research and development,this program is intended to assist in commercializing technologies that are essentially technically proven. The program's solicitation will be open to projects that produce or deliver electricity, thermal energy,or other forms of energy using renewable energy technologies.It is also open to projects that improve or expand facilities for manufacturing renewable energy technologies. Many types of renewable energy technologies are eligible.The following are typical examples: -Photovoltaics,including utility scale and remote applications -Solar thermal power systems -Direct application of solar thermal energy,including water and space heatingf-Conversionof cellulosic biomass to liquid fuels 7*=Direct combustion or gasification of |biomass . :-Biofuels energy systems"1+Ethanol and ethanol by-product processes Y.Fuel cells using renewable fuels,including transportation and stationary *.applications_ -Geothermal energy,as electricity or heat"-Wind energy,including utility gtid-connected,village power :'and small and large ;.off-grid applications _. << Pa ef 1;° vR25 eeeClynvalsPagetMacon b Cemrcdeler FROM KPMG FED SVCS (THU)06.06°96 07:26/8T.07:25/NO.3560969958 P 3/4 Rene Peat Marwick tp The business aspects of the program are equally important.Although each team Jeader js a State Energy Office (or its equivalent),the presence on each team of one or more for- profit companies underlines the fact that the intended outcome is a profitable operation of a renewable energy system. To win an award,a team must present a convincing business plan that leads to profitability.Specifically,a minimum of 50%of the project cost must come from non- federal sources.The contribution can be in-kind (e.g.,labor)from the companies doing the work,and/or can be money from foundations,state funds,investors,etc.In addition, the projects must involve primarily U.S,-based manufacturing. Enclosed is a copy of the Commerce Business Daily notice highlighting this program,and important points of contact. Sincerely, Peter Stahl Senior Manager,High-Technology Group FROM KPMG FED SVCS (THU)06.06°96 07:26/ST.07:25/N0.3560969958 P 4/4 - Synopsis 961450012 from the CBD issue of 24-may-1996 Subject:PSE,Section:B ,Legend: Source:U.S.Dept.of Energy,Denver Regional Support Office,1617ColeBlvd.,Raom 230,Golden,CO 80401 Title:PROGRAM OF FINANCIAL ASSISTANCE FOR COMMERCIALIZATION VENTURES PROGRAM BOL DE-PS48 96R810587 DUE 081596 PoC Margaret Learmouth,(303)275-4830 (FAK).Competitive solicitation for financial assistance applications to assist entry inte themarketplaceofnewlyemerging,but viable,renewable energytechnologiesorinnovativeapplicationsofexistingjenewablaenergytechnologies.Eligible applicants for assistance tirider thiesolicitationarelimitedtoStateenergyoffices,or for stateslackingofficialenergyoffices,tha state agency withresponsibilityforenergymattere.At least one for-profit businessmustbejoinedwiththeStateagencyindevelopingprojecteandforningparticipationarrangementsunderthissolicitation.Partnering opportunities exiet betweenfor-profit entities (no fee or profit allowed),non-profitentities,other organizations,and state energy offices underresultingfinancialassistanceawards.Approximately 5-10 awards are expected to be made in 1996.Depending on theavailabilityoffunds$8-11 million may be made available forprojects.The solicitation is anticipated to be issued on or aboutMay31,1996,and will contain detailed information on funding ,cost sharing requirements,eligibility,application preparation,and evaluation,Applications will be due75daysaftersolicitationrelease.In addition to the direct financial assistance offered through this solicitation,DOE may beinapositiontooffernon-financial assistance in the form ef consulting expertise on bueécinesesa aspects of proposedprojects,such as davelopment of a business plan or identifyingcommercialfinancingforpromisingprojects.Candidate projects forthisformofassistancewillbaidentifiedduringtheapplicationreviewprocess.To obtain a copy of the solicitation once itisissued,write to the U.S.Department of Energy,DenverRegionalSupportOffice,1617 Cole Boulevard,Building 17,Room230,Golden,Colorado 80401,Attn:Margaret Learmouth,ContractSpecialist.Only written requests for the solicitation will be honored,For convenience,requests for the solicitation may be sent by telefax to Ms.Learmouth at (303)275-4930.(0143)i) G /O #LOCETERCZOG AO AAT LOOTOMUITIt «6¢ween:TT!Of-g7-c *MAW In TALI Aree.ret tie Page 6 Energy Times June 1996 What are Alternative Fuels? Alternative fuels include ethanol, methanol,compressed (CNG)or liquefied natural gas (LNG),liq- uefied petroleum gas (LPG), hydrogen,electricity and any other non-petroleum fuel,or energy source._ Passenger cars,pickups,heavy- duty trucks or buses may be Alternative Fuel Vehicles (AFV). Most AFVs in the US are pow- ered with LPG.CNG is also a widely used alternative fuel,as is E85,a blend of 85 percent ethanol and 15 percent gasoline. AFV fuel economy generally compares favorably to gasoline powered vehicles,and AFVs almost universally produce fewer harmful emissions than their gasoline burning counter- parts. About 275,000 AFVs were on the road in the US in 1994,and nearly all AFVs belonged to federal and private fleets.Today, all Detroit auto makers are man- ufacturing dedicated AFVs with engines capable of using propane, compressed natural gas,ethanol and methanol as transportation fuels.GM recently introduced a production electric vehicle target- d for use primarily in California. Ford has dedicated E85 and CNG sedan and pickup models, and Chrysler has CNG van,and pickup and sedan options. The Federal Energy Information Administration (EIA)estimates there will be 2.5 million AFVs on the road by 2010,and projects that if AFVs captured only 13 percent of the auto market during this fifteen year period,the US - could reduce total energy use transportation sector by 15 percent. Sp acta Goce oils corse oe Office of Intergovernmental Assistance 14th Floor -State Capitol 600 East Boulevard Avenue Bismarck,ND 58505-0430 aewe RURAL DEVELOFMENT DIVISION BADEN STEVE "33 WEST 4TH AVENUE SUITE 220 ANCHORAGE AK 99504 BULK RATE USS.Postage PAID Permit No.125 Bismarck,ND 58504 ENERGY EFFICIENCY INFORMATION FOR NORTH DAKOTA North Dakota Office of Intergovernmental Assistance June 1996 (701)328-2094 Bismarck,North Dakota Clean Cities Sweeping Red River Valley Clean Cities is a locally based,in- dustry,business and governmen- tal partnership,coordinated by the US Department of Energy to ac- celerate and expand the use of gasoline and diesel fuel alterna- tives.Local,decision-making Clean Cities volunteers,present a contrast to regular federal pro- grams.Reversing the customary top down,centralized approach, Clean Cities offers the citizens of North Dakota,and residents of the region,the opportunity to make decisions that best serve their alternative fuel requirements. Employing local resources,Clean Cities offers new fuel market options,and contributes to the partnership process with problem solving mechanisms,Working with local industry,businesses and governments,Clean Cities guides the goal setting,coalition assem- bling and infrastructure building process,essential for a practical alternative fuel market foundation. Red River Valley Clean Cities is a North Dakota State Energy Con- servation Program project,coordi- nated by the University of North Dakota Energy &Environmental Research Center at Grand Forks, with the assistance of the Denver Regional Support Office of DOE. The most important element of RRVCC is public information. Education,especially efforts to inform the motoring public,in- cluding government agency rep- resentatives,fleet managers, producers,suppliers,retailers, equipment manufacturers and all concerned alternative fuel inter- ests,are but one Clean Cities benefit available to the Valley. In addition to increasing fuel choice,other attainable regional benefits offer residents,business and industry new opportunities to replace dependence on im- ported oil with domestic,and renewable sources of transport- ation fuel. Tim Gerlach,Research Associate at EERC,is the RRVCC Coordin- ator.Since assuming control in February,Gerlach has recruited stakeholders,and encouraged potential participants to board the Clean Cities alternative fuels bandwagon. (Continued on Page 5) US Ethanol Production .........00...cc cece eee cece eeee 2 1997 NICE?Grant Cycle Announced ..................0..2 North Dakota Cross Currents ...........0000 ceeeeeeceeces 3 North Dakota Cross Currents ..........0c ccc ceecceeceeees 4 Sustainable Community Development Center ..............5 Alternative Fuels ..............- Clean Cities Sweeping Red River Valley ................05- eee eee ere secre a en woe eosove Nort VaKkaT Page 2 Energy Times June 1996 US Ethanol Production Half of US ethanol is made by one producer,and 80 percent of the ethanol production industry,is controlled by 20 percent of producers. The US ethanol industry,with the vast majority of production occur- ring in the corn belt,is dominated by Archer-Daniels Midland. In North Dakota,Alchem Limited,Grafton,with 10.5 million gallons annual produc- tion,is the only operating ethanol facility in the state.Another ethanol plant located in Walhalla, and operated by ADM,is closed, and it is not known when oper- ations will resume. US ethanol production capacity has increased from 20 million gal- lons in 1979,to 1.1 billion gallons in 1991.A November 1995 study by Bryan and Bryan,ethanol industry analysts,reports US annual ethanol production at 1.5 billion gallons,and indicates 76.5 million gallons in capacity went on line last year,with another 35.5 million gallons expected to go into production in 1996. US ETHANOL PRODUCERS Midwest Grain B Source:Bryan &Bryan,November,1995 1997 Nice*®Grant Cycle Announced The United States Department of Energy is again sponsoring an innovative,cost-sharing program, to promote energy efficiency, clean production processes and economic competitiveness in industry.The grant program, National Industrial Competitive- ness through Energy,Environment and Economics,or NICE',pro- vides funding to state and industry partnerships for projects to demon- strate energy efficiency advance- ments and clean production tech- 'nologies. Industry applicants must submit project proposals through a state energy,pollution prevention or business development office. Awardees may receive a one- time $400,000 grant for the proposed project.After initial funding,awardees are expected to commercialize the process or technology.Projects are awarded federal funds with at least a dollar for dollar match provision. Please contact this office at 328- 2094 for more NICE?information. EEE The 1997 NICE'project time line: >August 2,1996 -Last day for optional 2-page abstract >January 15,1997 -Solicita- tion closes >March 14,1997 -Evaluation completion >April 21,1997 -Earth Day awards announcement Page 5 Energy Times June 1996 Sustainable Community Development Center Open for Business The US Department of Energy has created The Center of Excellence for Sustainable Development,a program to help communities protect their environments for future generations,while promot- ing economic development. The Center of Excellence for Sus- tainable Development will offer general information and technical advice to help communities be- come more energy efficient and environmentally sound.It will also provide tool kits of workbooks, computer software and data for sustainable development project guidance,ranging from green buildings,to neighborhoods that waste less energy. Users may review case studies of successful community projects and research technical and finan- cial programs that can provide further assistance. The Center concept evolved from experience gained from offering technical assistance to devastated © Midwest communities in the wake of the great flood of 1993. DOE assisted many communities rebuild using sustainable devel- opment strategies,integrating economic development and environmental quality goals. Bill Becker,DOE Denver Reg- ional Support Office Director,will manage the Center. Interested communities can contact the Center toll-free at 800-357-7732,or via the Center home page on the World Wide Web at <http://www.crest.org/ doe/sustainable>. Clean Cities (cont from page 1)_ Gerlach's network building has enlisted 16 stakeholders.Gerlach has crafted the RRVCC coalition to include local,state and federal units of government,businesses, especially those with fleets,a dis- pensing system manufacturer, producers,suppliers and interested residents,through a series of organizational meetings. Directing the Clean Cities design- ation process,Gerlach is recruit- ing new stakeholders,and con- ducting promotional activities, including alternative fuel present- ations. During its brief existence, RRVCC has focused on devel- oping an alternative fuels market plan,enlisting stakeholder partici- pation from several economic interests.Formal Clean Cities designation is expected in August. The following units of govern- men,groups,businesses,organ- izations and associations,have emphasized their commitment to RRVCC as stakeholders,with several resources,including financial support,to alternative fuel infrastructure development: >Alchem Ethanol,Grafton >Kraus Industries,Winnipeg »US Postal Service,Grand Forks >City of Grand Forks >City of East Grand Forks >US Department of Energy >»University of North Dakota >»Grand Forks Air Force Base >ND Corn Utilization Council >»US Department of Agriculture »Norther States Power Company »National Ethanol Vehicle Coalition >»Grand Forks Chamber of Commerce -. >National Alternative Fuels Laboratory >ND State Energy Conservation Program >Energy &Environmental Research Center For Red River Valley Clean Cities information,please contact Tim Gerlach,telephone number (701)777-5144. PSISPONBLINS2DULY TFIIOW(ON(SISODaUETES'G@ LOU VAUI 010m Ou soSSGodesGoceEF:EESS0SsGoFor information on E85 and other alternative fuel vehicles,contact the North Dakota Office of Intergovernmental Assistance at 701-328-2094,or the National Alternative Fuels Laboratory at the Energy and Environmental Research Center in Grand Forks at 701-777-5000. For more Information... e on Ford's ethanol vehicles,or the dealer nearest you,please call Ford at 1-800-ALT-FUEL. ¢on the ethanol-fueled Taurus or for locations of E85 refueling sites in your State or throughout the Midwest, please call the National Ethanol Vehicle Coalition at 1-8O00-E85-8895. than! Governors'Ethanol Coalition Members Missouri -Governor Mel Carnahan,Chair Iowa -Governor Terry Branstad,Vice Chair Wisconsin -Governor,Tommy G.Thompson,Past Chair Arkansas -Governor Jim Guy Tucker Colorado -Governor Roy Romer Hawaii -Governor Ben Cayetano Illinois -Govemor Jim Edgar Indiana -Governor Evan Bayh Kansas -Governor Bill Graves Kentucky -Governor Paul Patton Michigan -Governor John Engler Minnesota -Governor Ame Carlson Montana -Governor Marc Racicot Nebraska -Govemor Ben Nelson New Mexico -Governor Gary Johnson North Dakota -Governor Ed Schafer Ohio -Governor George Voinovich Oklahoma -Governor Frank Keating South Dakota -Governor Bill Janklow Texas -Governor George Bush It is the Coalition's goal to increase the use of ethanol based fuels,to decrease the nation's dependence on imported energy resources,improve the environment and stimulate the national economy.This will be accomplished through a coordinated set of activities designed to educate and demonstrate to the public the benefits of ethanol use;to encourage ethanol fuel production and use through research and market development efforts;and to make investments in infrastructure to Support expansion of the ethanol market.The Coalition Supports the production of ethanol from corn or other domestic,renewable resources using sustainable agricultural methods and encourages its use in environmentally acceptable applications. P.O.Box 95085, Lincoln,NE 68509-5085, Phone 402-471-2867, Fax 402-471-3064 North Dakota Office of Intergovernmental Assistance State Capitol,14th Floor 600 East Boulevard Ave. Bismarck,North Dakota 58505-0170 The 1996 E85 Taurus Flexible Fuel Vehicle Flexible Fuel Benefits in America's Best-Selling Fleet Car Why Use 85%Ethanol Fuel? The 1996 Flexible Fuel Taurus operates the same as a was designed to operate on higher blends of ethanol.But, because it is a flexible fuel vehicle,it can operate on any blend of gasoline,up to 100 percent -or ethanol,up to 85 percent.QUITOSeDJUIIIIdST--TONVHLGS8a'JOUBUIAJUDII0dDALATAJYSIagasoline-powered model,only it By using more ethanol,rural America's economic growth continues -adding income for farmers and creating jobs for other Americans.Nearly 100,000 Americans working directly or indirectly in the nation's ethanol industry. Maybe you've already been operating your fleet vehicles on ten percent ethanol blends.By switching to 85 percent blends,you will be increasing the ethanol used more than eight times.The more ethanol is used to replace imported oil,the less America will rely on imported oil from unstable parts of the world.And you will be helping to lower the nation's trade deficit. Eight-five percent ethanol - it's a win-win for everyone. Specifications for the 1996 E85 Taurus A Commitment to the Environment The Taurus Flexible Fuel Vehicle is a prime example of Ford's commitment to protecting the environment and world leadership in the development of alternative fuel vehicles.Its an advanced Flexible Fuel Vehicle that is available in an ethanol version.Ethanol is a renewable fuel that burns cleaner.Taurus Flexible Fuel Vehicles operate on E85 (85%ethanol and 15% unleaded gasoline),unleaded gasoline or any mixture of the two in the same tank. This flexibility makes it ideal for fleet use in any location. A Dynamic New Taurus America's #1 fleet car has been totally redesigned.The 1996 model is the next generation Taurus,designed to be safer and quieter with more responsive performance, more agile handling and more comfort and convenience features than any Taurus before it.Aerodynamically,it incorporates advanced design with the sleek appearance to match.And it sets new,higher standards for mid-size sedans. The Best of Both Worlds The 1996 Taurus Flexible Fuel Vehicle has all the quality,safety and comfort of the gasoline-powered version.And because it's Ford-built,the E85 Taurus carries the same service and warranty*benefits as Ford's gasoline-powered vehicles. *Ask your dealer for a copy of the limited warranty. Option 992 3.0L V-6 Flexible Fuel Engine Upgrade ¢Unique block material 1996 TAURUS 3.0L Flexible Fuel Vehicle %Alcohol Stainless Steel e r WwW _j j Instrument and TeflonInceasedwearresistantpistonPanelBraidedFuel Anti-SiphonringsReadoutLinesDevice Installed Fuel¢Exhaust valve Unique Block Heater Filler Pipe seat inserts Calibrations Assembly for Ethanol¢Engineered cylinder headcombustion --- chamber YY, °Alcohol |as compatible 25 \pounds per 3.0L V6 FF Dielectric Fuel \ hour fuel BPgiages Senora eine'.Sema ten injectors Fuel Assembly New In '96 (Coated)Canisters 1996 Taurus Flexible Fuel Vehicle Improvements ¢New Steel fuel tank (18 U.S.Gallons/68 Liters) e«Revised fuel composition sensor e New in-tank fuel delivery module 1996 Taurus Feature Highlights ¢Dual air bagst* ¢Meets 1997 U.S.Federal side impact protection requirements e "Safety-cell”body construction ¢Sturdier body structure *Always wear your Safety belt. While 85 percent ethanol may be a new fuel to you,state governments have been using E85 in hundreds of cars for several years. In 1995,the National 'os m New StationsEthanolVehicleCoalition-a :@ Soon-topartnershipoftheGovernors'OpenEthanolCoalitionandNationalStations Corn Growers -was formed to Future Sites expand the use of 85 percent ethanol. AS part of that project, dozens of public fueling stations e are being opened throughout ¢Seats designed to prevent occupants from sliding forward under safety belts ¢Childproof rear door locks ¢Heated mirrors to help clear ice or SNOW e Advanced MacPherson front and quadralink rear Suspensions ¢Variable-assist power steering ¢More rear Seat knee and leg room *60/40 split fold-down rear Seat track ¢Particulate cabin air filtration ¢Optional hands-free cellular phone @ Boulder Golden &@ Denver Colorado Springs the Midwest.Thirteen stations are already open in four states and the District of Columbia and in 1996,at least 40 more will be opened. Additionally,dozens of 85 percent ethanol stations are serving state government's vehicle fleets. For more information on the locations of E85 refueling sites,contact the National Ethanol Vehicle Coalition at 309-663-0571 or?1-800-E85-8895. Grand Forks Duluth ABismarck Fargo A\Fergus Falls Aberdeen @ St.Cloud a Stevens Green,Marshall el Point @ BayHiMinneapolis-Pierre gy Madison ot Pad Mitchell gy Sioux Falls iti SiouxVermillionCity Rapid City Ames @Des Moines Council Davenport @ South Bend ClevelandOmahaMFwight '1Lincotn@Moline@Peoria Ft.Wayne eBloomiIndipallCincinnatiSpringfielde|badKansasEdinburgh@City+)(hs,qt tanktorta Jefferson City St.LoulsWichita Louisville e Lexington, &printed on recycled paper ..and at 1248 Pennsylvania Ave.,S.E.Washington,D.C.Qs Page 3 Energy Times June 1996 CROSS CURRENTS NORTH DAKOTA ENERGY NEWS Devils Lake Sioux Erecting Wind Turbine The Devils Lake Sioux have re- ceived a $200,000 grant from the De- partment of Energy for a wind energy project on the Fort Totten Indian Res- ervation.Wind en- ergy resource data, gathered for the past three years, with start-up assist- ance of the North Dakota State Energy Conserva- tion Program,were used to quantify the wind energy potential for the project. The Devils Lake Sioux wind energy project,un- derway with site selection, turbine and tower acquisi- tion,is expected to go on line sometime in July. Other elements of the wind energy project include an avian impact study,load identifica- tion,training and utility negoti- ations. Working with the Energy & Environmental Research Center at the University of North Dakota, the Devils Lake Sioux plan to build a 108-kW Micon wind turbine,to supply electric power to the Tribe. Energy Efficient Mortgages Available in North Dakota After two years of testing in five states,the United States Depart- men of Housing and Urban Development has extended the Federal Housing Administration (FHA)Energy-Efficient Mortgage Program to.all SO states.The ex- panded program was authorized by the Energy Policy Act of 1992. The FHA program enables a new or existing house buyer to finance 100%of eligible energy retrofits without the necessity of a new appraisal or additional credit qualification. The expanded FHA program in- cludes requirements setting limits on the size of the loan to 5%of property value ($8,000 limit);al- lows the maximum loan amount to be exceeded by the cost of eligible improvements;and requires energy savings tobe determined by a home rating,or energy auditor. Regional FHA field offices are helping to market the program to lenders. For details on the Expanded Energy-Efficient Mortgage Pro- gram,contact a HUD office and refer to mortgage letter 95-46, issued October 6,1995. Standing Rock Sioux Study Reservation Renewable Resources The Standing Rock Sioux Tribe at Fort Yates,and 15 other Tribes from 9 states,will receive Title XXVI grants,from a US Depart- men of Energy solicitation. The Standing Rock Sioux Tribe will focus on economic develop- men opportunities,to enhance the quality of reservation life with an integrated renewable resource _plan,to lay a foundation for amoresustainablefuture. Title XX VI awards are intended to assist reservations develop solar, wind,biomass and hydroelectric resources.Title XXVI provides opportunities for tribal govern- ments to assess the technical and economic feasibility of renewable energy projects,and to demon- strate DOE developed technolog- ies,in an operational environment. Page 4 Energy Times June 1996 CROSS CURRENTS NORTH DAKOTA ENERGY NEWS SUN DAY Shines at Special Schools More than 1,200 students part-icipated in energy \efficiency and renewable en- ergy learning activities at 42 schools in 35 communities . around North //Dakota,and celebrated SUN DAY 1996,an annual observance, facilitated by the State Energy Conservation Program.SUN DAY is dedicated to the educa- tive,economic and environmental benefits of energy efficient technologies and renewable energy'\applications. North Dakota SUN DAY activities focused on learning opportunities,and resulted with 43 teachers requesting suggested SUN DAY activities packages. SECP offered students free Ener- gy Ant coloring books,Pink Panther posters,use of Energy Source®curriculum kits and ener- gy efficiency and renewable ener- gy films and videotapes.In addi- tion,the SECP sent over 4,000 energy efficiency and renewable energy publications to students on behalf of their teachers. E85 Fuel in North Dakota The American Coal- ition for Ethanol announced that Fargo has been selected as the site of the first public (|E85 fuel station in North Dakota. ACE,along with the National Ethanol Vehicle Coalition,are .range of fuel choices. Although 10%blends of ethanol are readily avail- able in North Dakota,and\with the exception of E85 providing incentives to fuel retailers to add E85 to their availability at the state mo- tor pool in Bismarck,E85 has not previously been marketed in the state. E835 is offered for sale at the Cenex station on 13th Avenue South,just east of I-29 in Fargo. A second E85 fuel outlet,is ex- pected to be online by June 30 at the StaMart Station Store,at the junction of Hiway 2 and I-29,in Grand Forks. Other North Dakota outlets,in- cluding Bismarck,are planned for the state. Include Energy Efficiency in Home Flood Repair The North Dakota State Energy Conservation Program has a limited number of copies of Rebuilding Your Flooded Home for state residents experiencing water damage in their houses. Rebuilding Your Flooded Home is 36 pages of guidelines for incorporating energy efficiency into flood-damaged home repairs and to add energy efficiency at the same time structural needs are addressed.Many energy efficien- cy options available today may not have been available at the time of construction,even if it was built only a few years ago. To receive a free copy of Rebuilding Your Flooded Home, please call or write,North Dakota Office of Intergovernmental Assistance,State Energy Con- servation Program,600 East Boulevard,Avenue,Bismarck, ND 58505-0170,telephone 328-2094,fax 328-2308. « Calendar September 21-26 .BOCA Annual Meeting July 21-25 :_>(The 2nd ICC Code Development Hearings also willSBCCIMeetingbeheldatthismeetingonthesedates): _1996 Asheville,North Carolina Providence,Rhode Island |Comact:SBCCI Contact:BOCA (708)799-2300,fax (708)799-4981. 205)591-1853.:|(205)_October 14-16 =I August 25-31 ICC Code Development HearingsACEEE1996SummerStudyNewOrleans,LouisianaonnEnergyEfficiencyinBuildingsContact:ICC (310)908-8182.Pacific Grove,CaliforniaContact:Conference Manager,1001 Connecticut - Avenue N.W.,Suite 801,Washington,D.C.20036 (202)429-8873,fax:(202)429-2248. October 27-31.SBCCI Annual Research and Education Conference Sheraton Civic Center | Birmingham,Alabama'September 11-12 Contact:(205)591-1853. .International Energy &Environmental Congress-Milwaukee,WisconsinContact:The Association of Energy Engineers (770)447-5083 ext.210,fax (770)446-3969. November 14-17 : 1996 EEBA Excellence in Housing Conference -Hyatt Regency,Minneapolis - Contact:(612)851-9940. ®Printed on Recycled Paper |Setting the Standard A.L.Parker (address corrections) Pacific Northwest National Laboratory P.O.Box 999-MSIN K5-16 Richland,Washington 99352 Address Correction Requested U.S.DEPARTMENT "A Better Climate for Jobs”thHath laashils MeaalbeasteaslL3 US DEPARTMENT OF ENERGY BUILDING STANDARDS ANDO GUIDELINES PROGRAM _the improvement in energy efficiency in the 1995 version of _ -Publication of the 1995 MEC determination is expected this airreeea.Denver and Seattle Regions;in Columbus,Ohio for DOE's 2nd Quarter 1996SettingtheStandardVolume5,Issue2ComingThisSummer:Le gislative Determination_Regarding the 1995 CABO Model Energy CodeTheUS.Department of Energy (DOE)iis planning too publish _good faith effort to comply with such requirements and thatanoticeintheFederalRegisterofitsdeterminationregarding.-it has made significant progress toward meeting its certifica-tion obligations.Such demonstrations could include one or more of the following:1)a plan for response to the require- '.ments,2)a statement that the state has appropriated or requested funds (within state funding procedures)to imple-ment a plan that would respond to the requirements,or3)anoticeofpublichearing. the Council of American Building Officials (CABO)Model Energy Code (MEC),as compared to the 1993 version of the MEC,for low-rise residential buildings.The notice will provide guidance and procedures for states covering theirCertifications,Statements of Reasons and Requests forExtensionsofDeadlines.ooAnextensionmaybegrantedforthe1993MECcertification requirements due in July 1996,and for the 1995 MEC certifica-tion requirements due two years from the date of publication - of the draft determination.Requests for extensions for filing certifications for the 1993 MEC should be submitted separately from those for the 1995 MEC. summer.States will have two years from the publication date to review their low-rise residential building codes,compare them to the 1995 MEC,decide what action (if any)they willtaketorevisetheircodes,and file a certification statementontheseactivitieswithDOE.;a, .For further determination on this determination and certifi- 'cation requirements for residential buildings,contact StephenTurchen(202)586-6262 or Stephen Walder (202)586-9209atDOEinWashington,D.C.. The Secretary of Energy may permit an extension of the dead-line for complying with the certification requirements described above if a state can demonstrate that it has madea | 'Fill '96 Building Standards and Guidelines Workshop PlannedTheDOEanditsRegionalSupportOfficesaresponsoring© four building standards and guidelines program workshops this fall.Workshops will be held in Las Vegas for DOE's *Code implementation and enforcement tools and lessonslearnedinthestates e "The status of state codes Chicago Region;in Atlanta for DOE's Atlanta Region;and in Newark,New Jersey for the DOE Philadelphia and Boston Regions.Exact dates and locations are being finalized and will be announced soon. *Code training possibilities *Home energy rating systems. The workshops are directed toward state code officials,energy office staff,utilities staff,and other state staff or stakeholder groups involved with the adoption,implementation,and enforcement of building energy codes.Participants in similar workshops held in 1994 and 1995 found that the workshop setting offered an excellent opportunity to discuss issues and | concerns related to building energy codes in their state. The workshops will address iissues related to the adoption,development,implementation,and enforcement of residen-tial and commercial building energy codes.Each workshopwillfeaturetopicstailoredtomeettheneedsofthestatesin its respective region.Topics will include: *Anoverview of the ASHRAE/IES Standard 90.1-1989 and .CABO Model Energy Code .."ses for a©An introduction to MECcheck™and COMcheck TM "A BY,code compliance software For more information about dates,location,and regis- tration call the Building Standards and Guidelines %Program Hotline at (800)270-CODE.There iis%no registration fee, "A Better Climate for Jobs” * The Model Energy Code:FrequentlyAskedQuestions The Model Energy Code (MEC)is published by the Council of American Building Officials (CABO)and revised approxi- mately every three years.Here are some answers to fre- quently asked questions about the MEC as compiled by staff of the Building Standards and Guidelines Program. Q What residences does the MEC apply to?Are any buildings | -exempt from the code requirements?. A_The MEC applies to new one-and two-family residences..It also applies to multi-unit residences of three stories or less.Buildings or portions of buildings that are neither :heated nor cooled are exempt,as are buildings that have a low peak rate of energy use (below 3.4 Btu/h or 1.0 watt/f2).Existing buildings are exempt,except -for additions to those buildings (expansions to the . conditioned floor space).Historic buildings are alsoexempt.Historic buildings include buildings designated as historically significant by state or local governments_and buildings listed or eligible to be listed on The National Register of Historic Places. Q_What types ofbuildings would be considered residential -buildings and would be covered by the residential require-.ments in the MEC? 'A Detached one-and two-family dwellings are considered residential buildings (type A-1 in the MEC).All other residential buildings of three stories or less are consid- ered to be multi-family (type A-2)residences.The presence of dwelling units (independent housekeeping . units complete with living,sleeping,eating,cooking, and sanitation facilities)in the structure distinguishes residential buildings from commercial buildings.Apart- .ments and condominiums would be considered type A-2buildingsbecausetheygenerallyhavethesefacilities. Because of the lack of complete living,sanitation,andeatingfacilitiesinhotels,motels,barracks,dormitories,nursing homes,etc.,such structures would be covered bythecommercialbuildingcode. Q Ifa hotel/motel buildingis converted to multi-family residential use,does the converted building have to meetthecode? A_If the conversion resultsin an increase in the peak demand (connected space heating,space cooling,and water heating load)of the building,then yes,the entire building must be brought into compliance...>OQ Does an addition have to meet the air leakage requirementsintheMEC? A Yes,an addition must meet the requirements to seal the new space from air leakage.Sealing the junction between the new conditioned space and the existing conditionedspaceisparticularlyimportantbecausesubstantialairleakageoftenoccursatthesejunctions.For example,thejunctionbetweentheroofofanewadditionandan existing wall is a common site for substantial air leakage. Q Ifa basement wall is partly exposed,which part do I need to insulate,the part above ground or below ground? Both.If the insulation was left out,that uninsulated portion would need to be accounted for in an overall building heat loss/gain computation. When must the basement walls be insulated?- Basement walls must be insulated when the basement is heated (i.e.,heated or cooled).A basement is classified as heated if it has supply air registers,heating or cooling elements designed for conditioning the space,hydronic coils or radiators,a wood stove,or uninsulated ducts. Q Does the duct system in an unconditioned basement (i.e., one that has the floor above insulated)have to be insulated? Yes.Ducts in unconditioned spaces must be insulated. MECcheck™Now Available at Nominal Cost In April 1996,the U.S.Department of Energy's Buildings Standards and Guidelines Program (BSGP)began charging $20 for each copy of MECcheckT™materials.MECcheck includes the MECcheck Manual,Prescriptive Packages,Soft- ware,and Users Guide.Some of the MECcheck Software and manuals can still be downloaded at no cost from the BSGP __web site on the Internet at http://www.energytech.palgov:2080/bsgp/. The charge is necessary to recover part of the cost of printing and distributing the materials in hard copy.The demand for the MECcheck materials has grown while the budget for printing and distribution has shrunk.Since January 1996,- 750 copies of the MECcheck materials alone have been pro- duced.To enable product development to continue and to avoid limiting the number of copies that are distributed,BSGP management elected to recover part of the costs for repro- ducing MECcheck.There are now 9,000 MECcheck users in16Statesand35localgovernments.For more information or to ordera copy of MECcheck,calltheBSGPHotlineat(800)270-CODE. Setting the Standardis published quarterly for the US,Department of Energy.by the Building Standards-and.Guidelines Program at the PacificNorthwestNationalLaboratory.Its purpose is'to encourage information exchange among buildings industry professionals and organizations,state We welcome reader ¢co ents and contributioncandlocalcodeofficials,and researchers.'The goal:is facilitate timely development and early adoption of the building energy conservation standards,«Editor,Rosalind Schrempf *Layout:BEY Neidehiser :Hotline:(800)270-CODE..: The 1992,1993,and 1995 Model Energy Codes-What's the Difference? The three versions of the CABO MEC most commonly usedarethe1992and1993MEC.A new version of the MEC ispublishedeverythreeyears;in 1993 a special version waspublishedbecauseanumberofsignificantcodechangeshadbeenapprovedbytheCABOcommitteethepreviousyear.- The next version of the MEC is expected to be published in 1998.(The first version of the MEC was issued in 1983,andupdatedversionswerepublishedin1986,1989,1992,1993,©and 1995.)The 1995 MECis now being considered foradoptioniinseveralstatesandjurisdictions,While most sec-tions of the 1992,1993,and 1995 versions of the MEC arethesame,there are some differences worth noting. -The most significant differences between the 1992 and 1993 versions are that the 1993 MEC has°°more stringent wall insulation requirements 'for multi-family buildingsin'all locations *more stringent ceiling and wall insulation requirements in _ single-family homes in warmer (southern)locations (zones 1 through 8 in the MECcheck™<materials) *'new duct insulation R-value requirements and a more readable requirements format.In most cases,these require-ments are not more stringent than the 1992 MEC require-ments. The 1992 MEC is very similar to the 1989 MEC in its level - of required insulation/window energy efficiency.The insula- tion requirements in the 1986 MEC and all previous versions are based on the older ASHRAE Standard 90-80A and are much less energy-efficient than the older codes. The significant differences between the 1993 and 1995 versionsarethatthe1995MEC-*adds provisions to limit heat loss and air infiltration throughrecessedlightingfixtureslocatedinthebuildingenvelope *adds a reference to the National Fenestration Rating Council (NFRC)standard for U values of glazing assem-'blies and provides default U-values for products without_NFRC U values ¢adds criteria specifically to correct for metal stud framing in wall thermal calculations '®strengthens the duct-sealing provisions and applies them to all supply and return ducts.Duct tape is*specificallydisallowed. *references a newer version of the ASHRAE Handbook of Fundamentals,raising the default wall framing factor and, effectively,slightly strengthening the insulation/window requirements *eliminates the potential for insulating the walls of a ventilated crawl space rather than the floor above. ©Two reports are available that provide additional detail about the differences between the 1992,1993,and 1995 MEC: Differences Between the 1992 and 1993 CABO Model Energy -Codes (PNL-10387)and Differences Between the 1993 and 1995CABOModelEnergyCodes(PNL-10775).To obtain a copyofoneorbothofthesereports,call the Building Standards”and Guidelines Program Hotline,(800)2270-CODE._- Training Update:COMcheckTMPlansareunderway to onduct training on COMcheck™,a compliance tool that incorpo-° rates software and prescrip- tive methods that can be used for complying with ASHRAE/. IES Standard 90.1-1989 (Stan-.dard 90.1)COMcheckis 'scheduled to be released by theendofAugust,and training will beginin September and.October.As we went to press,initial training sites had_been selected in Ohio,Utah,and New Jersey.A training |location will also be selected in the Southern United States. The training is designed to be a one-day session that will focus on using the COMcheck compliance tool to make the buildingenvelope,mechanical system,and lighting system comply - with Standard 90.1.A practical,realistic approach will betakentoshowhowtocomplywiththecodeusingCOMcheck.The training will address the following questions:"©When does the code apply?*What do I need to do to make my building comply?¢How do I use the COMcheck compliance tool to showcompliance?¢What do I need to check to ensure compliance using theCOMchecktool? More details on upcoming COMcheck training will be _announced this summer.For more information,contact Eric Makela at Pacific Northwest National Laboratory (09)372-4744, Alt.Feel Vefrele esEnvi.Frey shy Dandi Oc.a Prag -Havel =20LEKLE -1400 a;Works -mlnja |Cheep:ng.-Nev:riZons._TAVOn -.Sowayieg.soledngeevo."pregom.weeveOTFregyem.-CNG.yehicles oo Diana.-R.tbis.-LE R-4FAOS cSC9e8be).oe iCehyegel)-ee Eft Lov,l Ns popesod |Oy_"iO OK ethan ewe aeeh |__SOOT vill yon 8Peabng ete ret eh contract vektcle ¢-/Q0_ae hom USA rl)do _esnverst orn:_EDT Ricky etal. : é 7 ao : fy ton + a , i ; . : . . , . - . wa . a R . , 5 6 . '' - . 4 ” 7. ' ' ' , . a wv i t , . at . t woe . , * ' . : ; , Fs i . . , : od ia ' = \ : . . " a oo -” - . Bs i 5 id ' . on . : - : 5 « aan ; . ; we a / \ Pa . : i . . . ' . : ) ; ; a pene 3 ' y ' - = , L : : H 5 F . ; , \ . , e \ : . ---f - 4+ -.. -} ----4---_ +. - = - Rocky Flats agreement signed The Rocky Flats Cleanup Agree- ment and Vision Statement were made final July 19 at a signing ceremony held in Colorado Gov.Roy Romer's of- fice.The agreement and vision are the culmination of three years of negotia- tions between DOE,the Colorado De- partment of Public Health and Envi- ronment,the EPA,and Lt.Gov.Gail Schoettler. The vision and agreement will al- low Rocky Flats cleanup and closure to proceed at an accelerated pace while focusing on accomplishing the highest risk-reduction activities first. They were finalized following a 60- day comment period in which 150 public comments were received. "We can now get on with the im- portant cleanup and closure work and convert this site to other appropriate uses,”said Romer."The vision sets out what we hope to achieve for Rocky Flats and the cleanup agreement pro- vides the tools to get us there.The fundamental objective of these docu- ments is to make sure that Rocky Flats is cleaned up quickly and effectively and made safe.” "This is a groundbreaking agree- ment for DOE in terms of a coopera- tive effort and consultation with the regulators and the public and,most importantly,will enable us to get on with the cleanup and closure of Rocky Flats,”said Al Alm,assistant secretary for Environmental Management. The vision and agreement are es- sential to achieving DOE's goal to sub- August 1996 AROUND stantially complete cleanup under a Ten-Year Plan."Rocky Flats is setting a standard for other DOE facilities in getting the job done within 10 years,” Alm said. SRS plans tank closure With the vitrification of high-level liquid radioactive waste under way at its Defense Waste Processing Facility, the Savannah River Operations Office is hoping to transfer that momentum to yet another first-of-its-kind mile- stone:the closure of a waste tank by the end of the year. Responding to stakeholder interest, DOE,the EPA and the South Carolina Department of Health and Environ- mental Control hosted a June 11 infor- mational meeting in North Augusta to discuss the Draft Environmental As- sessment for high-level waste-tank clo- sure,along with the submitted Indus- trial Wastewater Closure Plan for 51 high-level radioactive waste tanks at SRS. Public comments were accepted through early July on the draft Envi- ronmental Assessment,and incorpo- rated into the plan for resubmittal to the state and EPA for approval.Public feedback strongly supports closure. INEL chosen to lead systems engineering The Idaho National Engineering Laboratory will lead the way in imple-- menting systems engineering prin- ciples and practices throughout the DOE complex. A newly announced Partnership in Systems Engineering Excellence names the Idaho Operations Office to head up efforts toward establishing a more disciplined,systematic approach for programs,projects and facilities man- agement.The partnership will formal- ize a systems approach to safely and cost-effectively solve technical,mana- gerial and safety problems for all DOE site Operations. The partnership-announced June 27 by Don Pearman,associate deputy secretary for Field Management-was formed between the DOE Offices of Environmental Management and Field Management,the Idaho Operations Office and the INEL. As lead organizations,DOE-Idaho and Lockheed Martin Idaho Technolo- gies Company will provide training in systems engineering principles and practices throughout the DOE com- plex. Systems engineering is the struc- tured discipline that considers all as- pects of a program in developing products and services to meet specific customer requirements and objectives, all within budget and schedule.+ United States Department of Energy (CP-41) Washington,D.C.20585-0505 Official Business eu22lo0403 Udi U7Z99O =Pp CRIMP CP-41 ENERGYAKCUMMUALTTY-REo AFFA [ks333west4THAve#22U ANCHURAVE AK99201-2541 FIRST CLASS U.S.POSTAGE PAID TEMPLE HILLS,MD PERMIT NO.4820 20 DOE This Month -DEPARTMENT OF b "ADAMtreedONMRASalBeerBOARteheeSmIyeEvLpOBSmy«SauisiipcemussidhchalYonesdaniad?Aicdeiat,0aoak (DOE======Inside U.S.Department of Energy Published monthly at Washington, D.C.,by the Department of Energy, Office of Congressional,Public and Intergovernmental Affairs for the in- formation of Department employees and affiliates and available to oth- ers by paid subscription. The Secretary of Energy has deter- mined that this periodical is neces- sary in the transaction of public busi- ness as required by law.Use of funds for printing has been approved by the director of the Office of Management and Budget.The content is reprintable without permission and pictures are available for media reproduction upon request. : Hazel R.O'Leary Secretary of Energy Carmen E.MacDougall Deputy Assistant Secretary for Communications Tracy L.Cozzens,Editor Dennis Cresswell,Carmen Stafford Contributing Editors Lorraine Entwisle Graphic Design SUBSCRIPTION price for 12 issues is $21 ($26.25 foreign).Send check,or pro- vide VISA or Mastercard number and expiration date,to:Superintendent of Documents,P.O.Box 371954,Pittsburgh, PA 15250-7954.Credit-card orders can be called in 8 a.m.-4 p.m.ET, 202-512-1800,or faxed to 202-512-2250. Cite "DOE This Month CEINS).” Circulation Office:202-586-2050 News Office: DOE This Month c/o Westinghouse Hanford Company Employee Communications P.O.Box 1970,mailstop B3-26 Richland,WA 99352 Phone:509-376-4639,fax:509-376-5560 Internet address: Tracy_L_Cozzens@r1l.gov Street address:1100 Jadwin Ave. Richland,WA 99352 Deadline for submissions:15th of every month for the following month. DOE PA-0019-8 Vol.19,No.8 DOE This Month is printed on paper containing at least 50 percent recycled materials. *\150-300 seashipments ins :countries Under a new DOE policy,DOE will woes J Euro . So eae Theisdeeast]accept about 20 metric tons of 5 f Chariestor',Aft .rae Gn Asia spent nuclear fuel into the U.S., Station starting this summer. Radioactive materials!Who ya gonna call?Brookhaven National Laboratory, where a special team helped law enforcement investigate a criminal conspiracy to assassinate public officials using radium. The Atlanta Games showcased more than athletic accomplishment. The Games provided an opportu-= A"nity to demonstrate clean energy wonvnnians "|technologies to the world. am On our cover The first canister of vitrified high-level waste rolled out of the West Valley Demonstration Project in New York in July.The success was the culmination of 14 years of design,construction and testing of a state-of-the-art facility. The West Valley plant is the nation's second high-level nuclear waste vitrification plant.Last March,the Defense Waste Processing Facility at Savannah River began operating. At top is the control room,where start-up operations were monitored by (from left)Bill Poulson,president of West Valley Nuclear Services;Ted Sonntag,program manager for the New York State Energy Research and Development Authority;Tom Rowland, DOE West Valley Area Office project director;and Eric Smith, vitrification systems engineer. At bottom,the first canister of high-level waste glass is positioned for placement inside the weld station for canister lid welding. For more on West Valley,see page 5. DOE This Month Rice named 'Federal Employee of Year' Susan Rice,management analyst for the Fernald Area Office,received the Federal Employee of the Year award from the greater Cincinnati area Federal Executive Board for the administrative/technical cat- egory.Rice was recognized for her outstanding per- formance,innovative ideas and effective manage- ment of challenging projects,including personnel, administration,information systems and perfor- ;mance-based fee. Rice One of her most visible contributions was establish- ing an Information Center so employees can access va- cancy announcements from other DOE operations offices and federal agencies. Within five years of joining DOE in 1986,Rice advanced from secretary/steno to management analyst through DOE's Upward Mobility Program. "Susan's fast-paced advancement to management analyst is due to her outstanding work performance,day-to-day demonstration of professional- ism,and willingness to reach beyond her own job to help others,”said Fernald Area Office Director Jack Craig."She has earned this recognition.” NEWublications USDOE Office of Inspector General re- ports on Audit of Department of Energy Management and Operating Contrac- tor Available Fees (May)DOE/IG-0390; Audit of Department of Energy's Ac- tivities Designed to Recover the Tax- payers'Investment in the Clean Coal Technology Program (June)DOE/IG- 0391;Audit of Groundwater Remedia- tion Plans at the Savannah River Site (June)ER-B-96-02;Audit of the Depart- ment of Energy Program Offices'Use of Management and Operating Con- tract Employees July)DOE/IG-0392. Available from Office of Scientific and Technical Information,P.O.Box 62,Oak Ridge,TN 37831;http:// gopher.hr.doe.gov. Mbtestones YEARS OF SERVICE August 1996 Headquarters Office of the Secretary -Ann Farace (25 years).Chief Financial Officer -Linda I.Keller (25).Congressional/Public Affairs -Barbara L.Barnes (30),Ruth K. Vass (30),Edith U.Ward (30).Defense Programs -Glen L.Tayler G5).Eco- nomic Impact/Diversity -James T. Dixon (35),Therra A.Robinson (25).EIA -Clyde E.Boykins (35),Ronald W.O'Neill (30),EdwardJ.Flynn (25).Energy Effi- ciency -Ronald R.Loose (35),Pauline K. Mazariegos (30),Agnes L.Savoy (30). Energy Research -Stephen G.Buswell (25).Envir.Management -Maria E. Vignone (25).Envir.,Safety &Health - Judith D.Foulke (25).FERC -Jerome M. Feit (40),Stephen L.Grossman (35),John W.Scott (35),Shirley M.Arrington (30), Thomas M.Mould (30),Marilyn L.Rand (30),Leonard Burton IV (25),Karen M. Canada (25),David E.Hunter (25),Dou- glas P.Redman (25).Fossil Energy - George E.Lynch III (25),Steven Mintz (25). General Counsel -Clara R.Barley (25). Human Resources -Belinda G.Hood (30),Camellia McKie (30),Sandra J.Beatty (25),Gwendolyn S.Cowan (25),Sharon A.Evelin (25),Gloria A.Paige (25).In- spector General -Richard D.Terry (25). National Security -Bernard K.Dehmelt (25).Nuclear Energy -RobertJ.Neuhold (25).Scientific/Technical Information -Barbara H.Layton (25). Field Albuquerque -George L.Rader (30), Bobbie E.Ashmore (25),Margaret R.Cerno (25),James W.Lester (25),Joe H. Nickerson (25),Jonathan F.Sink (25). Chicago -Philip W.Krey (40),David E. Ramirez (25).Golden -Robert J.Brown (30),Peter Palica (25).Morgantown ETC -Peter E.Schuster (25).Nevada -Marvin R. Dockter (25),Bill D.West (25). Oakland -Maria J.Solis (35),Robert H. Teets (25).Oak Ridge -Lowell F. Campbell (35),Eugene W.Gillespie (30), K.Dean Helms (30),Ronald O.Hultgren (25).Ohio -James A.Smotherman (25). Pittsburgh ETC -Richard R.Desantis (25), James I.Joubert (25),Lloyd Lorenzi,Jr. (25).Richland -Waldemar F. Hendrickson (25).Rocky Flats -Wilda L.Sutter (30).Strategic Pet.Reserves - Donald E.Smith (25). Bonneville Power -Mark L.Dunton (30), Gary M.Ihle (30),Frederick M.Johnson (30),William E.Kendrick (30),James R. Lewis (30),Philemon T.Reid (30),David L.Sakala (30),Ronald F.Stark (30),Michael C.Davis (25),Kathy L.Eaton (25),Ronald > H.Holeman (25),Rose Ann M.Lafferty (25),Arlene T.Miller (25),Cheryl A. Ostrom (25),Donald A.Thompson (25), Carl T.Timmons (25),John R.Weiss (25), Robert E.West,Jr.(25). Southwestern Power -Donna M.Heslar (35),Cheryl R.Crosswell (25),Gerald W. Martin (25).Western Area Power -Rob- ert A.Stucklen (35),Ronald R.French (30), Gary L.Jernigan (25),Kenneth E.Mathias (25),Stephen C.Stuntz (25),William D. Telschow,Jr.(25). RETIREMENTS May 1996 Headquarters Envir.Management -Raymond E. Gibson (30 years). Field Western Area Power -Harry S.Pierce (20). June 1996 Headquarters Chief Financial Officer -James H. Maroldo (28).EIA -Shirley A.Brannan (28),Edward Hill,Jr.(31),E.Diane W. Lique (31). Field Alaska Power -Ronald J.Doty (34).Al buquerque -Harry T.Season,Jr.(27). Bonneville Power -Billie D.Deal (17), Victor D.Gordon (30),Peter M.Jenkins (31),Richard A.Raynor (19).Idaho - Joanne M.Flinn (20),Marvin J.Rieb (9). Morgantown ETC -Louis A.Salvador (10).Oak Ridge -Karen S.Cochran (28), Western Area Power -Wayne M. Hoffman (34). July 1996 Weadquarters Envir.,Safety &Health -Teresa L.Ross (30). Field Naval Pet.Reserves CA -George S. McJannet (25). August 1996 19 e Donnie Cubbage,telecommunica- tions specialist in the Headquarters Of- fice of Information Management,Hu- man Resources and Administration,re- ceived the "Management/Administra-. tive Excellence Award”as part of the 1996 Federal Telecommunications Ser- vices (FTS)Awards.Cubbage was honored for his outstanding initiative and leadership in the development and implementation of service en- hancements in compressed video transmission services and the addition of wideband video digital satellite compression service to the FTS2000 contract. e Pacific Northwest National Labora- tory Director Bj]Madia has honored three staff members with the Fitzner/ Eberhardt Award for Outstanding Con- tributions to Science and Engineering Education.A retired Pacific Northwest scientist,Lee Rogers,Was presented with a special "lifetime contribution” award for helping students and the public understand and appreciate the ecology of the Columbia Basin.Re- searchers AJ Fuciarelli,Eric Nyberg and Jim Young were selected for theircontributionstoeducationprograms and professional!recognition received. e Dieter Gruen,Argonne National Laboratory,has been included in the 1996-97 edition of Who's Who of American Inventors.The honor was based on Gruen's recent patent,"Dia- mond from Fullerens,”a new method of producing thin diamond film from recently discovered soccer-ball-shaped molecules of carbon.The film is ex- tremely smooth and offers low friction and high resistance to wear,and shows promise as a low-friction coat- ing for machine tools and rotary pump seals.Who's Who of American Inven- tors profiles U.S.inventors whose in- ventions have made a positive impact on society.Fewer than 10 percent of all patent holders are selected each Gruen Lindberg Roberto International Atomic Energy Agency positions overseas Nominations for the following IAEA positions are considered by the IAEA along with applicants from other IAEA member nations.Assignments are usually for three years and are deemed to be exempt from national income tax.Copies of special application pack- ets,including vacancy announcements,can be obtained by calling 202-586-8253. year for this honorary membership. e A video documentary and a book- let produced at Los Alamos National Laboratory about the Acquired Im- mune Deficiency Syndrome and its precursor,the human immunodefi- ciency virus,have been nationally rec- ognized.The "Our Faces”video and "HIV/AIDS in the Workplace:A Posi- tive Approach,”were winners in the 1996 Social Responsibility Awards competition of the Women Executives in Public Relations.The 54-page book- let was developed by Debbi Wersonick and the 29-minute video was produced by Dan Curry.Both are in the Lab's Human Resources Division. e Steven Lindberg,a senior re- search staff member for Oak Ridge National Laboratory,has received a sabbatical award from the Interna- tional Institute of Hydrophysics at the GKSS Research Center to conduct re- search projects in Germany.Lindberg will be conducting research on the en- vironmental chemistry of mercury, specifically the atmospheric emission of mercury from wetland soils in the Elbe River floodplain. ¢Jim Roberto,director of Oak Ridge National Laboratory's Solid State Division,has been appointed vice chair of the Committee on Condensed Matter and Materials Physics of the Na- tional Research Council.The commit- tee will prepare a report that provides guidance for long-range planning in the fields of condensed matter and material physics. e Nora Volkow,4 board-certified psychiatrist at Brookhaven National Laboratory,was appointed chair of the Medical Department.Volkow has made major contributions to the scien- tific community's understanding of ad- diction.She will oversee research that includes the development of new di- agnostic techniques in nuclear medi- cine,medical physics and radiation therapy. ¢Paul Bertsch,a senior researcher at the Savannah River Ecology Labora- tory,was recognized for his outstand- ing contributions in soil chemistry and clay mineralogy by the Soil Science Society of America.Bertsch has con-Approx.Salary Position Title Vacancy No.Closing Date ; $71,417 Nuclear data info.physicist 96/035 Aug.15 ducted research at the laboratory for $85,051 Nuclear medicine physician 96/036 Aug.15 12 years.He is also technical director $82,757 Radiation oncologist 96/037 Aug.26 of the Advanced Analytical Center for $82,757 Transport safety specialist 96/038 Aug.26 Environmental Sciences.¢ 18 DOE This Month Cold War technology to help KazakstanheU.S.Department of Energy and the Kazakstan Ministry of a Science-Academy of Sciences plan to adapt airborne sensor technol- ogy developed in the U.S.for defense uses to environmental protection and energy exploration. The science and technology agree- ment signed July 12 in Washington, D.C.,between Secretary Hazel O'Leary and Kazakstan Ambassador Bolat Nurgaliev builds upon previous joint activities between the two countries, such as the movement of weapons- grade uranium from Kazakstan to se- cure storage facilities in the U.S.under Project Sapphire. The expanded cooperation will fur-. ther the U.S.nuclear nonproliferation goal of preventing "brain drain”in the Newly Independent States by employ- ing scientists at former nuclear facilities in peaceful technology ventures,inchuid- ing environmental cleanup programs, while promoting trade and investment opportunities for U.S.industries. The use of DOE's Airborne Multi- sensory Pod System (AMPS)in Kazakstan to support environmental cleanup,map unique ecological zones,and explore for mineral depos- its is expected to be the first joint ef- fort under the agreement.Scheduled for later this summer,this mission will use the technology for the first time outside the U.S. "This mission to Kazakstan,which will apply Cold War technology to en- vironmental cleanup,is a perfect ex- ample of what we can accomplish un- der this agreement,”O'Leary said. "These projects will further U.S.for- eign policy goals of employing de- fense personnel and facilities in peace- Secretary Hazel O'Leary shakes hands to seal an agreement with Kazakstan Ambassador Bolat Nurgaliev which will use a former U.S.military technology for environmental cleanup and energy exploration. ful programs,which in turn will help the Kazakstani economy and people move to a strong,free-market system. U.S.industry will benefit as well from the increased trade and investment Opportunities.” AMPS is a collection of airborne re- mote sensing systems developed to support arms control and nonprolif- eration.It is the result of a multi-labo- ratory effort led by Pacific Northwest National Laboratory and involving Sandia and Lawrence Livermore Na- tional Laboratories,as well as the Na- val Research Laboratory in Washing- ton,D.C.,and the Bechtel Nevada Re- mote Sensing Laboratory. The program supports research ef- forts in such disparate areas as agricul- ture,marine resource protection and environmental cleanup in addition to national security activities such as treaty verification. AMPS features two large pods de- signed to be carried beneath the wings of U.S.Navy P-3 aircraft.The pods contain sophisticated imaging instru- ments that produce impressions of the earth's surface below the aircraft,in- cluding high-resolution images and to- pographic maps of stunning accuracy and detail.It includes aerial photogra- phy,video,hyperspectral and multi- spectral imagers,and an imaging radar. The AMPS mission will help Kazakstan evaluate and clean up sites used by the Soviet Union to develop and test nuclear and biological weap- ons so the sites can be closed or con- verted to commercial,non-weapons activities. One potential use for the AMPS technology is exploration of mineral deposits,particularly at a former nuclear weapons test center.The project could also improve the coun- try's transportation,irrigation and agri- cultural systems as well as protect unique ecological zones,including the last desert forest known to exist. U.S.and Venezuelan energy secretaries discuss bilateral cooperation Secretary Hazel O'Leary met July 9 with Venezuelan Minister of Energy and Mines Erwin Arrieta.The two en- ergy secretaries discussed the bilateral energy relationship and their joint leadership of hemispheric energy co- operation activities which follow up on the Summit of the Americas. O'Leary congratulated Minister Arrieta on the success of the petro- leum opening,or "apertura.”Interna- tional oil consortiums,including seven American oil and natural gas majors and independents,will partner with Petroleos de Venezuela to develop eight large oil and natural-gas tracts in Ven- ezuela.The contracts,which have been approved by Venezuela's Congress, were signed in Caracas July 10. "Venezuela has become the largest, and a most reliable,supplier of oil im- ports to the United States,”O'Leary said."Venezuela holds sizable invest- ments in the United States energy sec- tor and our market welcomes Venezu- elan oil exports.”She called Ven- ezuela's petroleum opening a historic opportunity which will cement Venezuela's role as a major oil pro- ducer into the next century.¢ August 1996 DOE working to prevent spread of nuclear weapons Under a new policy,DOE will ac- cept about 20 metric tons of spent nuclear fuel into the U.S.from for- eign research reactors over a 13-year period,beginning this summer. The decision comes after nearly three years of intense effort by DOE. It will significantly contribute to the national objective of preventing the spread of nuclear weapons. DOE issued a record of decision on the Nuclear Weapons Nonprolif- eration Policy Concerning Foreign Research Reactor Spent Nuclear Fuel on May 13,in consultation with the Department of State. The enriched uranium in this spent fuel was exported by the U.S. starting with the "Atoms for Peace” program in the 1950s. Under that program,the countries agreed not to develop nuclear weap- ons if the U.S.would help them with peaceful applications of nuclear en- ergy. The spent fuel will be received from up to 41 countries through the Charleston Naval Weapons Station in South Carolina (about 80%)and the Concord Naval Weapons Station in California (about 5%). Some of the material (about 15%) will be received overland from Canada. Shipments through Charleston are expected to begin this summer,and Concord 1NavalWeapongStationi'.feel, FOREIGN RESEARCH REACTOR FUEL TO BE ACCEPTED AT U.S.SITES through Concord in mid-1997.An Implementation Strategy Plan has been completed,and DOE is now working with affected states and lo- cal governments to develop detailed transportation plans. The spent nuclear fuel will be managed at the Savannah River Site and Idaho National Engineering Laboratory,along with other DOE- owned spent nuclear fuel,until a re- pository is available for permanent . disposal. The project team faced a techni- cally challenging environmental evaluation interwoven with interna- tional policy and diplomatic con- PR 240 truck or tower rail shipments from Canada 150-300 sea shipmentsfrom38 countries .Europe"The Middle EastGt”South AmericaffCharlestor''...AfricaNaval%AsiaWeapons.:Station cerns.The final environmenta!im- pact statement was prepared by SAIC under the management of Charles Head of Environmental Management. Dave Huizenga,acting associate deputy assistant secretary for Nuclear Material and Facility Stabilization, will continue to provide overall di- rection for implementing the policy, with Environmental Management's Ken Chacey serving as implementa- tion team leader. Other key team members include Judith Holm,transportation manager; Bill Clark,Savannah River;and Bob Stump,Idaho National Engineering Laboratory.+ Additional BPA downsizing could affect 900 Following a three-year downsizing effort to reduce its regular and con- tractor staff by 20 percent,the Bonneville Power Administration has announced new downsizing targets over the next three years.The move, which could affect as many as 900 regular employees and contractors,is expected to save $70 million annually. BPA is the nation's largest federal power marketing agency.For nearly 60 years,BPA has supplied half of the Pacific Northwest's electrical power and provided the lowest wholesale electricity rates in the nation. Now,facing deregulation in the wholesale electrical utility industry, BPA is facing intense competition for the first time in its history. While other wholesale electricity suppliers now offer comparably priced power,they do not have BPA's legisla- tive mandates and public responsibili- ties to Northwest consumers,other government agencies,taxpayers and the environment. BPA has mandates for providing leadership in energy conservation,de- velopment of renewable energy,and funding for fish and wildlife protec- tion. "We intend to honor our obliga- tions to provide public benefits,and the way to do that is through a com- mercially viable business,”said Sue Hickey,BPA's chief operating officer. "Our vision is a lean organization with highly skilled employees.We are working diligently to achieve a level of efficiency that will set a standard for both business and government.” The new target calls for a reduction of about 500 BPA employees and 400 contractors by 1999.The targets are preliminary and will be refined as part of BPA's reengineering effort.In the early 1990s,BPA had close to 3,700 employees.Today,the number is 3,230. BPA hopes to avoid involuntary layoffs,Hickey said."I believe we have the tools to meet our targets without the terrible disruption of in- %,voluntary downsizing.” 4 DOE This Month COMING vents Petroleum solutions sought Petroleum companies with environ- mentally related legal,regulatory and technical issues will have an opportu- nity to discuss their concerns with se- nior officials from federal and state regulatory agencies at the Third Inter- national Petroleum Environmental Conference Sept.24-27 in Albuquer- que,N.M. The National Petroleum Council,a 180-member advisory panel to DOE, recently urged DOE to work with in- dustry and public agencies to find ways to lower the costs of regulatory compliance without sacrificing envi- ronmental protection. The Albuquerque conference offers an ideal forum for professionals from the oil and gas industries to discuss situations in which federal or state regulations impose significant cost or administrative burdens that could be reduced through better coordination between regulatory agencies or with better technology or scientific data. Sponsors are DOE,the University of Tulsa and the South-Central Envi- ronmental Resource Alliance.Chttp:// www .fe.doe.gov;Barbara Derby,Con- tinuing Engineering Education,600 South College Ave.,Tulsa,OK 74104- 3189;918-631-3088;fax 918-631-2154, e-mail:conted-cee@utulsa.edu) Warsaw site of symposium The Third International Symposium and Exhibition on Environmental Con- tamination in Central and Eastern Eu- rope (Warsaw '96)will be conducted in Warsaw,Poland,Sept.10-13.This is the third symposium following the highly successful Budapest '92 and Budapest '94 symposia. This event will focus on the envi- ronmental problems of Central and Eastern Europe with an emphasis on identifying and evaluating solutions in- volving innovative and low-cost envi- ronmental technologies. Based on the results of the two previous symposia,more than 250 technical platforms and more than 100 poster presentations are expected, with participants from more than 50 countries representing government agencies,industry,academia and re- search institutions throughout the world. Clyde Frank,deputy assistant sec- retary for the Office of Science and Technology (EM),will make the key- note presentation. The symposium is sponsored by DOE,EPA,Florida State University, the Technical University of Budapest, the Regional Environmental Center for Central and Eastern Europe,and others. John Moerlins,904-644-5524;fax 904- 574-6704;warsaw96@miailer.fsu.edu; ICEECER/FSU,2035 E.Paul Dirac Drive,Suite 226 HMB,Tallahassee,FL 32310-3700. August 18-23 Spectrum 96,Seattle,Wash.Bien- nial meeting on nuclear and hazardous waste management,designed to promote regional,national and international under- standing of DOE's cleanup needs and business opportunities.500+papers. Sponsors:DOE,Am.Nuclear Soc.,others. chttp://www.hanford.gov/ans/ s9Ghome.html) September 16-18 NESEA Sustainable Transportation and S/EV96 Symposium,Madison Square Garden,New York City.Sponsors:DOE, New York Power Authority,NY City Dept. of Env.Prot.,others.Premier electric ve- hicle symposium and trade show on the East Coast.Showcase for market-ready cars,trucks and buses.Major car compa- nies are tooling up for the first marketing of electric vehicles since the turn of the century.(NESEA,50 Miles Street, Greenfield,MA 01301;413-774-6051;fax 413-774-6053) 15-19 Partnerships to Develop and Apply Biomass Technologies:Bioenergy '96, Nashville,Tenn.Designed to facilitate the exchange of information on commercial applications,feasibility studies,demon- strations and pilot plants.Sponsor:DOE. (Phil Badger,205-386-2925) April 1997 1-3 1997 Software Quality Forum,Albu- querque,N.M.Deadline for submitting abstracts is Oct.1.Sponsored by the Software Quality Assurance Subcommittee of DOE's Quality Managers,the Quality Managers of the Nuclear Weapons Com- plex,and the Albuquerque Office's Weap- ons Quality Div.Explores progress made in software over the past 50 years-both the lifespan of computer software and the Nuclear Weapons Complex.(Wayne Jones,301-903-4655) UNSUNG eroes peas Stone Heroism in action A Pantex Plant employee has been awarded the Texas Department of Public Safety's highest honor,the Director's Award,and has been nomi- nated for a national Carnegie Hero Fund award for her heroism. Tammy Stone is a hazardous-waste management technician with Gardner- Zemke,a subcontractor at Pantex.She was heading to Amarillo last January with her three sons when she wit- nessed a pickup and a car collide ahead of her.The pickup shot into the air and landed upright on railroad tracks running beside the highway. A train was speeding down the tracks.Stone immediately pulled her car off the road and ran to the pickup. She and another driver couldn't get the unconscious driver out-his grip was frozen on the steering wheel. With the train screaming even closer, Stone yanked,pulled and twisted the driver's hands until they were free, then the two dragged him away. They were 10 steps from the tracks when the train plowed into the pickup.She began working on the victim.He had a good pulse and was breathing,but remained unconscious. Within 10 minutes both the high- way patrol and an ambulance arrived. That's when Stone saw the mangled remains of the pickup she had just been in,clinging to the front of the train's engine.* August 1996 17 ducation NOTES From 111 applicants,27 freshmen and sophomores from colleges and universities throughout the nation were chosen for Argonne National Laboratory's Student Interdisciplinary Research Training (SIRT)Program, which gives minorities the opportunity to learn about the lab and receive re- search training.The 10-week residen- tial program provides hands-on train- ing in biotechnology,cell culture, computer science,and engineering. "The SIRT Program has received a great deal of praise,and we expect it will have a major impact on the re- cruitment and retention of minorities in Argonne programs and help strengthen their plans to select science or engineering careers,”Tolbert said. Above,Lecturer German Nunez of Florida International University,in- structs students in the computer tech- nology/engineering laboratory. Me” The County of Los Alamos re- ceived a grant from the Sister Cit- ies program for an exchange be- tween high school students from the Los Alamos National Labora- tory area and the still-closed Rus- sian city of Sarov,also known as Arzamas-16,one of two Russian nuclear-weapons-design laborato- ries. The students are working on a common project on the rivers that run through their native cities. The six 16-year-old Russian stu- dents and their teacher visited Los Alamos for three weeks in June, and five Los Alamos high-school and middle-school students flew to Sarov for three weeks in July. Even after the fall of the USSR, Sarov was a totally closed city until three years ago,when Los Alamos Director Sig Hecker and others on his weapons stewardship staff made a historic first visit. Last year was a first-ever ex- change of community leaders,and this year a first-ever exchange be- tween the students. %"ye Sandia National Laboratories is partnering with Southwest uni- versities to develop the first under- graduate curriculum in the country in security engineering. The Southwest Surety Institute's curriculum will combine elements from different disciplines,such as safety,engineering and criminal justice,to produce individuals who will be able to design security sys- tems to address issues of work- place violence,terrorism and theft. 1% The Grand Junction Projects Office's donation of 10 computers and a printer (above)will allow Clifton Elementary School to open a new computer laboratory for its stu- dents."We're going to double the time the students will have with the ma- chines,”said Principal David Fricke. Clifton was one of 15 schools on Colorado's Western Slope that re- ceived 140 excess computers and 59 printers.Grand Junction also gave 10 computers and seven printers to a school in Monticello,Utah,where re- mediation work continues at sites con- taminated with radioactive mill tailings. oO- Machining equipment once used in parts production at Rocky Flats has been donated to the Rocky Mountain Manufacturing Academy at the former Lowry Air Force Base.The equipment is valued at more than $5 million,and will be available to students by next January.By being made available to 11 colleges and universities,the equipment will be instrumental in im- proving the manufacturing capability of a 10-county area in Colorado.¢ last five years. 2000. Oakland Operations Manager James Turner visited Leland High School of San Jose,Calif.,to bestow the winner's plaque for this year's Math Challenge.Leland and Oakland High School tied as this year's winners,but Leland has won or "placed”in this competition for the From left are Shirley Ni,Leland High School team member,Turner and Principal Robert Perez.The annual math challenge is cosponsored by the Oakland Office and Lawrence Livermore National Laboratory,in line with DOE's national educational goal of making U.S.stu- dents first in the world in math and science by the year 16 DOE This Month Cover Story:West Valley Demonstration Project DOF's second vitrification plant goes on line On June 24,the West Valley Dem- onstration Project team began the transfer of liquid high-level radioactive waste to a specially designed glass- making facility for solidification into a durable,solid glass. The first canister of glass was com- pleted on July 5. Startup of the plant is the culmina- tion of 14 years of design,construc- tion and testing by DOE and the New York State Energy Research and Devel- opment Authority. More than 600,000 gallons of liquid radioactive waste-a byproduct of commercial nuclear fuel reprocess- ing-will be "vitrified”into stable,du- rable glass stored in 300 stainless-steel canisters over the next 2-1/2 years. Glass is an ideal form for long-term management of this highly radioactive material. The canisters will be stored in a shielded cell in the site's original re- processing plant,ready for disposal in a geologic repository.Each canister measures 10 feet high by 2 feet in di- ameter,and weighs nearly 5,000 pounds. The start of processing at the WVDP follows DOE's successful start- up of the Defense Waste Processing Facility in South Carolina in March. "We think the combination of the two facilities puts the U.S.into the fore- front of technology in this area,and it marks the beginning of the end of the high-level waste problem in the United States,”said Energy Under Sec- retary Thomas Grumbly. Grumbly complimented WVDP em- ployees for the successful start-up, which reflected many years of suc- cessful performance.West Valley Nuclear Services Co.,Inc.,subsidiary of Westinghouse Electric Corporation, is the managing and operating con- tractor for the WVDP.Westinghouse also manages the Savannah River Site. "The department is extremely proud of this achievement,”said Sec- retary O'Leary."In a single year,the Clinton administration has turned the corner on stabilizing some of the country's most dangerous radioactive waste.” Startup of operations followed ex- tensive safety reviews by independent teams of nuclear experts,DOE and NYSERDA. DOE intends to clean up and close the facilities used by the West Valley Demonstration Project once the solidi- fication is completed. The WVDP is the site of the only commercial nuclear-fuel reprocessing facility to have operated in the U.S. The plant,owned by New York State, stopped operating in 1972.¢ Hanford helping employees find success during changeAneffortto"Help Employees Land on Their Feet”during change at Han- ford has earned kudos for Westing- house Hanford Company's Human Re- sources staff. "I applaud all that you've done to make a difficult time easier on people,”said Bob DeGrasse,director of the Office of Worker and Commu- nity Transition for DOE Headquarters. DeGrasse spoke at a June 27 recog- nition event for the HR team which put together the program.The pro- gram includes an ongoing series of ar- ticles in the site newspaper,the Han- jford Reach,and a wealth of resources on the Westinghouse Hanford Company Human Resources Home Page,includ- ing information on career planning, transition,finances,mental and physical health,and self-evaluation-all of it geared toward helping people find the answers they need to be successful. "This is an important effort,”said Richland Operations Manager John Wag- oner."It's important to the employees, and it's important to the community which has a stake in the changes we're going through at Hanford.” "Helping Employees Land on Their Feet”is a unique program in the com- plex,but Hanford isn't the only site going through dramatic downsizing. So far,contractor employment across the DOE complex has been reduced From left Peter Diaz and Jay Fernandez ofWestinghouse Human Resources demonstrate the home page to Bob DeGrasse of DOE Headquarters.Looking on are Faye Powers,also of Human Resources,Percy McCraney of DOE Headquarters,and Larry Myers,director of Human Resources. by more than 30,000 over two years. Any future layoffs will be to accom- plish specific objectives,DeGrasse said."We'll be in a position soon to reach a level of stability.” August 1996 RAPid response provided to radium plotormembersoftheRadiological Assistance Program team at DOE's Brookhaven National Laboratory,calls to the 24-hour hotline are usually routine.But the call that came in on June 13 at 1:03 a.m.pulled the group into an ongoing criminal in- vestigation that captured headlines across the country. RAP assists federal,state and local governments in handling incidents in- volving radioactive materials.Brook- haven is the headquarters of the RAP team for 11 northeastern and mid-Atlan- tic states,plus the District of Columbia. After receiving the call,team mem- bers surveyed private residences in the Bellport,Medford and Manorville, N.Y.,homes of Long Island men ar- rested by Suffolk County Police and charged with conspiracy,criminal pos- session of a weapon and illegal pos- session of explosive devices.Accord- ing to the Suffolk County District Attorney's Office,two of the men were conspiring to assassinate political and public officials with radioactive materials. The RAP team found an assortment of radioactive material at the Bellport and Medford homes.The highest ra- Gore honors two Three teams are the latest Hammer Award recipients for DOE.Vice Presi- dent Al Gore grants the Hammer Award to people who have partici- pated in a team effort that has contrib- uted dramatically to improving the way government works.It recognizes special achievements in at least one of four main themes of reinventing gov- ernment:improving customer service, cutting red tape,empowering employ- ees and getting back to basics. The 60-person Life Cycle Asset Management Process Improvement Team (Associate Deputy Secretary for Field Management)took 13 burden- some and prescriptive directives of more than 1,200 pages and replaced them with one directive of 15 pages. The team projects a savings of $51 million annually when fully imple- mented. The Directives Reengineering Brookhaven's RAP team found radioactive materials at the homes of suspected conspirators.Team members include (from left)Alan Keuhner,Henry Kahnhauser, Mona Rowe,Michael Holland,Steven Centore and Jerald Bond. diation readings were from radium- 226,which was contained in lead shields.At both houses,the team found no contamination-good news for neighbors in the areas.Team mem- bers also provided technical support Group (Office of Scientific and Tech- nical Information)led department- wide government and contractor stakeholders in streamlining require- ments related to scientific and techni- cal information,improving the $250 million annual process to ensure that all customer segments have timely and cost-effective access to the informa- tion.Expected savings are $1.5 million annually and additional longer-term department-wide savings of $10 mil- lion through FY 1999. The Performance Agreement Team (Office of Policy)developed the Secretary's first Performance Agree- ment with the President for FY 1995 and a system to track the status of all action items.Rather than reporting the status of commitments by printing 100- page quarterly reports,status is shared via a user-friendly computer system named SOLOMON.SOLOMON was to the DA's office during the initial in- vestigation. Radium was once used in luminous watches,clocks and instrument dials. Later uses included medical treatment for cancer and instrument calibration.* employees on interagency teams the product of direct hands-on user design rather than traditional,red- tape-bound software development. The tracking system is government- owned software and can be custom- ized to any agency's performance agreement. In addition to the DOE team awards,Robin Spradlen of Oak Ridge's Y-12 Site and Richard Hopf, deputy assistant secretary for Pro- curement and Assistance Manage- ment,each participated on inter- agency teams which received Hammer Awards. Spradlen worked with the National Institutes of Standards and Technology on the Interagency Calibration Team. Hopf headed the Performance Mea- surement Action Team which adapted a new performance-assessment ap- proach based on best commercial practice.* DOE This Month posium June 17-20. Tribal leaders inspect a transuranic package transporter during a tour of WIPP.DOE will use the transporter to ship transuranic waste from more than 20 temporary storage sites. Tribes give input on WIPP Representatives of more than 360 Tribes from 12 states and the District of Columbia participated in the Carlsbad Area Office's National Tribal Sym- DOE hosted the symposium to receive input from tribal leaders whose lands may be along transportation routes designated for shipments of defense- generated transuranic radioactive waste that will be permanently disposed of at the Waste Isolation Pilot Plant.The symposium fulfilled a congressional and presidential mandate that requires DOE to seek tribal involvement in planning for shipments of waste to WIPP.Tribal leaders visited WIPP to see first-hand how DOE plans to permanently dispose of transuranic waste. Topics covered included radiological response,technology transfer, emergency-response training,the WIPP transportation system and how it works,WIPP raptor research and land management,DOE-tribal cooperative agreements,and tribal authority and jurisdiction on interstate highways. The symposium also gave Tribes a mechanism to participate in the devel- opment of WIPP's second Supplemental Environmental Impact Statement. Public hearings on the draft EIS are scheduled for late summer and early fall. DOE is working to get WIPP permitted through the New Mexico Environ- ment Department and the EPA.When DOE meets all applicable regulatory re- quirements,the Secretary of Energy will decide in October 1997 whether to operate WIPP as the nation's first underground nuclear-waste repository. Oak Ridge lauded for family policies Oak Ridge Operations has received national recognition for its family-cen- tered work programs. In a national competition among all federal agencies,Oak Ridge was se- lected by the Office of Personnel Man- agement as a finalist in the 1996 Director's Awards for Outstanding Work and Family Programs."We are extremely proud of this award,”said Oak Ridge Manager James Hall."Family-friendly policies make good sense for our em- ployees and good sense for DOE.” Nominations for the Director's Award are based on effective use of flexible work schedules,including al- ternate work schedules,use of credit hours,selective "telecommuting,” leave-share programs,and part-time and job-share opportunities.Oak Ridge was the only DOE organization honored in the competition.* NEW ON THE nternet Information Management Commodities on-line The Chief Information Officer an- nounces the DOE-Wide Information Management Acquisition Program Home Page.DIMAP offers easy access to thou- sands of computer hardware and soft- ware products DOE-wide,including the DOE contractor community,and at prices below GSA schedule.Visit DIMAP today at http://www.hr.doe.gov/ dimap/.(Bobbi Ryan,301-903-0263) Getting financial assistance The Office of Procurement and Assis- tance Management now has a home page at http://www.pr.doe.gov/ fahome.html to assist DOE program and awarding office staff involved with the solicitation,award and administra- tion of financial assistance (grant and cooperative agreement)instruments.The home page has copies of the regulations (10 CFR 600),the DOE Guide to Finan- cial Assistance,financial assistance let- ters and other references,Office of Man- agement and Budget circulars,and links to search engines for the Federal Regis- ter,Catalog of Federal Domestic Assis- tance,U.S.Code,and the home pages of DOE program offices and other federal agencies involved with financial assis- tance.(howard.mitchell@hq.doe.gov)* Education Fair -Learn about educational pro- grams offered by schools in the Washington,D.C.,area,particularly programs geared to help federal employees who may be affected by employment transitions.Visit each booth for information and to speak to school representatives.More than 30 schools will take part. Workshops will be given on con- ducting an effective job search, resumé writing and college prepara- tion for adults (no sign-up needed.) e Aug.13,10 a.m.-3:30 p.m., Forrestal Bldg.,IE-245,Lower Lobby *Aug.15,10 a.m.-3:30 p.m., Germantown Bldg.,Auditorium Coordinated by DOE Headquarters Career Management Resource Center 202-586-2452 August 1996 15 esearch DIGEST Breakthroughs by Lawrence Livermore National Laboratory re- searchers may open the door for U.S.manufacturers to produce computer chips in a new way using a futuristic technology-extreme ultra- violet light. "By using extreme ultraviolet light, with a wavelength 20 times shorter than the current state of the art,manu- facturers should be able to produce computer chips 10 times faster and with 1,000 times more memory than today's chips,”said Nat Ceglio,head of Livermore's Advanced Microtechnology Program.The break- throughs were achieved under re- search agreements among eight U.S. microelectronics firms and three na- tional labs-Lawrence Livermore, Sandia and Lawrence Berkeley. (Stephen Wampler,510-423-3107) Sandia National Laboratories scien- tists who predict the behavior of basic materials are joining forces in a research forum to share experiences and expertise in atomic-scale simula- tions.The Atomic-Scale Simulations Forum spans both sectors of the labs' business-National Security and En- ergy and Environment-in both the Albuquerque and Livermore sites and throughout Sandia's four research divi- sions.The forum has about 50 mem- bers who are looking forward to the arrival of the next-generation supercomputer due next winter under the DOE Defense Program's Acceler- ated Strategic Computing Initiative. (Nancy Garcia,510-294-2932) Scientists at Ames Laboratory have applied for a patent for a "glue”suit- able for joining parts made of a promising new class of ceramic materials called CFCCs.The ceramic equivalent of fiberglass,CFCCs consist of silicon carbide fibers embedded in a silicon carbide matrix.They can sur- vive conditions too hot or corrosive for even stainless steel or aerospace "superalloys.”The Ames glue elimi- nates the need for high-temperature curing to develop useful strength, samples.(Frank Juan,423-576-0885) e'Squash'still state-of-the-art An instrument developed three decades ago at Oak Ridge National Laboratory is still state-of-the-art today,providing valuable data that can help answer questions about the thermal conductivity of a number of mate- rials.The "squash machine”helped researchers perform calculations needed to demonstrate that radioisotope satellite power supplies could safely reenter the atmosphere.Researchers also used the squash machine to measure the thermal conductivity of irradiated pressure vessel steel samples from the High Flux Isotope Reactor,which was the subject of embrittlement studies.Their data helped alleviate concern about the reactor's safety. The machine continues to provide data on amorphous silicon films, waste glass,zinc oxide varistors and other materials to researchers.The original version of the "squash machine”was developed in 1964 by Peyton Moore.An advanced design was put into service in 1971.The data books shown with the squash machine contain results on more than 350 research New Oversight Office turns corner on safety n early 1995,the Office of Over- sight was established as an inde- pendent entity within the reengineered Office of Environment, Safety and Health. At the time,no one in DOE-head- quarters or field-quite knew what to make of this new organization.It was clear there would be no more "Tiger Team”audits.There would be no more wasteful,overlapping teams of in- spectors that would descend ona field site,producing only bad press,long lists of noncompliances with confusing or ders,and no benefits for DOE. In its place is a revolutionary ap- proach to oversight at DOE.This over- sight is totally independent from line management,yet seeks to provide managers with quality information that not only improves safety at DOE,but makes them better managers. There are now multidisciplinary as- sessments,and no surprises before the results of assessments are released. Oversight is analytic,so that assess- ments are fair and not based on a single inspector's judgment.The goal is to pro- vide focused,disciplined analyses that hold managers accountable for safety in a way that is fair and effective. Needless to say,there has been a fair amount of skepticism-and re- lief-from DOE managers.Today,after hundreds of meetings with DOE line managers,program managers,the De- fense Board,field offices and Con- gress,DOE and its stakeholders are starting to see the positive results they had been looking for.Managers are: e reallocating resources to address safety needs by,for instance,reducing critical maintenance backlogs. e bringing safety systems into com- pliance with their design criteria. ¢providing increased attention to safety needs while setting budget priorities. e focusing more attention on subcon- tractor safety programs. e modifying their approach to ensur- ing safety as DOE moves toward privatized activities. Additional benefits: e new and safer ways for hoisting, rigging,and crane operations. e improved radiological control pro- grams,resulting in decreased worker and environmental contamination. *increased initiative among line managers to correct safety deficiencies he goal is to provide focused,disciplined analyses that hold managers accountable for safety in a way that is fair and effective. and to put in place processes that pre- vent future deficiencies. The changes aren't limited to correct- ing "noncompliances”at specific facili- ties.They involve systemic and pro- grammatic improvements that make safety considerations paramount in facility op- erations today and in years to come. A key success factor is the "Safety Man- agement Template,”made up of three principles,each with specific criteria. The criteria lay out management's re- sponsibilities for safety.They also pro- vide a framework for evaluating the ef- fectiveness of safety program manage- ment,and are largely responsible for the credibility with which oversight reports have been received.The criteria are: ¢line managers are responsible and accountable for safety and security management. ¢comprehensive requirements for safety and security management exist, are appropriate to the need,and are executed by line managers. e the competence of each person is commensurate with assigned responsi- bilities. Despite these successes,safety is still a major issue.Oversight investiga- tions show that DOE has been ex- tremely lucky in "dodging the bullet” of what could easily become cata- strophic accidents.Despite reasonable efforts,DOE continues to see a spate of accidents,such as the recent elec- trocution of a 24-year-old student at Los Alamos,an accident that could have easily been prevented with proper safety planning. The Office of Oversight has com- pleted 12 comprehensive inspections, eight reviews,four special studies,and more than 300 site surveillances at facilities throughout the DOE complex.The office is also responsible for accident investi- gations. For more information,call the Of- fice of Oversight at 301-903-3777.The reports are available at the Oversight homepage:bttp://tis.eb.doe.gov/web/ eb2/.% which is a crucial requirement of other joining methods.The glue is being tested in collaboration with three ma- jor CFCC manufacturing companies. (Diana Lutz,515-294-5661) Too much soap in an automated carwash or heaps of foam in a factory chemical line can be messy and ex- pensive.But researchers at Los Alamos National Laboratory have developed a sensor that continuously moni- tors detergent or surfactant levels for both industrial and residential uses. The formation of foam in a small tank interrupts a light beam and shows de- tergents are present.The monitor can be incorporated into other systems to automate the addition of detergents to a washing machine or parcel out anti- foaming agents into an industrial stream. (Gary Kliewer,505-665-2085) Former Pacific Dr.William (BilD R.Wiley, a former Pa- cific North- west National Laboratory di- rector de- scribed by col- leagues as a visionary and the driving force behind the establishment of the Environmental Molecular Sci- laboratory director Bill Wiley dies ences Laboratory,died at his home in Richland,Wash.,June 30,following a brief illness.Wiley was 64. "His passing will be felt in the local area,the Northwest and in the interna- tional scientific community for a long time to come,”said John Wagoner, manager of the Richland Operations Office."We are within months of com- pleting the EMSL.When world-class sci- entists arrive to work at the facility,we truly will begin to appreciate the legacy he left us.” Wiley,Battelle Memorial Insti- tute's senior vice president for Sci- ence and Technology Policy at the time of his death,served as director of the laboratory from 1984 to 1994. "As a result of his vision and foresight,Battelle and Pacific North- west began to attain national and international recognition for leader- ship in molecular science,environ- mental science and technology and global climate change,”said Battelle President Douglas Olesen. lt DOE This Month August 1996 DOE at the Atlanta Games: Energy technologies make>Olympic splashl\orld-class swimmers,diversandwaterpoloplayers aren't the only ones making a big splash at the 1996 Summer Olympic Games this month in Atlanta. The Olympic Aquatic Center features the world's largest solar rooftop en- ergy installation to generate electricity and control water temperature. The pool's solar energy system is one of several innovative technologies that the DOE and its commercial/gov- ernmental Team Energy partners are demonstrating during the Olympic Games. "Atlanta will be a showcase for America's best,whether it's Olympic athletes or world-class technologies,” said Secretary Hazel O'Leary."The Clinton administration's work with American manufacturers to support these innovations and promote a clean environment will score big wins for future generations. "What's more,the enormous inter- national market potential for these cost-shared technologies will give the United States a leg up on the competi- tion and create high-wage,high-tech jobs for American workers.” Team Energy's flagship project is the Aquatic Center,or natatorium,at the Georgia Institute of Technology campus in downtown Atlanta.This Because there aren't enough _liquid natural gas outlets"enroute,four Idaho National Engineering Laboratory buses were lodded onto flatbed trucks for delivery to the Games. project features a $5 million installa- tion of 2,856 photovoltaic panels that cover 40,000 square feet of space on the pool's roof,making it the largest photovoltaic building in the world. Another example of renewable en- ergy is the natatorium's solar thermal water-conditioning system.It uses 250 solar collectors on the roof to eco- nomically heat or cool the pool water. (The temperature range for interna- Modules integra tedInto the architec energy ffoey175homes. :mates23eae of the natatorium can converttt gun's.energy'into 340 kilowatts of electrical power,enough Fs isFate8: ,Feesig tional competition is narrow,and can- not exceed 78°F.) A diverse array of other energy-effi- cient and renewable energy technolo- gies in use at various Olympic facilities around metropolitan Atlanta are now,or soon will be,commercially available. They provide excellent examples of how easily new technology can be in- corporated into a community's energy plans.Among the projects: ¢Hundreds of alternative-fuel ve- hicles-loaned by transit authorities from across the U.S.-shuttle visitors throughout the Atlanta area, demonstrating the feasibility of clean, competitive alternatives to gasoline and diesel for urban transportation. Buses and support vehicles powered by compressed natural gas,liquified natural gas and electricity help keep Atlanta's air clean during this time of peak transportation demand. *130 lamps on 65 light poles powered by the sun's energy illumi- nate the parking lot serving the Na- tional Park Service's new Martin Luther King,Jr.Visitor Center in downtown Atlanta.In addition to re- ducing reliance on conventional elec- tricity sources,the new lighting is por- See OLYMPICS,page 9. DOE This Month n-line technology turns laboratories into 'collaboratories' In the near future,researchers thousands of miles apart will be able to collaborate on experiments as if they were in the same room-because of computer technology.The goal of "collaboratories”is to place large-scale unique DOE facilities on-line,providing access to instruments,data acquisition and analysis resources and to the researchers themselves. Under the Distributed,Collaboratory Experiment Environ- ments Program funded by the Office of Energy Research, four prototype remote experiment environments are being built.The first phase,begun in 1995,provided remote ex- periment-monitoring capabilities and some researcher inter- action capabilities.Many other capabilities are under devel- opment.One facility taking part is the Advanced Light Source at Lawrence Berkeley National Laboratory (at right is the facility's Beamline 7),a national user facility for qualified scientists and engineers to conduct experiments.For more, check http://www-itg.Ibl.gov/DCEEpage/ DCEE_Overivew.html.+ Morgantown Health Center cuts sick leave use The Morgantown Energy Technology Center's METCercise program has produced health benefits with a measurable im- pact on costs and productivity.The center estimates that for every dollar it invests,it gets back between $1.30 and $2. Participants use 12 hours less sick leave per year on average than employees who don't take part.An on-site rehabilita- tion program saved the agency $46,000 in avoided therapy costs and lost work time in one year.Savings from reduced absenteeism,fewer medical claims and productivity increases are estimated at $114,450. The program started in 1987 as a simple aerobics class in- structed by a DOE employee.Now it has a full-time director and a wide array of health and fitness services,including smoking cessation,fitness screening,a "healthy back school,”and weight management.About 150 of the center's 500 employees are active participants.* Savannah River Law Enforcement joins elite class of agencies Secretary Hazel O'Leary (center)congratulates the Savan- nah River Site Law Enforcement Department,operated by Wackenhut Services,Inc.,for receiving national accreditation from the Commission on Accreditation for Law Enforcement Agencies.Of 18,000 agencies in the U.S.,only 360-2 per- cent-have been awarded national accreditation. "The standards and overall philosophy for achieving ex- cellence in police operations effectively mirrors DOE con- duct of operations standards,”said General Manager Lawrence Brede."National accreditation validates our com- mitment and ability to provide 'best-in-class'law enforcement services to our customers,clients and to the community.” The accreditation process usually takes three years,but was achieved in 18 months.From left are Director of Safe- guards and Security Larry Ogletree,Brede,O'Leary,Lt.Timo- thy Nave,Security Officer Jeffrey Dumouchel and Savannah River Manager Mario Fiori.# August 1996 13 EMSL supercomputer to help solve environmental problemsOneofthemostpowerfulcomputersintheworldnow is housed in the Environmental Molecular Sciences Laboratory at Pacific Northwest National Laboratory in Richland,Wash. With the first phase of installation now complete,the IBM RS/6000 Scalable POWERparallel Systems computer is ranked 29th in the world.It could become one of the top 10 most powerful computers next March when the second part of its two-phase installation is completed. The computer,named NWMPP1,is undergoing acceptance testing.It will be used collaboratively by researchers from the national laboratory system,universities and industry to con- struct more realistic and accurate models of environmental processes important to EMSL's research mission. "It will enable researchers to perform environmental mo- lecular science essential to cleaning up the environment faster and more cost-effectively,”said Ray Bair,deputy director of EMSL's computing and information sciences.+ Hanford fuels development laboratory deactivatedHanford's Fuels Development Laboratory has been deacti- vated,meeting a milestone in the cleanup of the former de- fense site's nuclear facilities.The deactivation occurred 37 days ahead of schedule and is the first major plutonium facil- ity deactivation at Hanford completed to current DOE "end- point”criteria. Deactivation of the lab reduces the mortgage on the facil- ity from $12 million a year to an estimated $160,000 annually. It also brings to a close an era of successful breeder-reactor fuel development and production at Hanford. For deactivation,a new technique was developed to stabi- lize and seal the gloveboxes where fuel was fabricated.Spe- cially fitted metal plates were placed on the gloveports and heat-sealed with a material resembling shrink-wrap,which is used to protect welds on industrial pipes.The technique proved to be so efficient,it is now being widely used to de- activate other Hanford nuclear plants. Development Workshop to do finish work for INELAnIdahoFallsrehabilitationfacility for the severely handi- capped has won a contract to finish 3,000 drum spacers for the Idaho National Engineering Laboratory's Radioactive Waste Management Complex. Development Workshop,Inc.will provide the deburring and gluing for both 83-gallon and 55-gallon drum one-sided and two-sided spacers.The spacers provide seismic stability for transuranic waste drums and allow them to be stacked higher,conserving valuable storage space.As the two-piece spacers come out of the injection mold,the parts must be deburred,placed on a setup table,glued and clamped to- gether while the adhesive dries.The manufacturer in Atlanta will ship them to the Development Workshop for assembly. The arrangement provides an opportunity to a special seg- ment of the local economy,and shifts manufacturing control and response from Atlanta to Idaho Falls,improving service to INEL.It also eliminates packaging waste used to ship the finished product from Georgia to Idaho.+ 12 DOE This Month Students meet FutureCar challenge As the American auto industry wraps up its 100th birthday,govern- ment and industry officials are an- nouncing the first-year winners of the FutureCar Challenge-a national com- petition to engineer the cars of the near future. A team of engineering students from Virginia Tech earned the top spot in a competition that included 12 top engineering col- leges.Students were challenged to design "super” fuel-efficient cars without sacrific- ing comfort, safety,afford- ability and consumer acceptability. The teams turned in impressive performances,including test vehicles that achieved nearly 60 mpg on the highway and just under 50 mpg in city driving,a significant figure for a five- passenger family car. "These students are an important part of our overall national effort to create a new breed of American ve- hicle,”said John Gibbons,assistant to President Clinton for Science and Technology."This combination of ad- vanced technologies,industry and government cooperation and youthful enthusiasm is a powerful force.” The FutureCar Challenge is sponsored by DOE and the U.S.Council for Automo- tive Research,a joint research effort of Chrysler,Ford and General Motors. Student competitions like FutureCar Challenge are a good investment,ac- cording to Secretary Hazel O'Leary. "The payoff for the American taxpayer is an increase in job opportunities and job skills,an advantage in global competition,and the financial and strategic benefits of reducing our dan- gerous dependence on foreign oil.” "I think it's harder than the moon shot,”said Ford's Bob Mull."Once we make these dramatic improvements in technology,we still won't have suc- ceeded unless people like the end product enough to go out and buy it.” The winning vehicle from Virginia Tech scored particularly high in fuel economy (49.2 mpg city)and in emis- sions testing.It's a Chevrolet Lumina using a battery-powered electric motor combined with a propane-fueled, three-cylinder engine.+ Olympics (Continued from page 8.) table,easy to install and maintain,and requires no trenching. ¢Asolar thermal dish uses an ar- ray of mirrors focused ona Stirling en- gine to convert sunlight to electricity at efficiencies considerably higher than those of today's commercially available solar technologies;the new technology also has great potential to provide electrical power to remote vil- lages around the world as well as other "off-grid”applications. ¢The Southface Energy and Envi- ronmental Resource Center show- cases the latest in energy efficiency and renewable energy designs.Visitors may tour the center to see the state-of- the-art walls,windows,doors,lighting, appliances and heating and cooling systems.Photovoltaic roofing shingles will be integrated into the roof design, generating electricity while serving the traditional function of roofing shingles. ¢The electricity supplied by the Southface Center's roofing shingles produces hydrogen for a hydrogen- powered fuel cell vehicle,which will shuttle visitors around the Atlanta Science Museum.The center will also serve as a training site for teachers and students at all grade levels,archi- tects,design engineers and building trades construction workers. Through the international audience on-hand in Atlanta,DOE and its Team Energy partners hope to communicate a powerful message worldwide:that energy efficiency and renewable-en- ergy technologies supplied by U.S. companies can help meet the de- mands of the world's energy consum- ers while protecting the environment - and saving money. For more information on Team En- ergy:1-800-DOE-EREC (363-3732)or +,http://www.eren.doe.gov. Muhlen was one of eight Olympians from Cincinnati to carry the torch. Olympian says 'Go for the Gold' Most people know Roland Muhlen as a hard-working union electrician at Fernald.Muhlen is also a former Olympian sprint canoeist who placed sixth in the 1,000-meter race in the 1972 games.He participated again in 1976 and would have participated in 1980 if the Moscow games had not been boycotted. The Olympic Games aren't just for the elite or advantaged athlete."I want the general public to realize that a person who has an average back- ground-like me-and desire and op- portunity,can be on the Olympic team,”Muhlen said."It may be within your reach,or the reach of your kids, if you believe.” For Muhlen,canoeing was a week- end sport."I bought my first canoe at the age of 19,and began racing in lo- cal events for enjoyment.I didn't dis- cover that sprint canoeing was even in the Olympics until I was 25,and I was 29 when I participated in 1972 .” Muhlen was the national sprint ca- noeing champion from 1972 to 1981. "Being a union electrician was very helpful because my schedule was flex- ible,I had security and income,and a job to come back to in the end.”# August 1996 Nevada Test Site to purchase solar power DOE has formally signed a state- ment of intent agreeing to pay an esti- mated $1.4 million annually for up to 10 megawatts of solar power for the Nevada Test Site from the Corporation for Solar Technology and Renewable Resources,becoming the first site to receive solar power. Sen.Richard Bryan (center)joins solar corporation President Rose McKinney- "It's the right thing to do,”said Terry Vaeth,Nevada Operations Office's acting manager."We're putting actions in front of words and commit- ting to purchase the first power pro- duced by the corporation.DOE will continue to challenge other federal agencies to join us in this venture.” James and Terry Vaeth at the signing of a statement of intent making the Nevada Test Site the first to receive the corporation's solar power. The not-for-profit corporation is fa- cilitating the commercialization of so- lar and renewable energy technologies in Southern Nevada.Through a pub- lic-private partnership,it's working to bring community leaders,solar devel- opers and the public together for more expanded solar energy opportu- nities for our nation. "I could not be more pleased with DOE's commitment to purchase solar power,”said Sen.Richard Bryan (D- Nev.),who serves as the corporation's chairman."A new energy era has dawned for the Nevada Test Site.It's appropriate that this site takes the lead in both generating and using a clean, safe and environmentally benign en- ergy source.” In 1995,DOE presented the corpo- ration with a $3 million grant to study potential sites for a solar enterprise zone in Southern Nevada.The most promising sites are the test site and Eldorado Valley in Boulder City. Fifty energy managers from federal facilities around the West met in Las Vegas recently to explore the opportu- nity to purchase power from the cor- poration,which needs commitments for a minimum of 50 megawatts before asking four private businesses to con- sider building the solar enterprise zone.* IBM exec chosen to lead Argonne Lab Dean Eastman,a world-renowned expert on the electronic properties of materialsand spectroscopy,is the new director of Argonne National Labora- tory.Before his appointment,Eastman was serving as vice president of tech- nical strategy and development reengi- neering for IBM. University of Chicago President Hugo Sonnenschein made the announcement . June 27 on the recommendation of the Argonne Board of Governors.The laboratory is celebrating 50 years of scientific and technological achieve- ment as the nation's first multipurpose national laboratory.The university manages the laboratory for DOE. Eastman has played key roles in science and technology at IBM for the past 33 years.Before his last posi- tion in the IBM Server Group,he also served as IBM director of hard-° ware development reengineering at IBM's corporate headquarters and as vice president of systems technology and science at IBM's research division. "I have great confidence that Dean Eastman will continue Argonne's remarkable contributions to American technology and devel- opment,”said Secretary Hazel O'Leary."He brings great manage- ment ability in addition to his enor- mous accomplishments as a scien- tist.”Eastman succeeds Alan Schriescheim,who announced in November that-he intended to step down after 12 years as director. 10 DOE This Month Adding value to DOE's missions 'Electronic'Summit fosters climate of change An June 11,Secretary O'Leary kicked off Summit 96,the third in a series of annual conferences to foster a climate of change in which the Department of Energy has become more responsive to its customers,more mission driven, and more efficient. The previous two summits drew a few hundred participants from Head- quarters and locations throughout the energy complex.Using technology to link the Forrestal Building auditorium with Richland,Oakland,Oak Ridge, Albuquerque,Chicago,Savannah River and 17 other sites,Summit 96 involved more than a thousand participants,in- cluding a large number of managers, at less than $15 per person. Vice President Al Gore's National Performance Review newsletter,Rein- vention Express,praised Summit 96, saying it was "cutting the nation's en- ergy bill.” In her opening remarks,O'Leary stressed that employees,contractors and stakeholders should work to- gether to add value to the achieve- ment of DOEF's missions.Associate Deputy Secretary for Field Manage- ment Don Pearman provided an ar- ticulate overview of the goals of the summit working teams. Speakers included senior DOE offi- cials,industry and union leaders,and customers representing views of the Department of Defense,Congress,the Office of Management and Budget, and the university and environmental communities. Ten regional working teams met electronically after the June 11 session to consider the three goal areas.The teams presented their initial recom- mendations to O'Leary and senior staff on June 27,using interactive video links. The Secretary agreed with recom- mendations that she establish a mea- sures,evaluation and assessment steer- ing group,and provide concurrence on a pilot-project approach for the customer-supplier value chain. She also agreed with aspects of the third recommendation on role trans- formation,including reevaluating ex- isting initiatives and goals,and ap- pointing a full-time senior manager to make reengineering consistent with guiding principles. O'Leary will discuss all three rec- ommendations with her senior staff and follow up as necessary.On Sept. 26,progress reports will be presented to Secretary O'Leary and her seniorstaff.* For more information,consult DOE's Summit 96 home page,pro- vided by the Stanford Linear Accelerator Center and Lawrence Livermore National Laboratory,at hitp://www.explorer.doe.gov DOE 'lights the way'at quality conference Employees from Westinghouse Sa- vannah River Company and the DOE Office of Quality Management shared almost $1 billion worth of proven cost-saving and productivity- enhancing initiatives at the ninth an- nual Conference on Federal Quality, held June 3-6 at the Washington Hilton and Towers in Washington, D.C. Although most of the conference exhibitors concentrated on selling their products,DOE chose to offer its wealth of innovations at no cost. Surfing the Net Booth visitors surfed the Internet and learned more about the DOE Success-Thru-Sharing and Electronic Sharing Program Web Sites. They watched demonstrations of a new soluble waste technology pro- cess and visited a portable radiologi- cal containment hut. They also took home a catalog that details more than 130 "best practices”gleaned from the DOE community's sharing efforts. The exhibit also featured informa- tion on work measurement and scheduling;lessons-learned;process improvements in activity-based cost- ing;performance measures;cycle- time reduction;NEPA categorical ex- clusions;and reengineering. Although there was lots of "give” at the booth,the DOE exhibitors also engaged in a little "take”as well. Persistent questioning of other exhibitors yielded many excellent ideas perfected by other organiza- tions.Some of these included: *The Tennessee Valley Authority's economic development plan that has resulted in $16 billion in invest- ment and 160,000 new jobs in three states. *A fully-automated 360-degree per- formance feedback process that en- ables organizations to align em- ployee and team behavior and busi- ness strategy while avoiding the pro- duction of thousands of documents. *An accredited,presidential-award- winning Army Management Engi- neering College which may provide an excellent alternative to in-house development of certain advanced . training. *An Air Force contract reconcilia- tion and auditing system that has saved more than $25 million. All these "best practices”are available to the DOE community via the Electronic Sharing Program at http://www.srs.gov/cgi-bin/esp- interface.pl,and will soon be posted as Success Stories on the Suc- cess-Thru-Sharing (StS)Web Site: http://www.explorer.doe.gov. ESP is also indexed and acces- sible through StS Web Site. DOE was one of more than 35 federal and contractor organizations that participated. To find out more,contact Bob Campbell,202-586-4416,bob.campbell@hq.doe.gov.* August 1996 11 Denver Peciona!Supsor:Offics Office of Energy Efficiency and Renewable Energy U.S.Department of Energy August 22,1996 All Prospective Applicants SUBJECT:AMENDMENT NO.002 TO SOLICITATION NO.DE-PS48-96R810587 -COMMERCIALIZATION VENTURES PROGRAM This Amendment 002 to the Commercialization Ventures Program: ce)Incorporates answers to questions that have been raised since Amendment 001 was issued, through the closing date for questions (August 15,1996).Questions in Amendment 001 ended with question 17.Amendment 002 questions begin with 18.(Enclosure 3) On page 6 of the solicitation,in the last paragraph under the section TIMEANDPLACE FOR SUBMISSION FOR APPLICATIONS,the second sentence that reads "Only those responding to this request will receive amendments,if any,to this solicitation",is hereby deleted. Enclosure 1,Parameters of Return on Investment Calculations,is revised as follows:in item 2 the heading should read "Discount Rate,"not "Price of Electricity Sold." Enclosure 7,Revised Page 20 of the Solicitation,has been revised to show a new Enclosure 8. A new Enclosure 8,Excerpts from 10 CFR 600,regarding cost sharing and program income,is added.Because several questions concerned cost-sharing and program income requirements,we are including an excerpt from DOE's Financial Assistance Rules that may help in application preparation. §/27Allotheritemsinthesolicitationremainunchanged.Can -/ Enclosures:As stated Sincerely,Ded an We Wwt™.dt ail Marg yan .--- Contracting Officer wisv (y Cle 1617 Cole Boulevard Golden,Colorado 80401 Phone:303/275-4800 Fax:303/275-4830 ENCLOSURE 1 (Amended 15 August 1996) Parameters of Return on Investment Calculations NOTE:Paragraph 2,"Price of Electricity Sold,"has been re-titled "Discount Rate." Some standards of uniform economic analysis must be observed by CVP applicants,therefore, certain numerical parameters of return-on-investment calculations are set in advance. 1.Inflation Carry out all calculations in terms of "real"constant dollars,not "current”dollars. 2.Discount Rate Use the figure 12%.This is a reasonable amalgam of the opportunity cost of money as seen by small entrepreneurs,large stable cooperations,and utilities.It is a number which is not considered extreme by financial analysts.With inflation around 3%,this corresponds to 15%nominal rate,which is about right for a highly-probable technology venture amid business risk. 3.Duration Usea life-cycle of 20 years,maximum.Note that with a discount rate of 15%,a dollar is worth about 6%after 20 years.The front-end cost estimates are never accurate to within 6%anyway, so there is no accuracy to be gained by carrying the predictions beyond 20 years. 4,Displaced Cost of Electricity Use 5¢/kwh.There are wide swings in the value of electric power,including day/night variations. Retail electricity is 12¢/kwh in the summertime in some communities;Grand Coulee Dam electricity at night in the springtime is worth barely 1¢/kwh;and solar photovoltaic is intended to sell into the "peak"market.Therefore,a single standard number must be used for uniformity of calculations. It may be that a particular company feels that the commercial viability of its device is linked intimately to a particular cost structure for electricity.If so,the calculation of that advantage should be carried out separately,in addition to this standardized calculation. 5.Sale of Power Assume that whatever power is generated will be sold into a uniform national market.(This is to avoid penalizing projects from certain regions,such as that of Bonneville Power Administration.) This presumes the capability of wheeling,and eliminates regional price variations.Again,the intent of this requirement is to facilitate ease-of-comparison among projects. 6.Escalation Rates The U.S.Department of Energy has a set of stendard predictions for escalation of energy costs, which appear in "Annual Energy Outlook 1996 with Projections to 2015",DOE/EIA -0383 (96), January 1996.These are close to a no-real-growth scenario:electricity price decreases at 0.1% per year;oil increases 1.0%per year;natural gas increases 0.3%per year;and coal decreases 0.4%per year.Again for ease of comparisons,either these numbers or simply "no growth" should be used in calculations. 7.Capital Input Stream Generally,construction and installation should be taken as a one-year expense at the start of a project.For projects where it is necessary to incur construction and start-up costs for several years,that condition must be clearly identified and explained. 8.Leveraging Under no circumstances should "financing"considerations be mixed in with economic analysis. State-issued bonds,leveraging,borrowed money and related financing issues are interesting,but have no place in economic analysis.A project must be viable based on economic merit;only then is financing used to achieve acceptable cash flows. In particular,where a state is contemplating issuing bonds to support a technological idea,that financial input may be construed as contributing to the state's own participation;but it cannot be used to change the appearance of the economic analysis of the project. ENCLOSURE 3 Questions and Answers:July 19-August 15,1996: Commercialization Ventures Solicitation No.DE-PS48-96R810587 Note:The answers to question are based on the background information provided,if any.Final determination will be made based on a review of the information contained in the application and any clarifying answers to question made by DOE during negotiations. 18.Question:Is municipal solid waste considered biomass under this solicitation? Answer:No,but it is considered a renewable feedstock and is eligible. 19.Question:Is the Cotton Waste Utilization program consistent with the objectives of the Renewable Energy Grant awards program to assist renewable energy technologies? Answer:The two programs have compatible goals,but federal funds received by the grantee under the Cotton Waste Utilization program cannot be used as non-federal cost share. 20.Question:Could you provide the name/telephone number for state government energy offices? Answer:State energy offices are listed by state and organization in Amendment 001. In addition,you can contact the state government to see if there is an energy office (or another state office with responsibility for energy matters),and proceed from there.: 21.Question:Is there a bias toward large companies vs.small companies in the evaluation process? Answer:No;all companies will be treated equally. 22.Question:Is the reference to applicant's efforts to obtain additional debt or equity financingfor the proposed project meant to be the State Energy Office,the private partner,or both? Answer:It can be either or both. 23.Question:Is a non-profit or governmental organization eligible for funding as the owner of the energy facility that may be operated under a joint venture agreement with a private firm? 24. 25. 26. 27. 28. 29. Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer. Question: Answer: Question: Yes,a non-profit or governmental organization would be eligible to participate as a sub-awardee in the program if there is a private,for-profit, partner.That partner would have to be specified in the proposal,and the agreement be in place at the time of submission of the proposal. Do some of the funds expended for technology development and initial commercialization activities during the last two years count as part of the match requirements under the CVP? It depends on the type of cost.Generally,funds previously expended cannot be used as a cost share.See also,Amendment 001,question 10, and Enclosure 8 to this amendment,which describes cost-sharing requirements. Assuming they are not accounted against the page limits,how many letters of support may be added to a proposal packet? Letters of support are not counted against the page limits,but proposers are requested to keep the number of such letters to a reasonable number. Can hydroelectric be added to the list of renewable energy technologies on page 4 of the solicitation? Yes.The list on page 4 of the solicitation provided examples and was not intended to limit eligible renewable energy technologies.(See Amendment 001,question 11) Would a product to be purchased and evaluated using improved facilities and tooling that are used to manufacture that product be eligible under the scope of the program? Yes,provided the product utilizes a renewable energy source. Can Independent Research &Development be allowed to fund a company's contribution to this program? Yes,provided the cost is allowable under the applicable cost principles and meets DOE financial assistance cost-sharing standards.(see Enclosure 8) Can a portion of the funds be used for promotional purposes in the way of making demos available to a network of national dealers in the US ona reduced cost (subsidized)basis (one per dealer)? 30. 31. 32. 33. 34. 35. Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer: Yes,if they are determined to be allowable,reasonable,and allocable under the applicable cost principles (i.e.,48 CFR 31.2 -Contract Cost Principles) A substantial part of the grant application involves providing a Business Plan,Budget,and Financial Information.Is this requirement to be addressed from the perspective of the sponsoring company or from the technology? The proposal should be written to address the entire project proposed to commercialize a specific technology product or process.Except where explicitly requested,information that does not specifically pertain to the project will not be considered by evaluators. Would the testing of a prototype 4.5 litre John Deere engine,to run on CNG and produce 160 horse power for utilization in school buses,be a viable project for the CVP? No,since the fuel source does not qualify as renewable. Are technologies for the recovery and utilization of landfill gas qualified in the FY 94 solicitation as renewable energy technologies valid for the FY 96 solicitation? Yes. Does the Hot Water Demand Pumping System and Flue Gas Baffle and a Vent Damper qualify as a renewable energy technology for this program? No.The source of Congressional appropriations for the solicitation limits the eligible technologies to renewable energy and precludes energy efficient technologies. Can the US DOE/DoD incentive for fuel cells be combined with CV funding as long as it stays under the maximum 50%match from Federal Sources? Yes. With regard to commercial partners,and the requirement for no profit:is it correct to assume that it is legitimate for the company to cover expenses? Yes,if the costs are determined to be allowable,reasonable,and allocable under the applicable cost principles. 36. 37. 38. 39. 40. 41. 42. Question: Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer: Question: How many RFP inquiries have been received and what is the projected number of proposals expected? DOE has received over 400 requests for the solicitation.DOE is unable to predict the number of proposals that will be submitted. Is it possible to file an application through the Department of Conservation and Natural Resources since the Penn Energy Office was disbanded? Yes,provided the entity meets the eligibility requirements outlined in the solicitation and Amendment 001. Who has requested the CVP solicitation? See Amendment 001 to the solicitation for a list of other entities who have expressed an interest in the program. What is the period of performance? The period of performance is up to five years.(see page 7 of the solicitation) If a company wished to build an energy plant costing $10 million ($2 million equity/$8 million loan),can the funds requested from the CV program be used for the $2 million equity? Yes.However,DOE will not assume any liability with regard to the loans (i.e.,if the Federal support ends).The loans are strictly the responsibility of the recipient,nor will DOE accept an equity position in the venture. Ifa company wished to build an energy plant costing $10 million ($2 million equity/$8 million loan),would the $8 million loan serve as the 50% or more cost sharing requirement? Provided the contributions meet the regulatory cost-sharing standards (see Enclosure 7),cost-sharing may be derived from cash contributed to the grantee or the venture by non-federal public or private organizations and individuals.In addition,such cash contributions used as cost share must be allowable under applicable cost sharing requirements (i.e.,prohibitions against interest on debt). If a company wished to build an energy plant costing $10 million ($2 million equity/$8 million loan),would the loan have to be approved by the 43. 45. 46. 47. 48. Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer: Question: time of the proposal submission? Section 6.c (p.14)of the solicitation states the proposers should "provide evidence of firm funding commitments.”(See answers to question #91.) Maya federally-recognized Indian tribe be an eligible applicant and apply directly to the DOE for funding,or must such tribe apply through the applicable state energy office? A federally recognized tribe would not be an eligible applicant,but could team with an eligible applicant. The CVP requires a 50%match.Can this match be provided through a commercial loan,or some type of third party financing? Yes.(See also answer for question #40.) Is an extremely efficient residential boiler eligible? No.The source of Congressional appropriations for the solicitation limits the eligible technologies to renewable energy and precludes energy efficient technologies. Would a fuel cell power plant qualify for consideration as a project for funding under the CVP? A fuel cell power plant would be an eligible application provided that the intended fuel cell feed gas is derived from a renewable resource. Does DOE have a schedule for proposal evaluation and award date? Yes.The anticipated schedule is: °Initial screening of applications:August 29 -September 5,1996 .Technical and business reviews:September 6-13,1996 °Clarifications,analysis,coordination,and selections for negotiations:mid-September through mid-October,1996 °Announcement of applications accepted for negotiation:mid- October,1996 °Negotiations:mid-October,1996,through mid-January,1997 °Awards:beginning in mid-January,1997 Should the investment analysis discussed in the ROI Analysis,be based on Answer: 49.Question: Answer: 50.Question: Answer: 51.Question: Answer. 52.Question: the entire investment required,including DOE supplied funds,or the investment excluding DOE funds? The calculation of Return on Investment should include all funds utilized by the project,including those supplied by DOE. How does the distribution of program income affect the ROI Analysis? The distribution of program income should not affect the project's Return on Investment.Return on Investment should be calculated by dividing income before distribution by total investment. Appendix C -Budget and Additional Provisions,-5,contains the following statement:"DOE will have the right to interrupt and modify the conduct or performance of project activities for programmatic reasons."What is the exact implications of this statement,particularly the meaning of the term "programmatic reasons”? If ,after application review,it is determined there is a need for DOE's substantial involvement in the project,then the award will be a cooperative agreement.If no such need is identified,then the award would be issued as a grant.The specific nature and extent of DOE's post award involvement will depend on the particular project and will be negotiated with the applicant prior to award.For example,the substantial involvement term, agreed to during negotiations,might include the provision for DOE program staff to review the technical progress of the program and have the right to approve one stage of the activity before work could begin on a subsequent stage. If a project generate”additional profit beyond that shown in the ROI calculation,how is this additional profit treated?(Is the for-profit participant allowed to keep this excess profit;or,must this additional profit be shared with DOE;or,must the entire "excess"profit be returned to the DOE over the life of the project to be used to "pay back"the DOE grant?) The treatment of program income will be negotiated separately for each project selected for award.Enclosure 8 provides a definition and describes the uses of program income. May the for-profit project participant recover the cost of proposal preparation and submission once the project enters operation either out of the project's gross revenue,or if not,out of the project's "excess"profits? 53. 54. 35. 56. 37. Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer: Question: The DOE is under no obligation to pay for any costs associated with preparation or submission of applications if an awards is not made.If an award is made,such costs may be allowable as provided in the applicable cost principles.Allowable costs are determined based on the cost principles applicable to the organization incurring the costs.In this example --a for-profit sub-award recipient -the applicable cost principles are 48 CFR part 31.Determining the allowability of deferred bid and proposal costs will be made on a case-by-case basis at the time of negotiation based on the cost principles. In regard to utility scale wind turbines,is the requirement to be substantially manufactured and reproduced in the US applicable to each component separately from the wind turbine,to the wind turbine only,or to some type of aggregate cost? In the aggregate,the renewable energy technology funded by DOE must be substantially manufactured in the United States. In regard to utility scale wind turbines,how is the requirement to be substantially manufactured and reproduced in the US applied to equipment, design,lease of wind rights,transportation,equipment installation,project startup costs,etc? The "substantially manufactured”requirement holds for equipment. However,the solicitation additionally requires that all "activities supported under this solicitation must be performed within the United States of America.” Can project funding be used during the development stage for a project or product that does not meet the DOE requirement of "...manufactured substantially within the US"if the manufacturer is committed to substantial manufacture in the US for the commercialization phase? No. Can DOE providea list of utility scale wind turbine manufacturers that clearly meet the DOE requirement of "...manufactured substantially within the US? DOE does not have sucha list. Is commercialization of electric vehicle recharging technology eligible? 58. 59. 60. 61. 62. 63. Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer. Question: Yes,if the project utilizes renewable energy sources for recharging. We are interested in Turbine Verification Program Phase III,any info or the contact person in charge of this RFP would be appreciated Contact the Electric Power Research Institute,E.Davis,(415)855-2256. Would a geothermal heating/cooling district qualify for funding under this program and if so,what is the maximum amount of funds per project? Yes.There is no set maximum or minimum funding per project other than the total amount of funding available.However,DOE anticipates making 5-10 awards. Would a project involving revolving loans to new homeowners to bring a solar thermal product to market be eligible? Yes. Do we have to type on each page of the original application and subsequent copies;"Copy No.1","Copy No.2",etc.,or if it is sufficient to place it on the first page?' It is sufficient to write the copy number only on the first page. We have developed a product that uses bio-fuel for cooking,we are close to commercialization with several more months of R&D and field-testing of production models remaining.Is this eligible? The technology appears to be eligible.-However the K.&D is not an eligible activity,and the field testing would have to be an integral part of an overall commercialization strategy for the application to have a reasonable chance of being selected for negotiation of an award. Can NREL play a supporting role in a proposal for the CVP? No,since DOE anticipates using NREL technical staff as proposal reviewers. Must the application be directly and specifically related to renewable energy,such as developing a solid oxide fuel cell (SOFC)module specifically for use with a renewable fuel,or is it sufficient that renewable fuels can be used in our SOFCs? 65. 66. 67. 68. 69. 70. 71. Answer: Question: Answer: Question: Answer: Question: Answer. Question: Answer: Question: Answer: Question: Answer: Question: Answer: A fuel cell power plant would be an eligible application provided that the intended fuel cell feed gas is derived from a renewable resource. Is NYSERDA considered the applicant in all cases?Do you want similar information on the private-sector partner? NYSERDA would be one potential eligible applicant from New York. Eligibility information on the private sector partner would not be required. Would a project in Puerto Rico,a territory of the U.S.qualify? Yes.Projects carried out in the territory of eligible applicants,as described,are eligible. Is there a limit on the size of project in which the CVP can participate? There is no set maximum or minimum funding per project in the solicitation other than the total amount of funding available.However,DOE anticipates making 5-10 awards. What is your proposed schedule for investments in selected projects? DOE expects to make selection and notify applicants by mid-October,and commence negotiations with selected applicants immediately.While the date of awards will vary and will depend upon the length of negotiations, DOE expects that most awards should be complete by early 1997. If a project proposes to produce liquid transportation fuels,rather than electricity,do you have preferred/suggested prices-for "displaced cost"of gasoline/diesel/other transportation fuels?How about for sale of the fuels? The appropriate displacement cost for transportation is $0.60/gallon,which should be used in all calculations to provide uniformity between proposals. Are State Agencies required to complete all of the forms included in the package (i.e.Lobbying,Drug Free Workplace)? Yes. Can the Environmental Checklist be completed during contract negotiations? In order to facilitate review and possible award,the Environmental 72. 73. 74. 75. Question: Answer: Question: Answer: Question: Answer: Question: Answer. Checklist should be submitted with the application. Do you have sample completed forms as a guide? No such samples have been developed. Do we need a statement of eligibility? We would expect that the information contained in the application to be detailed enough to allow reviewers to make a determination that the applicant meets the solicitation's eligibility requirements.A separate "statement of eligibility”is not required. Can we receive the required federal forms in hard copy? Hard coy...s of required forms were mailed as part of the solicitation package to those who requested the solicitation directly from our office. Our proposal is to construct and operate a commercial scale facility using our proprietary technology.However,our funding request will be for only development period assistance.We would not be using the federal funds for R&D etc.,simply to help develop an actual working commercial site. As a small business,what rights,if any,will the government have to our technology? Under the terms of the agreement,awardees qualifying as a domestic small business,or nonprofit or educational institution (Bayh-Dole awardees)will have the right to elect to retain title to inventions conceived or first actually r 'uced to practice their employees under theiragreement as set out in AR 952.227-13 ae patent nights of all other awardees will be as set vat in DEAR 952.2..7-13.The status (e.g.,large vs.small business)of the business or institution at each tier of any particular agreement will determine the rights to inventions made by employees of that entity under the agreement.Rights to technical data will be as set out in the solicitation. It should be particularly noted that the Rights in Technical Data clause in the solicitation does not give the government any rights in the confidential background data (trade secrets)which an awardee uses in performing the agreement except as otherwise specifically called for in the agreement.In the case of Bayh-Dole awardees,generally the government will not have any rights in such background data nor in any background patents owned by the awardee.However,in the case of other awardees subject to DEAR 952.227-13,the government will obtain limited rights in background patents,and if the awardee requests a waiver of patent rights,to 10 76. 77. 2. 79. 80. Question: Answer: Question: Answer. Question: Answer. Question: Answer: Question: Answer: background data as well consistent with the Department's patent waiver policy. Our project will be a joint venture between several companies.For this purpose we will be putting together a limited partnership to own the project.Do we apply for federal funds in the name of the new entity or in the name of one of the primary partners? Applications must be submitted by an eligible applicant,as described in the solicitation and Amendment 001.Companies or joint ventures between companies cannot apply directly for federal funds under this solicitation. If we use slurry carbonization as the core technology(utilized differently) in two separate projects,one in Georgia and one in Arizona,would they be considered as different projects and would each proposal be considered independently?We want to enter two separate applications. The two projects may be submitted separately or combined in one application.Since the objective of the solicitation is technology commercialization,it could be advantageous to combine them into a single application as an integral part of an overall commercialization strategy. Phase change materials efficiently store and release thermal energy,and several studies have shown that these materials can reduce energy costs of heating and cooling building.Is this type of project eligible? A buildings application would not be eligible.However,integration of phase change materials into,for example,a power generation system using a renewable energy source would be acceptable.- Are awards made by DOE directly to the applicant or passed through the state agency? Funds are passed through the state agency,which is the eligible applicant. Can past labor count towards the project as cost sharing or must it be proposed labor (as in-kind)in the future? Past labor cost cannot be used as cost share;proposed labor cost could be allowable as a cost-share provided they otherwise meet the requirements for cost-sharing contained in DOE's financial assistance rules at 10 CFR 600.(see Enclosure 8) 11 81. 82. 83. 84. 85. 86. 87. 88. Question: Answer. Question: Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer. Question: Does methanol fuel qualify under CVP as a "renewable"fuel or is it is considered a "replacement"fuel? Methanol fuel qualifies as a renewable fuel provided it is derived from a renewable feedstock. Would establishing a production line to manufacture nickel metal hydride batteries for PV storage and other uses be eligible? No. Would developing and demonstrating an electric scooter and other products using nickel metal hydride batteries and a PV recharging station be eligible? Yes.It would be necessary to describe the project in terms of an integrated photovoltaic-powered transportation system. The requirements page did not specify the project had to use photovoltaic or wind energy.Is a unique commercial refrigerator eligible? No. Is a technology such as a fuel cell that uses methanol whose predominate, but not sole,production source is renewable feedstock,eligible for funding? A fuel cell power plant would be an eligible application provided that the intended fuel cell feed gas is derived from a renewable resource. Can tne purchase of capital equipment be included in the cost of the proposal? Yes. Since the costs for capital equipment would be shared between a for-profit industry and DOE,who would own the equipment at the end of the contract period? Title to equipment acquired by a recipient with federal funds vests upon acquisition in the grantee or sub-grantee respectively. If the DOE cost-shares the purchase of equipment,what would the 12 89. 90. 91. 92. 93. Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer: Question: capitalized basis for the depreciation of the equipment be?(full vendor value or the for-profit industry cost-share amount?) If the purchase of capital equipment is funded through a direct charge to the project,the value of the equipment has been fully covered;therefore, no depreciation would be charged.If it is bought by the for-profit and depreciation is charged as an indirect cost,then the basis is full vendor value. We will not be able to complete a full 3 year audit before the Aug 29 deadline.Will DOE CVP accept without penalty a 3 year compilation with our proposal by the deadline date with the understanding that we would submit the full audit report by September 13th? Audited financial statements are preferable in order to facilitate the business review.However,unaudited statements are acceptable.A letter of explanation should accompany the application. Would a Phase I activity consisting of developing detailed.design, engineering and equipment specifications of a project be eligible for an award. No. If we do not have a firm commitment for 50%or better financing by Aug 29th,would this lack preclude our having a successful proposal? No.The solicitation requires "evidence of firm funding commitments,”for the 50%cost share (section 6.c,p.14).If it is likely that the project will be able to secure 50%of the costs but has not made final arrangements by August 29th,the proposer may include all documentation in the proposal. Such proposals will be evaluated on a case-by-case basis,and in accordance with the evaluation criteria in the solicitation,the reliability and availability of non-federal funding commitments will affect the score received. Maya private sector project be paid (or credited for cost-sharing)for project labor or for provision of equipment for project use? Yes,provided the costs are allowable under applicable cost principles and meet the regulatory cost-sharing requirements.(see Enclosure 8) May that private sector participant earn a profit on its labor or equipment? 13 94. 95. 96. 97. 98. Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer: Question: No profit or fee will be provided through financial assistance awards,to for-profit organizations,participating as a team member or partner in the projects.A profit or fee is consider to be an amount in excess of actual allowable,allocable,and reasonable direct and indirect costs which are incurred in conducting an assistance project.A fee or profit is allowable to subcontractors who are merely vendors of products or services used in grant activities. Maya private sector participant be paid or credited for cost-sharing for providing a wind turbine for project use? Loaned equipment may be used to satisfy a cost-sharing requirement provided the standards for such third-party in-kind contributions,described in DOE's financial assistance rules on cost-sharing,are met.A usage fee may be reimbursable if it otherwise meets the requirements contained under the applicable cost principles.(See Enclosure 8.) For a foreign-owned U.S.corporation which manufactures parts of their turbine in the U.S.,assembles foreign made turbine parts in the U.S., contracts for other parts which are made in the U.S.,and installs the machine in the U.S.on a U.S.manufactured foundation,would the resulting assembly be considered "manufactured substantially within the US.? In the aggregate,the renewable energy technology funded by DOE must be substantially manufactured in the US. Will yo"!2dvise when the next CVP will be offered? It is ur:y that there will be another solicitation.DOE will retain the mailing ust for notification should another solicitation be made. Is the commercialization of electrochromic technology,referred to as smart windows,eligible? No.The source of Congressional appropriations for the solicitation limits the eligible technologies to renewable energy and precludes energy efficient technologies.: If a project has obtained the necessary environmental permits such as air and water permits from a state government,would DOE need to complete a NEPA review?If a NEPA reviy »:is needed,how soon would it begin, and how long would it take? 14 99. 100. 101. 102. 103. 104. Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer: Question: DOE will need to complete NEPA reviews for all successful applications, regardless of any previous state permitting.The reviews could proceed simultaneously with negotiations and are not anticipated to be lengthy. If income received from sale of a product,during the project period,is reinvested in the project through expansion or replication,would the funds be considered income?How would they be handled? Sale of commodities or items fabricated under a grant agreement would be treated as program income.The three alternative uses of program income (deduction,addition,and cost-sharing or matching)are described in Enclosure 8. What is the source of funding for this solicitation?If the available funds are broken down between technologies,what amounts are available for the different technologies? The source of funding is by FY 96 and prior years appropriations.No subdivision of funding technology has been established,but achieving a diversity of technologies may be invoked as a program policy factor.(See _page 18 of solicitation.) Will selections be made in Denver,or at the national level? The selection will be made by the Selection Official whose position is at DOE Headquarters in Washington D.C. What involvement does DOE plan to have in monitoring the progress and activities of the grant and what will be expected ofthe State Energy Office? DOE will negotiate with each successful applicant the appropriate monitoring role for each party. Given some level of investment by a company,and given some degree of internally generated technology effort,does the CVP have a mechanism in place that would allow us to receive additional direct funding from the DOE to help support such development? No.DOE does not anticipate funding for the Commercialization Ventures Program beyond the current solicitation. _Are high efficiency combustors eligible? 15 105. 106. 107. 108. 109. 110. Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer. Question: Answer: Question: Yes,provided _y are used in conjunction with a renewable fuel. Where can I find a specific description of "disposition of program income"? Refer to 10 CFR 600.225 which describes three methods for using (disposing of)program income:the deduction method,addition method, and cost sharing method.(See Enclosure 8.) Is an extremely advanced wood-fueled residential heating system eligible? Yes. Enclosure 1 "Parameters of ROI Calculation",Item 2 "Price of Electricity Sold"says 12%.The text is confusing,how is 12%to be applied to the price of electricity?Is that an escalation to be applied to the Displaced Cost of Electricity of item 4,set at 5c/KWH?If so that contradicts item 6, Escalation Rates. Item 2 in Enclosure 1 was mislabelled.12%is the discount rate to be used when evaluating future cash flows;it has nothing to do with the Price of Electricity Sold.(see amended Enclosure 1).In order to calculate financials,$0.05/kwh has been supplied as the cost of electric power.For ease of comparison,the escalation rate for the cost of electric power has been supplied as "no growth.”The other growth rates indicated may be used for the type of power displaced by the project. If a for-profit company has a program with DOE METC for the development of an energy technology,will this preclude them from being eligible or reduce their chance for an award under the subject program? No. Regarding Enclosure 1,items 1 and 2;under the inflation category does the request that "real"constant dollars be used mean that there should be no inflation assumption? "Real”constant dollars means that the purchasing price of $1 should stay constant over the life of the project;inflation should not be calculated into projections. Enclosure 1,item 2:does this mean we should use a discount rate of 12% in evaluating future cash flows? 16 111. 112. 113. 114. 115. 116. Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer: Question: Answer. Question: Item 2 in Enclosure 1 was mislabelled.12%is the discount rate to be used when evaluating future cash flows;it has nothing to do with the Price of Electricity Sold.(see amended Enclosure 1). Would the widespread promotion,implementation and market research of daylighting be eligible? No.Daylighting or other passive solar projects are not eligible. Is a 200kw fuel cell on the local town's landfill be eligible? Yes. Is the reclamation of the resistive braking energy of a train to be used for re-acceleration of the vehicle eligible? No. Is it permissible to anticipate government funding at a rate of 50%for the first phase with a lesser degree of government funding in the second phase? Yes,assuming that the phases are integrally linked and presented as such, and that cost-sharing requirements for the project are met. As a small business which possesses unique &patented technologies but with $0 revenue currently,are we required in any way to provide government rights to our prior technology or any subsequent technologies as a result of grant? Under 35 USC 200 et.seq.domestic small business may elect to retain title to foreground inventions conceived or first actually reduced to practice under their agreements such as contemplated in this case (i.e.,funding agreements).Additionally,the government is generally prohibited by statute from requiring a domestic small business to provide the government rights to background patents.Stull further,since the government does not have any rights to a contractor's background patents,it has consistently been DOE's position not to require such contractors to give the government any rights in proprietary background trade secrets or the like other than the right to verify such information is proprietary. Is there any action we can take to achieve a state in which we retain a right to our exclusive technology but the government is granted a paid up right for the use of the technology with one exception;that is cannot be used by 17 117. 118. 119. 120. Answer: Question: Answer: Question: Answer. Question: Answer. Question: Answer: competitive companies? With respect to foreground inventions,a condition of electing to retain title is that the contractor file a timely patent application for the particular inventions involved in any country where the contractor desires to retain title.If the contractor does not file,the government ultimately has the option to take title and file on the government's behalf.In those cases where the contractor does file,the government will have a statutory paid- up nonexclusive license to practice such inventions,or have others do so, on the governments's behalf pursuant to 35 USC 202(c)(4).Additionally, the contractor is also bound by the March-in and Preference for United States industry provisions of 35 USC 203 and 204. Our project will be approximately $20 million and we would hope to receive a grant of about $2 million from DOE with this application.We plan to use the grant to purchase capital equipment for the project.There is no intent to use the funds for personnel,travel,budget,etc.As a result, when we complete the budget forms do we need to get into detail on all line items or just equipment items?How do we apply for such an exception (providing detail on just one line item)? Budget detail is needed for all project cost categories whether supported from DOE funds or used as cost sharing.In addition,applications will be point scored in accordance with the evaluation criteria in the solicitation, which includes reasonableness and completeness of cost estimates, reasonableness of cost projections,completeness of costs included in analyses,etc.The level of detail provided for the entire project will affect the total score received. Would «smmercialization of a fleet.2lectric vehicles be eligible* Yes,provided that the vehicles are integral to an overall system that is powered by a renewable energy source. Can a recently constructed 25,600 SF facility be used as an "in-kind" contribution/match for DOE funding? See Amendment 001,question 10. Iincorrectly used a 30 year -8%discount.I intend to convert all data by a factor equal to the difference.Is this acceptable? Financial information has been requested based on a 20 year calculation 18 using a 12%discount rate.All calculations needed to produce this information should be well documented and in accordance with standard practices. 19 Enclosure 7 REVISED PAGE 20 OF THE SOLICITATION (Asterisked items have been added since the original solicitation was issued) ATTACHMENTS (Completed Attachments must be submitted with the application)LQOMMOOW>Application for Federal Assistance,SF-424 Federal Assistance Budget Information Form,DOE F4600.4 Budget Explanation Form Pre-Award Information Sheet,GO-PF19 U.S.DOE Assurance of Compliance,DOE F 1600.5 Lobbying/Debarment/Drug-free Disclosure of Lobbying Activities,SF-LLL Environmental Checklist ENCLOSURES (Not required to be submitted with application) "1. 2. *3. *4. *5 *6. *7. *8. Parameters for Return on Investment Calculations Sample Cooperative Agreement Questions and Answers as of August 15,1996 Summaries of projects funded under the 1994 Commercialization Ventures Program solicitation . Persons and organizations that have received the solicitation,as of July 19, 1996 A map showing the location of Building 17 in the Denver West OfficePark,to which hand-carried applications are to be delivered Revised page 20 of the solicitation showing Attachments and Enclosures Excerpts from 10 CFR 600 (Revised 15 August 1996) Enclosure 8 Excerpts from 10 CFR Chapter II Part 600,Financial Assistance Rules. 10 CFR 600.224 Matching or cost sharing. (a)Basic rule:Costs and contributions acceptable.With the qualifications and exceptions listed in paragraph (b)of this section,a matching or cost sharing requirement may be satisfied by either or both of the following: (1)Allowable costs incurred by the grantee,subgrantee or a cost-type contractor under the assistance agreement.This includes allowable costs borne by non-Federal grants or by others cash donations from non-Federal third parties. (2)The value of third party in-kind contributions applicable to the period to which the cost sharing or matching requirements applies. (b)Qualifications and exceptions --(1)Costs borne by other Federal grant agreements.Except as provided by Federal statute,a cost sharing or matching requirement may not be met by costs borne by another Federal grant.This prohibition does not apply to income eared by a grantee or subgrantee from a contract awarded under another Federal grant. (2)General revenue sharing.For the purpose of this section,general revenue sharing funds distributed under 31 U.S.C.6702 are not considered Federal grant funds.: (3)Cost or contributions counted towards other Federal costs-sharing requirements.Neither costs nor the values of third party in-kind contributions may count towards satisfying a cost sharing or matching requirement of a grant agreement if they have been or will be counted towards satisfying a cost sharing or matching requirement of another Federal grant agreement,a Federal procurement contract,or any other award of Federal funds. (4)Costs financed by program income.Costs financed by program income,as defined in §600.225,shall not count towards satisfying a cost sharing or matching requirement unless they are expressly permitted in the terms of the assistance agreement.(This use of general program income is described in §600.225(g).) (5)Services or property financed by income earned by contractors. Contractors under a grant may earn income from the activities carried out under the contract in addition to the amounts earned from the party awarding the contract.No costs of services or property supported by this income may count toward satisfying a cost sharing or matching requirement unless other provisions of the grant agreement expressly permit this kind of income to be used to meet the requirement. (6)Records.Costs and third party in-kind contributions counting towards satisfying a cost sharing or matching requirement must be verifiable from the records of grantees and subgrantee or cost-type contractors.These records must show how the value placed on third party in-kind contributions was derived.To the extent feasible,volunteer services will be supported by the same methods that the organization uses to support the allocability of regular perscnnel costs. (7)Special standards for third party in-kind contributions.(i)Third party in-kind contributions count towards satisfying a cost sharing or matching requirement only where,if the party receiving the contributions were to pay for them,the payments would be allowable costs. (ii)Some third party in-kind contributions are goods and services that,if the grantee,subgrantee,or contractor receiving the contribution had to pay for them,the payments would have been an indirect costs.Cost sharing or matching credit for such contributions shall be given only if the grantee,subgrantee,or contractor has established,along with its regular indirect cost rate,a special rate for allocating to individual projects or programs the value of the contributions. (iii)A third party in-kind contribution to a fixed-price contract count towards satisfying a cost sharing or matching requireme:.-aly if it results in: (A)An increase in the services or property provided under the contract (without additional cost to the grantee or subgrantee)or (B)A cost savings to the grantee or subgrantee. (iv)The values placed on third party in-kind contributions for cost sharing or matching purposes will conform to the rules in the succeeding sections of this subpart.If a third party in-kind contribution is a type not treated in those sections,the value placed upon it shall be fair and reasonable. (c)Valuation of donated services --(1)Volunteer services.Unpaid services provided to a grantee or subgrdntee by individuals will be valued at rates consistent with those ordinarily paid for similar work in the grantee's or subgrantee's organization.If the grantee or subgrantee does not have employees performing similar work,the rates will be consistent with those ordinarily paid by other employers for similar work in the same labor market.In either case,a reasonable amount for fringe benefits may be included in the valuation. (2)Employees of other organizations.When an employer other than a grantee,subgrantee,or cost-type contractor furnishes free of charge the services of an employee in the employee's normal line of work,the services will be valued at the employee's regular rate of pay exclusive of the employee's fringe benefits and overhead costs.If the services are in a different line of work,paragraph (c)(1)of this section applies. (d)Valuation of third party donated supplies and loaned equipment or space.(1)If a third party donates supplies,the contribution will be valued at the market value of the supplies at the time of donation. (2)If a third party donates the use of equipment or space in a building but retains title,the contribution will be valued at the fair rental rate of the equipment or space. (e)Valuation of third party donated equipment,buildings,and land.If a third party donates equipment,buildings,or land,and title passes to a grantee or subgrantee,the treatment of the donated property will depend upon the purpose of the grant or subgrant,as follows: (1)Awards for capital expenditures.If the purpose of the grant or subgrant is to assist the grantee or subgrantee in the acquisition of property,the market value of that property at the time of donation may be counted as cost sharing or matching, (2)Other awards.If assisting in the acquisition of property is not the purpose of the grant or subgrant,paragraphs (e)(2)(i)and (ii)of this section apply: (i)If approval is obtained from the awarding agency,the market value at the time of donation of the donated equipment or buildings and the fair rental rate of the donated land may be counted as cost sharing or matching. In the case of a subgrant,the terms of the grant agreement may require that the approval be obtained from the Federal agency as well as the grantee.In all cases,the approval may be given only if a purchase of the equipment or rental of the land would be approved as an allowable direct cost.If any part of the donated property was acquired with Federal funds, only the non-federal share of the property may be counted as cost-sharing or matching. (ii)If approval is not obtained under paragraph (e)(2)(i)of this section, no amount may be counted for donated land,and only depreciation or use allowances may be counted for donated equipment and buildings.The depreciation or use allowances for this property are not treated as third party in-kind contributions.Instead,they are treated as costs incurred by the grantee or subgrantee.They are computed and allocated (usually as indirect costs)in accordance with the cost principles specified in §600.222,in the same way as depreciation or use allowances for purchased equipment and buildings.The amount of depreciation or use allowances for donated equipment and buildings is based on the property's market value at the time it was donated. (f)Valuation of grantee or subgrantee donated real property for construction/acquisition.If a grantee or subgrantee donates real property for a construction or facilities acquisition project,the current market value of that property may be counted as cost sharing or matching.If any part of the donated property was acquired with Federal funds,only the non-federal share of the property may be counted as cost sharing or matching. (g)Appraisal of real property.In some cases under paragraphs (d),(e)and (f)of this section,it will be necessary to establish the market value of land or a building or the fair rental rate of land or of space in abuilding.In these cases,the Federal agency may r:quire the market value. or fair rental value be set by an independent appraiser,and that the value or rate be certified by the grantee.This requirement will also be imposed by the grantee on subgrantees. 10 CFR 600.225 Program income. (a)General.Grantees are encouraged to earn income to defray program costs.Program income includes income from fees for services performed, from the use or rental of real or personal property acquired with grant funds,from the sale of commodities or items fabricated under a grant agreement,and from payments of principal and interest on loans made with grant funds.Except as otherwise provided in regulations of the Federal agency,program income does not include interest on grant funds,rebates, credits,discounts,refunds,etc.and interest earned on any of them. (b)Definition of program income.Program income means gross income received by the grantee or subgrantee directly generated by a grant supported activity,or earned only as a result of the grant agreement during the grant period.'During the grant period”is the time between the effective date of the award and the ending date of the award reflected in the final financial report. (c)Cost of generating program income.If authorized by Federal regulations or the grant agreement,costs incident to the generation of program income may be deducted from gross income to determine program income. (d)Governmental revenues.Taxes,special assessments,levies,fines,and other such revenues raised by a grantee or subgrantee are not program income unless the revenues are specifically identified in the grant agreement or Federal agency regulations as program income. (e)Royalties.Income from royalties and license fees for copyrighted material,patents,and inventions developed by a grantee or subgrantee is program income only if the revenues are specifically identified in the grant agreement or Federal agency regulations as program income.(See §600.234.). (f)Property.Proceeds from the sale of real property or equipment will be handled in accordance with the requirements of §§600.231 and 600.232. -)Use of program income.Program income shall be deducted from outlays vhich may be both Federal and non-Federal as described below,unless the Federal agency regulations or the grant agreement specify another alternative (or a combination of the alternatives).In specifying alternatives,the Federal agency may distinguish between income earned by the grantee and income earned by subgrantees and between the sources, kinds,or amounts of income.When Federal agencies authorize the alternatives in paragraphs (g)(2)and (3)of this section,program income in excess of any limits stipulated shall also be deducted from outlays. (1)Deduction.Ordinarily program income shall be deducted from total allowable costs to determine the net allowable costs.Program income shall be used for current costs unless the Federal agency authorizes otherwise. Program income which the grantee did not anticipate at the time of the award shall be used to reduce the Federal agency and grantee contributions rather than to increase the funds committed to the project. (2)Addition.When authorized,program income may be added to the funds committed to the grant agreement by the Federal agency and the grantee.The program income shall be used for the purposes and under the conditions of the grant agreement. (3)Cost sharing or matching.When authorized,program income may be used to meet the cost sharing or matching requirement of the grant agreement. The amount of the Federal grant award remains the same. (h)Income after the award period.There are no Federal requirements governing the disposition of program income earned after the end of the award period (i.e.,until the ending date of the final financial report, see paragraph (a)of this section),unless the terms of the agreement or the Federal agency regulations provide otherwise. DOE F 1325.8 (8-89) EFG (07-90) United States Government Department of Energy memorandum DATE:August 15,1996 REPLY TO ATINOF:EE-44 RECEIVED aug 27 1996 suaect:Building Energy Tools Report DIVISION OF ENERGY to:State Energy Program Managers;Weatherization Program Managers Enclosed is a copy of Building Energy Tools,a report developed in June 1996 by the U.S. Department of Energy.This report is a consolidated directory of the software currently being used in Energy Efficiency and Renewable Energy offices.This report is only being printed once and will be expanded and kept up-to-date on the Energy Efficiency and Renewable Energy home page on the Internet (http://www.eren.doe.gov).Look for the Building Energy Tools under the Building Technologies section of the home page. eanne/Van Vlandren,Director Office/of State and Community Programs Energy Efficiency and Renewable Energy cc:State Energy Program Directors Weatherization Program Directors Calendar October 14-16 © New Orleans,Louisiana Contact:ICC (310)908-8182. October 15-17 - -jj Workshop- :Las Vegas,NevadaContact:The BSGP Hotline:(800)270-CODE.'October 27 -31 ,'SBCCI Annual Research and Education ConferenceSheratonCivicCenter -Birmingham,Alabama *Contact:(205)591-1853.-° <3)Printed on Recycled Paper |Setting the Standard *%US DEPARTMENT OF ENERGY:§BUILDING STANDARDS AND GUIDELINES PROGRAM (A.L.Parker (address corrections onl}y)_Pacific Northwest National Laboratory-P.O.Box 999-MSIN K5-16 Richland,Washington 99352 Address Correction Requested | 'ICC Code Development Hearings ; Building Standards and Guidelines .November 14-171996EEBAExcellencein|Housing Conference'Hyatt Regency,MinneapolisContact:(612)851-9940.. 1997.January 25-29.ASHRAE Winter Meeting --Philadelphia Marriott =--|Contact::ASHRAE Meetings,1791 Tallie Circle N.E.;Atlanta,Georgia (404)636-8400,fax (404)321-5478. -»More "Frequeritly Asked Questions”about the /Model Energy Cede.:(continued from previous page)space at 50°'during the day iin winter,then the.space iis.heated.Furnace enclosures that have outside air intro- .duced for combustion should also be considered.The furnace enclosure would be unconditioned,and the walls: _(assuming the furnace room is separated from acondi tioned space).; of the enclosure would be part of the building envelope.ao Alaska Department of Community &Regi 333 West 4th Avenue,Suite 220 Anchorage,AK 99501-2341 7 Better Glimatefarr Jobs”dh Lael:lohhtlawsliab ball leotaell Ll shafesbeadl 2 ?a US DEPARTMENT OF ENERGYBUILDINGSTANDARDSANDGUIDELINESPROGRAM Setting the Standard Volume6,Issue3DOEandClarkCounty,Nevada ICBO.7 Co-sponsor MECcheck™TrainingAMECcheck™training sessionn co-sponsored by the Clark_County,Nevada chapter of the International Conference of - 'Building Officials (ICBO)will be heldin Las Vegas on -October 17 in conjunction with the U.S.Department of © -Energy (DOE)Regional Workshop to be held there Octo-_ber 15 and 16.The training session will focus on compliancewiththeModelEnergyCode(MEC)using the MECcheck™compliance tool.Version 2.1 of the MECcheck™softwarewillbedemonstratedduringthetraining.The software deter-mines compliance using either'a UA or building energy-_methodology.The MECcheck™training session will include:;Overview of the MEC'-When the MEC Applies Basic Requirements:.- Prescriptive Package Approach-MECcheck™Software ApproachTrade-ott Approach _-Enforcement.-: _If you are interested iin attending|the training session,con-tact Carole Gates at the DOE Seattle Support Office,:(206)553-1165.For information about the regional work-shop,contact the Building Standards and Guidelines Pro-gram Hotline (800)270-CODE. 3rd Quarter 1996 COMebeck-£Z™Training OfferedTheCOMoheck-EZ™compliance tool will be showcased iin.training sessions across the United States this fall.The .-COMcheck-EZ™tool has beén developed by the U.S.Depart-ment ofEnergy Building Standards and Guidelines Program_.for use in complying with commercial building energy codes.'The software targets small,"simple"commercial buildings,'which dominate the commercial construction industry. Designing and constructing a building to COMcheck-EZ™_.will result in a building that,on average,meets or exceedstheenergyefficiencyofabuildingthatwasconstructedto'ASHRAE/IES Standard 90.1-1989 (Standard 90.1).COMcheck-EZ™training will be held October 3 in 'Atlanta a(contact Alan Gibson at the DOE Atlanta Support Office,[404]347-1769),and October 10 in Salt Lake City (contact.Brian Lawson at DOE's Denver Regional Support Office-[303]275-4810).; -The six-hour training.sessions explain the COMcheck-EZ™:”compliance toolsand show how building designers and build.ers can demonstrate compliance using them.The training."-covers the scope and application of Standard 90.1 and using ”COMcheck-EZ™to comply with requirements for the .--.building envelope,mechanical system,and lighting systems.;The release date for COMcheck-EZ™is November 15;until >.then draft materials will be available at the training sessions.- .More "Frequently Asked Questions”about the Model Energy CodeThelastissueofSettingtheStandardincludedsomefrequentlyaskedquestionsabouttheModelEnergyCode(MEC).:HerearesomeadditionalquestionsaboutthebystaffoftheBuildingStandardsandGuidelinesProgram. Q Whenis it acceptable to insulate the floor above a basementratherthanthebasementwalls? A When the basement iis unconditioned (neither heated nor |cooled).The primary choiceis to insulate the basement walls"(conditioned basasement)or to insulate all surfaces that separate,the basement space from the conditioned space above andadjacenttothebasement.ca.Q What are the sources of U-valuesfor windows and skylights?-A Most windows and skylights will have a label that reports.a U-value based on the National Fenestration Rating'Council (NFRC)test (use the "AA”U-value,rather than.the "BB”U-value on the NFRC label).For windowsandskylightswithoutlabeledU-values,the 1995MECrequiresusingtheU-valuesin Table 102.3aofthe1995MEC.Using this tableis 'optional for &the 1992 and 1993 MEC.. MEC,as compiled- US.DEPARTMENT OF ENERGY"A Better Cligzate for Jobs” Q How are conflicts berween the energy requirements in theMECandhealth,safety,or environmental requirements iin-other codes going to be resolved?A The health,safety,or environmental requirements takeprecedenceovertheenergyrequirements.The authority --.with jurisdiction makes this determination..Q Dol have to meet all the MECc insulation (or U-value)requirements exactly?A No,the MEC establishes the concept that overcompliance-in one area can be"traded off”for noncompliancein another.(For example,adding more insulation,better glazing,more|efficient equipment,etc.)Itis also permissible tto build toalevelthatexceedstheMEC.: Q Does a furnace or water heater iin a space define it as condi-tioned if there are no other heat sources such as resisters ornina'ducts?©A No.The presence of a furnaceor a water:heater ;2,does not by itself define the space as conditioned.3 When heat loss from the furnace or water heater1couldmaintainthe(continued on next page) het US DEPARTMENT OF ENERGY BUILDING STANDARDS AND GUIDELINES PROGRAM (Setting the Standard. 'DOE and Clark County,Nevada ICBO Co-sponsor MECcheck™Training ©. A MECcheck™training session co-sponsored by the Clark :a-County,Nevada chapter of the International Conference of'Building Officials (ICBO)will be held in Las Vegas on::October 17 in conjunction with the U.S.Department of -Energy (DOE)Regional Workshop to be held there Octo-ber 15 and 16.The training session will focus on compliancewiththeModelEnergyCode(MEC)using the MECcheck™.compliance tool.Version 2.1 of the MECcheck™softwarewillbedemonstratedduringthetraining.The software deter-mines compliance using either a UAor building energy.methodology.The MECcbeck™training session willinclude:. °Overview of the MEC © *When the MEC Applies ¢Basic Requirements . .©.Prescriptive Package Approach "©MECcheck™Software Approach Trade-off Approach Enforcement. "If you are interested in attending the training session,con-'tact Carole Gates at the DOE Seattle Support Office, (206)553-1165.For information about the regional work-shop,contact the Building Standards and Guidelines Pro- gram Hotline (800)270-CODE.To mo 3rd Quarter 1996 Volume 6,Issue 3° ;|COMcheck-EZ™Training Offered _.The COMcheck-EZ™compliance tool will be showcased in |training sessions across the United States this fall.The _COMcheck-EZ™tool has beén developed by the U.S.Depart-ment of Energy Building Standards and Guidelines Program ._for use in complying with commercial building energy codes.-The software targets small,"simple"commercial buildings,.which dominate the commercial construction industry.Designing and constructing a building to COMcheck-EZ™will result in a building that,on average,meets or exceedstheenergyefficiencyofabuildingthatwasconstructedto_ASHRAE/IES Standard 90.1-1989 (Standard 90.1). COMcheck-EZ™training will be held October 3 in Atlanta |:'(contact Alan Gibson at the DOE Atlanta Support Office,»-[404]347-1769),and October 10 in Salt Lake City (contactBrianLawsonatDOE's Denver Regional Support Office[303]275-4810).. _The six-hour training sessions explaintheCOMcheck-EZ™©compliance tocls and show how building designers and build-*ers can demonstrate compliance using them.The training :covers the scope and application of Standard 90.1 and using =- .COMcheck-EZ™to comply with requirements for the -building envelope,mechanical system,and lighting systems.-- The release date for COMcheck-EZ™is November 15;untilthendraftmaterialswillbeavailableatthetrainingsessions. 7 More "Frequently Asked Questions”about the Model Energy Code The last issue of Setting the Standard included some frequently -asked questions about the Model Energy Code (MEC).HerearesomeadditionalquestionsabouttheMEC,as compiledbystaffoftheBuildingStandardsandGuidelinesProgram.- -Q When is it acceptable to insulate the floor above a basementratherthanthebasementwalls?we A When the basement is unconditioned (neither heated norcooled).The primary choice is to insulate the basement walls(conditioned basement)or to insulate all surfaces that separatethebasementspacefromtheconditionedspaceaboveand-adjacent to the basement. Q What are the sources of U-values for windows and skylights? A Most windows and skylights will have a label that reportsaU-value based on the National Fenestration RatingCouncil(NFRC)test (use the "AA”U-value,rather thanthe"BB”U-value on the NFRC label).For windows-and skylights without labeled U-values,the 1995 PeMECrequiresusingtheU-values in Table 102.3a &of the 1995 MEC.Using this table is optional for § the 1992 and 1993 MEC.a "A Bea Q How are conflicts between the energy requirements in theMECandhealth,safety,or environmental requirements in ._other codes going to be resolved? "A The health,safety,or environmental requirements takeprecedenceovertheenergyrequirements.The authority |- with jurisdiction makes this determination...' Q Do I have to meet all the MEC insulation (or U-value)requirements exactly? A No,the MEC establishes the concept that overcomplianceinoneareacanbe"traded off”for noncompliance in another...(For example,adding more insulation,better glazing,more_efficient equipment,etc.)It is also permissible to build toa'_'level that exceeds the MEC. Q Does a furnace or water heater in a space define it as condi- 7 uninsulated ductse =.| @ A No.The presence of a furnace or a water heater%does not by itself define the space as conditioned.te}3 When heat loss from the furnace or water heater"could maintain the (continued on next page) tioned if there are no other heat sources such as resisters or - _sor Jobs” *)a Ps Calendar November 14-17 oe mc , "1996 EEBA Excellence in Housing Conference October 14-16 _-Hyatt Regency,Minneapolis = ICC Code Development Hearings Contact:(612)851-9940, 1996 e New Orleans,Loutsiana ; Contact:ICC (310)908-8182.1997 October 15-17.7 January 25-29 Building Standards and Guidelines _ASHRAE Winter MeetingWorkshop-Philadelphia Marriott ,oo Las Vegas,Nevada Contact:ASHRAE Meetings,1791 Tullie Circle N.E.,Contact:The BSGP Hotline:(800)270-CODE._Atlanta,Georgia (404)636-8400,fax (404)321-5478. October 27-31 Co SBCCI Annual Research and Education Conference Sheraton Civic Center 7 Birmingham,Alabama '-More "Frequently Asked Questions”about theContact:(205)591-1853. g the Standard is published quarterly for the U.S.Department of Energyby (continued from previous page)the Building Standards and Guidelines Program at the Pacific Northwest Nauonal fo -. Laboratory.Its purpose is t6 encourage information exchange among buildings:space at 50°F during the day in winter,then the space isindustryprofessionalsandorganizations,stare and local code'officials,and heated.Furnace enclosures that have outside air intro-researchers.The goal is to facilitate timely development and early adoption ofthe:building 'energy conservation standards...We-welcome reader comments andcontributions. duced for combustion should also be considered.Thefurnaceenclosurewouldbeunconditioned,and the wallsoftheenclosurewouldbepartofthebuildingenvelope(assuming the furnace room is separated from a condi-tioned space). ®Printed on Recycled Paper _ Setting the Standard '\US DEPARTMENT OF ENERGY BUILDING STANSARDS AND GUIDELINES PROGRAM ER wtren A.L.Parker (address corrections only)__ Pacific Northwest National Laboratory _ P.O.Box 999-MSIN K5-16 - Richland,Washington 99352) Address Correction Requested , David Lockhard Alaska Division of Energy 333 W.4th Ave.,Suite 220 Anchorage,AK 99501-2341 "A Better Climate tor Jobs” page 12 (Interview with NAIMA's Ken Mentzer,ftom page 7) It's important to be able to measure energy efficiency, SO we support home energy rating systems that give a consumer the ability to know what an efficient home is.In addition,rating systems will be most effective if they are coupled with appropriate financing mecha- nisms.The Energy Efficient Mortgage and similar tools allow consumers to purchase more energy-efficient homes or to improve existing homes. In keeping with our preference for market-based en- ergy efficiency,we are active in supporting voluntary programs to improve energy efficiency,such as EPA and DOE's Energy Star program or the Edison Electric Institute's E-Seal program. Alliance Update:It sounds like you see the solutions being as much market-driven as regulatory-driven. Ken Mentzer:Yes,I think the United States has the know-how and the technology today to create climate change responses that offer both economic and envi- ronmental benefits.We should provide more information on energy efficiencytohomeowners,build- ing owners,and industrial manufacturing plant man- agers,and let them make the best decisions. Alliance Update:Do you have any final thoughts? Ken Mentzer:It is important to broaden the base of the industry support for energy efficiency.Energy sup- pliers are well-represented in government as well as in the marketplace.But companies that make products that save energy have a harder time being heard. One sector that I would like to see more involved in energy efficiency is the insurance industry.They are a big industry and they have a big stake in climate change. They have already seen record losses from weather di- sasters in the last decade.Energy efficiency is a low-cost, no-regrets form of insurance against climate change. We are encouraged that insurance groups are begin- ningtosupport the Alliance on issueslikebuilding codes; codes are a natural for them,since insurers have been involved in codes issues for decades.I hope we can expand our joint efforts. Alliance to Save Energy 1200 18th Street,N.W.,Suite 900 Washington,D.C.20036 Phone:(202)857-0666 Fax:(202)331-9588 E-mail:info@ase.org WWW: http://www.ase.org/ Editor:Jay Wattenberg Printed on Recycled Paper Suite 220 Mr.David Lockard Community and Regional Affairs 333 West 4th Avenue Anchorage AK 99501-2341 Alliance Update is published quarterly by the Alliance to Save Energy Nonprofit Org. U.S.Postage PAID PERMIT No.348 Washington,DC.LTAlliance helps to stem budget slide for efficiency programs DOE efficiency budget likely to remain near FY 1996 levels The second session of the 104th Congress en- tered its August recess on a high note for energy efficiency.It appears that appropriations for the De- partment of Energy's (DOE)energy efficiency programs will not continue down the path of se- vere budget cuts begun last year.While DOE's efficiency budget was cut by 28 percent from FY 1995 to FY 1996,indications are that research,de- velopment,and deployment programs will remain approximately level for the coming year. The stabilization of the efficiency budget this year is due to a number of factors,including strong organizing and education by the Alliance,our As- sociate companies,and other like-minded organizations in the Sustainable Energy Budget Coalition. While the House Appropriations Committee slated efficiency programs for another 10 percent cut in the FY 1997 Interior Appropriations bill,key amendments by supporters of energy efficiency were able to raise the overall figure by $24 million,leav- ing the total energy conservation budget at $523 million,a 6 percent cut from last years total. The Alliance worked closely with Rep.David Skaggs (D-CO),Rep.Vern Ehlers (R-MI)and Rep. Ed Markey (D-MA)to fashion an amendment to restore $8 million -$3 million to bolster the se- verely depleted Federal Energy Management Program,and $5 million to replenish hard-hit build- ings programs such as lighting and windows research.The amendment proved strong enough to be accepted by the Interior Subcommittee Chairman Inside this issue The insurance industry is serious about energy efficiency,and with good reason.For a look into the industry's thoughts on energy efficiency and climate change, see the Perspective article on page 4. Alliance Update is published quarterly by the Alliance to Save Energy Ralph Regula.In addition,Rep.John Olver (D-MA), who has in the past been a strong supporter of the Codes and Standards program,was successful in fashioning a $4 million amendment to return some of the lost money to that program.Finally,in a dem- onstration of energy efficiency's renewed strength on the House floor,Rep.Bernard Sanders (I-VT) won a close vote restoring $11.8 million to the Weatherization Assistance Program. In the Senate,efficiency got more positive news. On July 16,the Senate Appropriations Committee reported their version of the Interior bill with an overall increase for efficiency of 3 percent over FY 1996 levels,for a total of $570 million.At press time, the Interior bill has yet to reach the floor in the Senate,and might be pushed off until after the Au- gust recess.It is unclear at this time as to what amendments will be offered on the floor. These events play out against a backdrop of con- sistent support for energy efficiency programs from the Clinton Administration.After requesting an FY 1997 efficiency funding level which largely reflected FY 1995 levels -what would amount to a 25-30 percent increase over last year -the Office of Man- agement and Budget has issued explicit veto threats for the Interior appropriations bill,which cite en- ergy efficiency as a key issue in their dissatisfaction with the bill. In addition to the encouraging news from DOE, Senate staff informed Alliance Chairman Sen.Jeff (continued on page 2) WASHINGTON Use of high-efficiency compressors in household refrigerators saved consumers at least $6 billion in energy costs between 1980 and 1990. The improved compressor design was developed by a private corporation with funding from the U.S.Department of Energy,through Oak Ridge National Laboratory. Refrigerator energy use dropped from about 1,300 KWH per year in 1980 to about 900 KWH per year in 1990. (Source:U.S.DOE Office of Energy Efficiency and Renewable Energy) page 2 Bingaman and co-Chairman Sen.James Jeffords that in this year's appropriations process,the EPA Green Lights and Energy Star programs will not be subject again to outright attempts to eliminate them on the part of the VA-HUD Subcommittee leadership.As we reported last year,a provision to zero out the EPA pollution prevention programs was included in the Committee's bill,and was only removed when Sens.Jeffords and Bingaman mounted support for an amendment to restore the funding.The VA-HUD bills passed by the House and by the Senate Appropriations Committee indi- cate that the "Green Programs”will also receive the same level of funding as in FY '96. One of the most contentious efficiency issues in Congress last year,the ability of DOE to pro- mulgate efficiency standards for lighting and appliances,remains unresolved as Senate floor action approaches.However,efficiency advocates are in a much stronger position at this stage than last year. Last July,a late-breaking Senate compromise placed a one-year moratorium on DOE's ability to put out proposed and final rules on standards.This year,less-rigid report language has been substi- tuted for last year's legislative mandate.Merging the House and Senate report language will likely result in the resumption of the development of new energy-saving measures for refrigerators,clothes- washers,and other consumer products in a revamped and much more inclusive process de- veloped this year by DOE.However,the specter of another moratorium will remain until the bill clears the Senate floor. Alliance President David Nemtzow cited a va- riety of reasons for efficiency's relative success in Congress this year."After last year's big cuts,we knew we had to dig in this time around.The Alli- ance and other efficiency advocates have had success at educating members about the real eco- nomic,environmental,and national security benefits of these programs and developing stron- ger champions in both the House and Senate,”said Nemtzow.(See President's Message,page 3) "We're keeping our Associate companies bet- ter informed and more involved than ever before. Their participation and continued public support are the keys to protecting essential efficiency ef- forts in the future,”said Alliance Director of State and Federal Policy David Hamilton. For more information,contact Dave Hamilton at (202)530-2216 or e-mail to dham@ase.org. Alliance puts African energy efficiency guide on internet TheAlliance to Save Energy has recently com- piled an information guide for anyone interested in energy efficiency or renewable energy issues in Africa.The Energy Efficiency and Renewable En- ergy Resource Guide for Africa is the product of months of work by Alliance staff and is now avail- able on the internet. Like the rest of the developing world,Africa is experiencing an increase in energy demand -high population growth rate and urban migration is causing energy demand to increase faster than it can be supplied.Due to the lack of resources,re- mote areas may never be connected to the grid, while urban areas have increasing power blackouts that disrupt industrial and commercial production. Because of this situation,African governments, international donor institutions and in-country non-governmental organizations (NGOs)have be- come increasingly involved in energy issues.The number of NGOs promoting renewable energy and energy efficiency has increased dramatically,and there are undoubtedly many opportunities for link- age between African and non-African organizations.Few groups realize that there may be other organizations out there working on simi- lar problems. The Guide consists of listings and contact num- bers for more than 300 NGOs (both African and Western),donors,lenders,research groups,re- source centers,training facilities,systems suppliers, industrial energy consumer organizations,and gov- ernmental authorities.There is also information on the projects and programs of these different or- ganizations.The Guide also provides some detailed case studies of selected African countries,their en- ergy situations,and their efforts at improving energy efficiency. The Guide can be found at http:// www.crest.org/sustainable/gem/gemdocs/ase/ index.html.For the benefit of those who do not have access to the World Wide Web,the Alliance is cur- rently working to publish a hard-copy version of the Guide for dissemination in Africa. For more information on the Alliance's work in Africa,please contact Alliance Senior Research Associate Seth Baruch at (202)530-2211 or e-mail to sbaruch@ase.org. Energy efficiency,renewable energy win gold in Atlanta - diverse technologies displayed For the first time a host city has incorporated energy efficiency and renewable energy products into the building and rebuilding done in prepara- tion for a major international competition -the 1996 Summer Olympics Games in Atlanta. The world's finest athletes filled their lungs with cleaner air,rode in non-polluting cars,and relaxed in solar heated saunas thanks to the cooperation of America's public and private industries in Team Energy.The Alliance,in coordination with the Solar Energy Industries Association,promoted Team En- ergy throughout the 1996 Summer Olympic Games. Vice President Al Gore said,"This year,the world's Olympians are competing in a cleaner envi- ronment thanks to energy efficiency and renewable energy technologies.New energy sources are help- ing to power the 1996 Olympics -from the solar-heated Natatorium to alternatively fueled ve- hicles and the super-efficient Energy and Environmental Resource Center.” Although photovoltaic and geothermal heat- source demonstrations may seem extraordinary to some,many countries have already taken advan- tage of these cost saving and environmentally friendly power sources.Atlanta has become the van- guard of utilizing energy saving and pollution preventing technologies in its environment. "The billions of people watching the Olympics were exposed to the most advanced portfolio of so- lar technologies which are here today and practical for use worldwide,”said Scott Sklar,Executive Di- rector of Solar Energy Industries Association. U.S.Department of Energy,primary sponsor of Team Energy,worked at making the Olympics fun, healthy,and efficient."Atlanta will be a showcase for America's best -whether it's Olympic athletes or world-class technologies.[Our]work with manu- facturers to support these innovations and promote a clean environment will score big wins for future generations,”said U.S.Secretary of Energy Hazel O'Leary."What's more,the enormous international market potential for these cost-shared technologies will give the United States a leg up on the competi- tion and create high-wage jobs for American workers,”added O'Leary. A diverse array of other renewable energy and energy efficiency technologies are in use at various sites around the City of Atlanta and the Southface Energy Institute Environmental Resource Center (ECOS). For more information,contact Alliance Media Assistant Kara Saul at (202)530-2203 or e-mail to: ksaul@ase.org. Alliance World Wide Web site now on-line The Alliance introduced its page on the Internet's World Wide Web in June. The site features information about the Alliance's many ongoing projects and publi- cations,breaking news stories,plus links to the Web sites of Alliance Associates and other efficiency-related sites. The Alliance's Web presence is hosted at Solstice,the popular,award-winning internet site dedicated to energy efficiency,renewable energy,and sustainable development.Solstice is visited by over 200,000 people per month from over 50 different countries.Solstice is run by CREST (Center for Renewable Energy and Sustainable Technology),which shares office space with the Alliance. The site is regularly revised and enhanced. For more information,contact Alliance Com- munications AssociateJayWattenberg at (202) 530-2204 or direct e-mail to jay_wattenberg@ase.org. Direct your web browser to http://www.ase.org/ ALLIANCEZNEWS The Alliance,along with the Center for Renewable Energy and Sustainable Technology (CREST)and the Business Council for Sustainable Energy, moved to a larger,more comfortable building just three blocks from our old offices.Our new address is 1200 18th Street,N.W., Suite 900,Washington, D.C.20036.The main phone and fax numbers remain the same as before. Thanks to our interns Payton Deeks,Andy Fahlund,Susan Freeman, Katie Miller,and Andrew Slutter for their dedicated support. page 11 |ALLIANCESNEWS | Leon Panetta's Keynote Address to the Alliance's 1996 Awards Dinner,"An Evening with the Stars of Energy Efficiency,”is considered by many to be one of the best speeches delivered by a political leader on energy efficiency. The text of Panetta's speech is available as an Alliance publication.Call the Alliance to order a copy.The speech is also available on the Alliance web page (direct your web browser to (http://www.ase.org/ panetta.htm). page 10 Leon Panetta delivers Keynote Address at sold-out annual Alliance awards gala White House Chief of Staff Leon E.Panetta ad- dressed the Alliance's fourth annual "Evening with the Stars of Energy Efficiency”in June.The honor- ees included Owens Corning,the United States Department of Defense,and Charles R.Imbrecht, Chairman of the California Energy Commission. Leon Panetta affirms the nation's commitment to energy efficiency in his Keynote Address. Panetta told those assembled that "we must be prepared to fight for the goal of making sure we have an energy-efficient America,that we have a more prosperous America,but more importantly, that we have a better America for our children and the future.” Sen.Jeff Bingaman (D-NM),Chairman of the Alliance,said,"These honorees years ago first rec- ognized the great promise of energy efficiency and began working to ensure that efficiency plays a prominent role in meeting our environmental and economic goals.Because of their efforts,people all over the world are taking advantage of energy effi- ciency as the key to greater prosperity and an improved environment.” Owens Corning,a world leader in advancing energy conservation,is best known for inventing glass fiber insulation nearly 60 years ago.Accept- ing his "Star of Energy Efficiency”award,Owens Corning Chairman and CEO Glen Hiner said, "Owens Corning promotes the value of energy con- servation and the benefits of using fiber glass in- sulation throughout the world.” Alliance president David Nemtzow said that "the Defense Department has been a role model for federal agencies by initiating energy saving per- formance contracts and by using private sector investment to reduce energy costs.” Charles R.Imbrecht,Chairman of the California Energy Commission, is the second ever recipient of the Charles H.Percy Award for distinguished public service promoting energy effi- ciency."Senator Charles Percy was an innovative public servant who inspired me in my own career in elected office.I am honored to receive an award named for this esteemed statesman,”said Imbrecht. The reception and dinner,held in Washington,D.C.,was attended by more than 290 Alliance supporters,in- cluding Associates and other business leaders,federal and state policymakers, and energy professionals. The Honorary Chair of the din- ner was Sen.Charles Percy;Co-Chairs were Susan Maxman,Past President of the American Institute of Architects,and Richard Abdoo,President and CEO of Wisconsin Electric Power Company. The dinner Vice-Chairs were 3M Company, American Methanol Institute/Methanex Inc., Edison Electric Institute,Edison International, Enron Corporation,Fannie Mae Foundation, Honeywell,Lockheed Martin,National Association of State Energy Officials,New England Electric System,North American Insulation Manufactur- ers Association,Ontario Hydro,OSRAM SYLVANIA, Polyisocyanurate Insulation Manufacturers Asso- ciation,Schuller International,Solar Energy Industries Association,and Solar Turbines Inc. Past honorees include Timothy E.Wirth,Pa- cific Gas and Electric Company,Philip R.Sharp, Maurice EF Strong,Arthur Rosenfeld,3M Company, and Mark O.Hatfield. Energy efficiency programs off the critical list by David M.Nemtzow Few changes in Congress have been as dra- matic in the past year as the treatment of energy efficiency. In 1995,it seemed that -according to the rhetoric of some Members of Congress -fed- eral energy efficiency programs bore the entire responsibility of balancing the federal budget. DOE's efficiency programs were slashed by 28 percent below the previous year's level and the House of Representatives endorsed language call- ing for a complete end to DOE's efficiency programs within three years.The House passed an amendment to impose a yearlong moratorium on DOE's authority to set efficiency standards for appliances.The Senate debated eliminating EPA's Green Lights and Energy Star programs.Lan- guage was added to other legislation prohibiting the government even from labeling the efficiency of automobile tires. By contrast,this year energy efficiency is be- ing embraced both by key Republican Members of Congress and the Democratic administration as a leading means to protect the environment in an economically sustainable manner.Although spending and other legislation is still pending at this writing,the reversal in fortunes is well un- derway.(See cover story for additional details.) Three different amendments to trim the efficiency cuts were adopted in the House and the Senate Appropriations Committee has recommended a 3 percent increase in DOE's programs.And while language to limit DOE's ability to set efficiency standards remains under consideration,there has not been the wholesale onslaught on the federal government's authority that we saw last year. In addition,the Clinton administration re-. cently issued two veto threats on legislation that insufficiently funds efficiency programs. There are several reasons for this change in fortunes.One,the Alliance,our Associate com- panies,and many others have worked hard to educate members of Congress about the eco- nomic,environmental,and other benefits of federal efficiency programs.While many in Con- gress remain uninformed or skeptical about energy efficiency,many more have learned about the success of public-private partnerships to bring new technologies into the marketplace.Two,af- ter last year's government shutdowns,both sides now recognize that most Americans do not want the government's plug pulled,but an assurance that their dollars are being well-spent;this new attitude has encouraged both sides to find com- mon ground on numerous issues. Three,and most important,has been the as- cendancy of support for environmental protection.Elected officials of both parties are determined to demonstrate their support for the environment as poll after poll reconfirms the broad support for environmental quality by the American public (see Alliance Update,Vol.VII, Issue 1,1996).Furthermore,Americans strongly support environmental programs when they per- ceive that the environment is "under attack”,as many concluded was the case following efforts in 1995 to dismantle or weaken clean water,air, and energy programs.This has led to a height- ening of the political stakes over environment in the nation's capital -the President wants to dem- onstrate the strength of his commitment to the environment,and Republican leaders are deter- mined to show that they are not attacking environmental programs.This "bidding war”over environmental credentials has played to the ben- efit of energy efficiency and other clean energy sources,as we have seen from the recent actions. Of course,legislative,political and budget- ary support for energy efficiency while necessary is far from sufficient.Federal efficiency programs must deliver results -technologies,informa- tion,standards,consensus and,most importantly, savings -on-time and on-budget.Otherwise efficiency's great promise and recent advance- ments will wither. The Alliance is working to broaden our base of support to include important new players,such as the insurance industry,which is increasingly recognizing the value of efficiency in combating global climate change (see page 4).We are in- creasing our efforts to explain to the American public the importance of energy efficiency.Most importantly,we will continue to work with en- ergy efficiency companies,advocates and others to continue to educate members of Congress about the enormous benefits of energy efficiency to our environment and our economy. PRESIDENT,3MUETSTS¥ANG ES Despite the persistent notion that all pro- environmental initiatives are,by definition,anti- business,the truth is that most energy efficiency programs enjoy broad corporate support. -Norman Augustine, Chief Executive Officer of Lockheed Martin Corporation and Board Member of the Alliance to Save Energy page 3 If climate change is a real threat,insurers will be among the largest stakeholders facing major losses from its potential effects. -Eugene Lecomte, President of the Insurance Institute for Property Loss Reduction page 4 Energy efficiency and the insurance industry by Eugene L.Lecomte For the first time in its history,the insurance industry is encountering energy efficiency as an issue that might affect its future.In the past,there has been no reason for property insurers to think about energy efficiency in the buildings they in- sure.Property insurance risks came from other sources:fire hazards,safety risks,structural weak- nesses,or vulnerability to storm and flood damage.ITPLR is dedicated to reducing losses - deaths,injuries,and property damage -result- ing from natural hazards.We conduct applied research and develop implementation strategies designed to reduce these kinds of losses so that property owners and insurers alike enjoy lower risk and lower insurance costs. Energy efficiency is an emerging issue for the insurance industry in part because of a growing concern about global climate change.ITPLR ac- knowledges the growing body of evidence, developed in the Intergovernmental Panel on Cli- mate Change and other bodies.We also recognize the uncertainties about climate change -the hard proof of causality,the accuracy of modeling prediction,the nature,timing and severity of impacts,and the appropriateness and cost-effec- tiveness of mitigation responses. The insurance industry has long relied on hard data for its research,and has developed the most sophisticated tools possible for evaluating risks.Comparable tools having the precision to evaluate the risks of climate change have not been developed,but the evidence is being examined.If climate change is a real threat,insurers will be among the largest stakeholders facing major losses from its potential effects.In the last de- cade,the property insurance industry has absorbed major losses from natural disasters,in- cluding Hurricanes Hugo and Andrew,the Mississippi floods of 1993,and the 1993 Califor- nia wildfires.Almost half of the natural-disaster property losses in the last 40 years have occurred since 1990.While there is no proof that these losses are due to climate change,their magni- tude has given urgency to the need for an understanding of the cause. Given the remaining uncertainties and the wide range of possible responses,what can the insurance industry do now on climate change? One area where the issues of property losses,natu- ral disasters,and energy efficiency converge today is in building codes.IIPLR spends much of its time and resources on the development,adop- tion,and implementation of improved building design and construction methods.For example, IIPLR conceived the Building Codes Effectiveness Grading Schedule,which is in the process of rat- ing the building code enforcement effectiveness of every community in America by the year 2000. Where practical,IIPLR will lend its support to energy efficiency in building codes as part of our ongoing efforts to produce lower-risk build- ings.Many energy efficiency technologies have direct property loss reduction benefits:attic in- sulation and ventilation can reduce ice-damming problems;wall and floor insulation can prevent frozen pipes;and double-glazed windows can re- duce losses from fire,wind,and theft.We also believe that energy efficiency in building codes is cost-effective in its own right.That means that even if climate change does not prove to be as great a risk as some predict,homeowners and our economy will be better off with improved building codes. IIPLR encourages the adoption and enforce- ment of cost-effective energy codes at the national, state,and local levels.In particular,we support the use of recognized model codes such as the Model Energy Code of the International Codes Council. Increasing energy efficiency in building codes is an important first step for the insurance in- dustry in responding to the climate challenge. IIPLR plans to work with the Alliance to Save Energy to explore other ways to promote energy efficiency as a cost-effective hedge against the risks of climate change. Eugene Lecomte is President of the Insurance Institute for Property Loss Reduction in Boston,Massachusetts. BCAP convenes first National Energy Code Support Network meeting in Ohio The Building Codes Assistance Project (BCAP)recently convened a meeting in Colum- bus,Ohio,to establish a network of private and public interests to increase the availability of en- ergy code compliance training and support to the States. Nearly 40 supporters of energy efficiency in construction,business and industry,federal and state governments,energy efficient builders and consultants,and model code organizations at- tended the July 17 kickoff meeting of the National Energy Code Support Network.The organization will identify states'training and technical sup- port needs and coordinate the delivery of training and assistance where needed. Alliance Associates in attendance at the meet- ing included Andersen Windows,the Polyisocyanurate Insulation Manufacturers As- sociation,the North American Insulation Manufacturers Association,CertainTeed,D &R International,Owens Corning,Schuller Interna- tional,and the Society of the Plastics Industry. BCAP has worked actively over the past year and a half to support the adoption of current na- tionally-recognized energy codes in states where none exist and the revision of outdated energy codes in other states.States have reported that they lack both the resources and the informa- tion to provide comprehensive code training and technical support for builders,code officials,and design professionals.Further evidence for com- prehensive and widespread state energy code support is seen by recent activities to roll back or repeal energy codes in several states. The U.S.Department of Energy (DOE)has provided considerable support to states for en- ergy code training.DOE,through the Pacific Northwest National Laboratory (PNNL),has de- veloped energy code compliance software, manuals,and other code training materials,and has conducted "train-the-trainer”sessions for builders and energy code officials.This support is critical but has not yet met the overwhelming needs of the states.Diminishing federal funds for energy codes in general,and code training in particular,could compromise a significant source of information on current energy codes. Nonetheless,there are a number of stake- holders who have an interest in energy-efficient building codes and practices and may have per- sonnel,funds,in-kind services,or information resources that could be used to assist states in providing energy code training and technical sup- port. Some industry trade organizations,such as the National Association of Home Builders and the North American Insulation Manufacturers As- sociation,have developed energy code compliance manuals and conducted training seminars of their own,primarily targeted to builder and contractor audiences.Other enter- prises,such as Southface Institute and AEC,have created compliance materials,software,and train- ing packages that are currently available. Recognizing the potential for coordinated ac- tion,BCAP pulled together these and other key stakeholders in the building and energy efficiency communities to leverage the many resources of business and industry,trade and professional or- ganizations,federal and state governments,and others.The network's goal is to draw on existing energy code training materials and technical sup- port resources developed by PNNL and others to satisfy the states'energy code support needs and to facilitate the rapid delivery of quality energy code training and technical support to builders, building code officials,and design professionals within those states. The successful kickoff meeting resulted in immediate industry support for efforts in Massa- chusetts to revise the current residential energy code to meet the 1995 Model Energy Code,and continued efforts in Ohio to fend off a code re- peal effort initiated by the Ohio Homebuilders Association. In August,BCAP will distribute to the par- ticipants (and other interested parties not in attendance)a list of specific training and sup- port needs and the key states currently in need of such assistance;responses from the Network organizations will include the capabilities of each to provide code compliance training,technical support,and in-kind services such as printing or meeting sites and the priority states for each or- ganization. The Network is eager to expand;for more information,contact Kate McQueen,Executive Di- rector of BCAP,at (202)530-2221,or e-mail to: kmcqueen_bcap@ase.org. BLUJTLLYDTILNLGIS Renew America is currently accepting applications for the National Awards for Environmental Sustainability.The Alliance is a member of the National Awards Council,which helps to recognize 25 outstanding programs each year. Award categories include energy efficiency, renewable energy and 24 other environmental issues. Applications are due September 15,and are available by contacting Renew America at (202) 232-2252 or renewamerica@igc.apc.org. Renew America's Web site is located at http:// solstice.crest.org/ renew_america/. paged. Energy bills are the single largest homeowner expense after the mortgage payment itself.More energy efficient housing can lower energy bills by one half -helping homeowners pay their bills while saving our natural resources.[The Alliance's Energy Efficiency Financing Guide]can help lenders tap into this enourmous and profitable market. -Secretary of Energy Hazel O'Leary oS page 8 Alliance publishes ground- breaking guide to Energy Efficiency Financing The Alliance recently released Energy Effi- ciency Financing:A Lender's Guide for Taking Advantage of This Emerging Market.This cut- ting edge publication will encourage lenders to factor in the impact of lower utility bills on hous- ing affordability by providing the information necessary to get high returns from moderate in- vestments. "Few lenders are aware of the existing en- ergy financing mechanisms as well as new conventional and Federal energy-efficient mort- gage programs,”said Alliance Director of Research Malcolm Verdict."This new publication provides the information necessary for a lender to take advantage of this profitable lending mar- ket.” Energy-efficient homes enable home buyers to qualify for larger loans,and benefit lenders through increased loan volume and decreased risk.Two percent can be added to typical mort- gage qualifying ratios for homes meeting minimum building code energy efficiency re- quirements.This qualifying technique,little known to lenders,is clearly pointed out in En- ergy Efficiency Financing,along with many other useful ideas for lenders. Electronic ballasts,from page 5 of technology development and demonstra- tion projects,building awareness of the economic viability and energy efficiency po- tential of high frequency electronic ballasts. At the same time,manufacturers were launch- ing initiatives to find component manufacturers who could meet the required standards. In the early 1980s,energy efficiency ad- vocates were working at creating the demand for energy-efficient products through fledg- ling utility demand-side management (DSM) programs.Initially,the utilities were unconvinced of the reliability of electronic bal- lasts.Because electronic ballasts provided a significant improvement in energy efficiency over electromagnetic ballasts,manufacturers recognized the major economic opportunities. The prospect of utility DSM programs,with "Energy Efficiency Financing is the first comprehensive guide to emerging federal,private and secondary,and utility energy financing pro- grams since the early 1980s,”said Alliance President David Nemtzow."I am proud that the Alliance has taken steps to show that understand- ing energy efficiency's benefits can help the most educated lender build their profit margins.” Fannie Mae's Chairman and Chief Executive Officer and Alliance Director James Johnson en- dorsed the new book in the introductory letter, seen on the inside cover. "This Lender's Guide to Energy Efficiency Fi- nancing provides useful information about energy efficiency mortgages and loans --financial prod- ucts you can offer that increase housing affordability,expand your business,help protect the environment and reduce our nation's grow- ing dependence on foreign energy supplies,”said Johnson. The guide is available for $15.00 each from the Alliance to Save Energy. For more information,contact Alliance Di- rector of Research Malcolm Verdict at (202) 530-2213 or e-mail to mverdict@ase.org. their stable,long-term funding,was enough to convince manufacturers that the demand for the product was real.As manufacturers improved the ballasts,DSM programs started "rebating”the technology.This coalescing allowed the electronic ballast industry to de- velop and mature into the industry we now have today. There are now 108 million high frequency electronic ballasts installed in the United States,saving consumers some $690 million per year.Electronic ballasts,when matched with the appropriate lamps,are now twice as efficient as the original fluorescents,and 3.5 times as efficient as today's incandescent lamps. For more information,contact Alliance Program Manager Gene Foley at (202)530- 2224 or e-mail to gfoley@ase.org. High frequency electronic ballasts -the development of an energy efficient technology The high frequency electronic ballast has been hailed as one of the great energy-efficient technologies in recent years.There has been a sharp rise in its usage,enabling lighting systems to be up to 40 percent more efficient.However, there has also been a certain amount of contro- versy as to how this technology was developed. Both manufacturers and the U.S.Department of Energy (DOE)have claimed credit for its "inven- tion.”Research at the Alliance has shed some new light on the development of this important tech- nology.To paraphrase a popular expression,it took a whole community to build a better bal- last. The development of fluorescent lamps and ballasts are inextricably linked.Fluorescent lamps and ballasts were developed in the early 1930s. As opposed to incandescent lamps in which light output is directly determined by current passing through the lamp filament,fluorescent lamps rely on an electrical arc passing between two elec- trodes,thus exciting mercury atoms,in turn causing phosphors inside the lamp to glow. The lamp's ballast is the control device which regulates the power to fluorescent lamps.Ballasts are needed to provide the proper voltage to es- tablish the arc and regulate the electric current flowing through the lamp in order to stabilize light output.It is the stabilization aspect of the ballast that earned its name,much like the bal- last in a ship. The first ballasts were electromagnetic de-vices containing a core of steel plates surroundedbycoppercoils.Fluorescent systems were 5 times more efficient than existing incandescent lights. However,the system could,by today's standards, be made more energy efficient. At the same time that fluorescent lamps and electromagnetic ballasts were being developed, researchers at the General Electric Company noted that applying high frequency current through the fluorescent tube produced more light per unit of energy input.However,the technol-ogy to mass-produce a ballast capable ofdeliveringhighfrequencypowerwasundevel- oped,while the 60 Hz systems were relatively easy to make. The earliest attempt at powering a lighting system with high frequency current was in 1951 by General Electric,using a rotary motor alter- nator which would control the entire building's lighting power.It converted line voltage (60 Hz) to 400-2,000 Hz.This technology never gained market acceptance -the system was expensive, requiring large pieces of machinery installed in the building,and electric power was relatively cheap and plentiful at that time.The first electronic ballasts for general light- ing applications were introduced by Triad (now part of MagnaTek,Inc.)in 1968.This new bal- last replaced electromagnetic with solid-state components,which increased the efficiency of the ballast and produced virtually no hum.Electronic ballasts regulate power at high frequency,which significantly increases efficiency of the lighting system that it operates. Though the original idea was sound,the quality of the components failed to meet the life expectancy standards set by existing electromag- netic ballasts.A number of other manufacturers were working on electronic ballast design at the same time,but none were successful in creating a reliable system.As a result of these problems,a basic mistrust of the electronic lighting technol- ogy grew within the electrical industry.People were comfortable with electromagnetic ballasts -it was a proven,widely used,and reliable sys- tem.Early electronic ballasts simply could not deliver this kind of performance. A number of forces were in play during the early 1970s prompting the continued develop- ment of the electronic ballast.The first major oil crisis certainly brought energy efficiency to the forefront of American thinking.With this moti- vation,industry,energy efficiency activists,and DOE each mounted considerable effort to over- come the problems and help develop parts which met the requirements to "build a better ballast.” The important thing to note here is that no- body had to make any great technological breakthrough.The two main tasks were to de- sign the right level of quality into the components and to simplify the circuit design.John Munganast,editor of Power Quality magazine, one of the advocates of this technology,noted in a recent conversation,"It was sort of like trying to coordinate a three-ring circus.”Component manufacturers would invest in the machinery to build ballast-grade components only if they had a guarantee that somebody buy the components. In 1977,the Energy Research and Develop- ment Authority (a predecessor to DOE),through Lawrence Berkeley Laboratory,launched a series (continued on page 8) TECHNOLOGY Since 1977,shipments of high-frequency electronic ballasts have risen from almost zero to nearly 40 percent of the ballast market. The development of the high frequency electronic ballast,through the combined efforts of industry,government and efficiency advocates, contributed significantly to the 50%efficiency improvements that have been achieved in fluorescent lighting systems. (Source:Alliance to Save Energy) page 5 Insulation currently installed in our homes, buildings,and factories saves about 1.6 trillion pounds of CO,emissions each year.This means that without insulation, our national CO, emissions would be 14 percent higher. -Ken Mentzer, Executive Vice President of the North American Insulation Manufacturers Association oO page 6 Insulation industry facing global climate change head-on The following is an interview with with Ken Mentzer, Executive Vice President of the North American Insu- lation Manufacturers Association (NAIMA). Alliance Update:What do you think of the administration's new climate change initiative an- nounced in Geneva this week?[ed.note:At the July 1996 meeting of the Intergovernmental Panel on Cli- mate Change,the U.S.government for the first time called for binding emission reduction targets for green- house gases.] Ken Mentzer:I think the U.S.realized that without some sort of solid targets not very much would be ac- complished in reducing emissions.We believe that the US.has the technologies in energy efficiency and renewables that can meet the climate challenge in a market-driven manner.These technologies,including improved insulation of buildings and industrial pro- cesses,create economic benefits on their own merit,on top of their environmental benefits. Alliance Update:Does that imply that you don't think that heavy-handed "command-and-control”regula- tions will be needed? Ken Mentzer:I don't think that's in the cards.I think that investments in efficiency and renewables can hap- pen without a lot of regulation.Give the private sector the targets and we will figure out how to hit them.I think there'll be a balance between "hard”emission targets,and market-driven approaches.The market- driven approach will focus on measures that provide the greatest benefits -both economically and envi- ronmentally.And they will vary from economy to economy. Alliance Update:Tell us about the insulation industry. How big is it? Ken Mentzer:NAIMA represents manufacturers of fi- berglass,rock wool and slag wool insulation materials in the United States,Canada,and Mexico.In these three countries,there are over 50 plants that produce insula- tion materials.They employ well over 10,000 people, and support 20,000-30,000 more jobs in the installa- tion/application area.NAIMA members'production accounts for a majority of total insulation industry production. Alliance Update:NAIMA is completing a study on the net energy and environmental benefits of insulation. What do you see as the significant findings from that study so far? Ken Mentzer:In that study our project team surveyed the members of NAIMA to determine the production of their plants,the energy used in manufacturing,and the energy saved by the products when installed.What we found is that,on average,for every BTU used in the production of the insulation,12 BTUs were saved in the first year of use.Over their lifetime,insulation prod- ucts save more than 300 times the energy used to produce them. Putting these numbers in environmental terms,the insulation currently installed in our homes,buildings, and factories saves about 1.6 trillion pounds of CO, emissions each year.This means that without insula- tion,our national CO,emissions would be 14 percent higher.The study has also told us that if we improved insulation in new buildings and industrial facilities to the levels recommended in national model codes and economic analyses,we could save another 293 billion pounds of CO,emissions each year. Alliance Update:As we noticed in Geneva recently, there is significant industry opposition to climate change action.The argument is that action on climate change is going to cripple the economy,cost jobs and weaken our competitiveness.Yet from the study we just dis- cussed,it is clear that some industries will contribute to the solution while supporting economic growth and jobs.What's your perspective on that issue?How do you think climate change action at the policy level will effect the insulation industry? Ken Mentzer:We believe that in a market-driven cli- mate change policy,energy efficiency and renewable technologies,in which the USS.is a world leader,create a number of benefits.Homeowners save money on energy bills,manufacturers reduce the energy compo- nent and cost of their products,and new jobs and economic growth are generated through investment in these technologies.Lower energy costs for product manufacturers make them more competitive in the global economy. Alliance Update:Given that NAIMA members are manufacturers who use substantial amounts of energy in their production processes,what is the industry do- ing to improve its own energy efficiency and reduce its own greenhouse gas emissions?Does the study that show any improvements in the efficiency of NAIMA- member plants compared to the 80s? Ken Mentzer:The industry has done a significant amount to improve its energy efficiency over the last ten years.Two notable examples are the use of recycled materials and improved manufacturing processing. Our fiber glass plants in 1994 used almost 900 million pounds of recycled glass,and that number continues to increase.The process improvements in our member plants have reduced the energy used per pound of prod- uct by 17 percent between 1983 and 1993. Alliance Update:What does that recycled glass content represent as a portion of the total raw material input? Ken Mentzer:It varies from manufacturer to manu- facturer,but the industry average now is up to 30 percent recycled glass.And some production facilities use over 40 percent recycled glass for their inputs. Alliance Update:So,it sounds like insulation manu- facturers are able to keep profitable making an energy saving product while becoming more energy efficient themselves. Ken Mentzer:The trend is certainly in that direction and we expect it to continue. Alliance Update:Perhaps this is an example that other manufacturers can take heart from as they face the climate challenge.I want to move to insulation prod- ucts and applications.Some people may not know where insulation is used.Where does most of the insu- lation go now and where do you see most of the potential benefits from new applications of insulation? Ken Mentzer:The largest application for insulation in the U.S.is in buildings,led by the residential sector. Advances in that area include new high performance products such as R-15 and R-21 batts.These give you higher efficiency performance in the same space. Alliance Update:Does that mean a builder wouldn't have to change the way they build a wall in order to get more energy efficiency? Ken Mentzer:That's right.A builder has a lot of options available to him for improving the energy efficiency ofa wall with available technology and materials. Alliance Update:How do the R-15 or R-21 products compare to other product types? Ken Mentzer:You would compare an R-15 batt to the original R-11 batt;both fitin 2”x 4”stud walls,but the R-15 saves about 35 percent more energy.An R-21 batt compares to an R-19 product;they both fit in a 2”x 6” stud wall,but the R-21 saves 10 percent more energy. There are also new techniques available for insulating basement and foundation walls and,of course,con- struction techniques for improved ceiling insulation. These techniques are well understood and easily ap- plied in the building sector. Alliance Update:What about the industrial insulation picture?Where are the applications now and where's the potential? Ken Mentzer:In industrial applications,our products are mainly used on high temperature steam and fluid lines and vessels.We have seen from field experience that the potential there is significant,particularly in process heating areas where there is little or no insula- tion.These pipes and vessels should be insulated to an economic thickness;we have a computer program called 3-E Plus available to calculate that.It can show an industrial user,based on his economic conditions, the most cost-beneficial level of insulation. Alliance Update:Is that available free to energy users? Ken Mentzer:It's going to be available through the Department of Energy on the internet;and we have that program available for purchase through NAIMA. Alliance Update:Are there other kinds of technical assistance materials available that people should know about through NAIMA? Ken Mentzer:Yes,indeed.We have a lot of material -for example,we can provide you information on howto comply with the residential Model Energy Code, and we have materials that allow people using pre- engineered metal buildings to be able to comply with ASHRAE Standard 90.1. Alliance Update:What are your views on the potential policies,programs,or incentives that the U.S.govern- ment or state governments might want to pursue in response to the climate challenge? Ken Mentzer:I have a number of thoughts:First,we ought to have minimum energy efficiency standards in our building codes.Training and education is an important part of understanding energy efficiency op- portunities,so along with those codes,we ought to provide a mechanism to insure that building officials and building trades people understand these codes and the applications of energy-efficient measures. (continued on page 12) Tey yen ay=\05aA S{P,0 iTILI1;Gi HAT, If we improved insulation in new buildings and industrial facilities to the levels recommended in national model codes...we could save another 293 billion pounds of CO, emissions each year. -Ken Mentzer, Executive Vice President of the North American Insulation Manufacturers Association page 7. Energy Report Page 4 News and Work Zs,in ProgressBEE Environmentally Sustainable Technologies Tellus institute has been working for the New England Governors'Conference,Inc. to assist in a joint project for the six New England states.We have assessed the possible impacts of electric utility industry restructuring on the development of envi- ronmentally-sustainable technologies in the region,and designed specific policy recommendations to the states regarding regulatory and other governmental pro- grams that would promote and support these technologies in the future. Renewable Resource Portfolio Standards Tellus'Energy and Environment program staff have been undertaking quantitative explorations of renewable resource portfo- lio standards for the U.S.and various re- gions,using the DOE/EIA National Energy Modeling System (NEMS)at Tellus.This work is producing estimates of the national and regional renewables mix and electric- ity price impacts that would result from meeting targets for renewables.In addi- tion,we estimated the carbon emissions impacts,and the trading price of renew- ables certificates.We examined targets that approximate that of the Schaefer bill which requires 4%of generation be non- hydro renewables by 2010.For informa- tion,contact Max Duckworth. Gas Work In Maine Tellus recently assisted the Maine Public Advocate in evaluating the reasonable- ness of the capacity acquisition strategy proposed by Northern Utilities (NU),the gas local distribution company serving Maine and New Hampshire.NU entered 20-year precedent agreements for a LNG service from a proposed 2 billion cubic feet LNG tank and for FT service from the pro- posed Portland Natural Gas Transmission System pipeline.In these agreements,NU subscribed for more than twice the capac- ity required to serve its sales customers. Testimony of Tellus witnesses Rick Hornby and Dr.Alex Rudkevich convinced the Maine Public Utilities Commission that the Company's proposed contracts were not reasonable.For information,contact Dr.Rudkevich. "Measuring Market Power"continued from page 3 power analysis of an electric utility "Leveraging --The Key to the Exercise merger should appropriately recognize of Market Power in a Poolco,"June, these distinct sub-product markets.1996) The relevant geographic market should Finally,in the FERC testimony,TellusbedeterminedprimarilybyadetaileddiscussedwhytheconventionalHHItestanalysisof trans-7a rer:used by the DOJ/mission costs,phy-The major limitation of the HHI Ftc in ail industrysicaltransmissionjsthatitismathematicallymergercasesisfarconstraints(in the incapable of taking the unique too simplistic a testshort-and long-run h ogi .to be able to F lgcapacitymarkets),characteristics of the electric adequately measure and the generating industry into account.market power in the capacity available Qt NNN fectricity industry. different locations that can actually The HHI is calculated by simply sum- compete.Existing or potential "load ming the squares of the market shares of pockets”should also be analyzed.Load all firms in a particular market.The pockets exist when,due to transmission DOJ/FTC concentration criteria consider system limitations,certain generation a market to be "unconcentrated"if its units must be operated within a particular HHI falls below 1,000,"moderately con- region in order to continue the provision centrated"if its HHI lies between 1,000 of reliable transmission service.The and 1,800,and "highly concentrated"if strategic location of these generation its HHI is in excess of 1,800.While units relative to the transmission system these breakpoints might be appropriate create an inherent potential for abuse of for interpreting the significance of HHI market power.values for other industries,there is no evidential basis for applying the same A market power analysis must also ac-criteria to the electricity industry. count for likely future changes to the electricity industry structure.Traditional The major limitation of the HHI is that it is market power analyses have considered mathematically incapable of taking the only wholesale transactions,but should unique characteristics of the electric in- now also analyze the potential impacts of |dustry or its changing structure into ac- retail competition.The implications of count.For example,there is no theoreti- how a retail competition scenario,where cal basis for squaring each firm's market the merged companies'generation as-share.Also,the HHI for one sub-market sets would be divested into a single,un-can not take into account how that sub- regulated "genco,"might impact market market interacts and affects other sub- power is extremely important to consider markets,since in the electric industry, because retail generation prices,which sub-markets do not operate in isolation would be unregulated,would be subject from each other.The index has no to possible market power abuse.In "cross-terms"to account for these ef- addition,where relevant,a market power fects.Tellus recommended that as an analysis should consider the potential alternative to the HH!,new and more so- establishment of a poolco structure,be-phisticated indices to measure market cause when electricity is dispatched and power in the electric industry must be sold through a poolco structure,there is developed.Tellus also suggested that a likelihood that leveraging (market simulation modeling of electricity markets power)will occur to enhance market may be required to accurately measure power.(See Tellus paper titled market power. "by Julie Michals Tellus Progress on Market Power Tellus has developed a mathematical proof that the equilibrium or profit maximizing state of a pure pootco will imply market clearing price signficantly above competitive levels.Competitive bids would be those based strictly on the generation owner's variable costs of production,except in relatively few peak hours.Tellus is currently extending this research to bilateral contract markets for generation,as well as to mixed poolco/bilateral market structures.For further information,contact Dr.Rosen. ot og "==ENERGY REPORT winwivaialVolume 4,Number 2 November 1996 e MPR =RoE Seaiid:SATS SERRE, i Tellus at Twenty =| Twenty years ago,Energy Systems Re-linkages between the building and operat-IN THIS ISSUE... search Group was incorporated as a non-ing of utility systems,and efficient,fair profit research organization.In 1990 we ways of reflecting those costs in the rates Tellus at Twenty,p.1becametheTellusInstitute.From the be-charged to energy users.We assisted ginning,our work aimed to inform debates energy planners in developing countries on resource planning,regulation,and policy by designing a new model linking energy issues.Our approaches were often new,demand,resource supply,and costs and Carbon Taxes,p.1 Natural Gas in Florida,p.3 Market Power,p.3 and our results sometimes controversial.transferring it to many energy ministries.News &Works,p.4 In one early line of work,we developed a Early sponsors of our work included na-Please send comments to: disaggregated end-use model that fore-tional laboratories,consumer advocates,Amy DiBiaso,Editor ;.ape ve :Email:atrin@tellus.comcastedhalfthegrowthinelectricitydemand_utility commissions,energy and environ-Tellus Institutethatutilitieswerethenforecasting.When mental offices,national and international 11 Arlington Streetourforecastswereputintoevidenceinagencies,and environmental organiza-Boston,MA 02116 regulatory proceedings on the need for nu-__tions.Later,our work was supported by (617)266-5400 clear plants,our staff quickly learned what it additional government agencies,utilities,www.tellus.com means to provide expert testimony in con-private businesses,and a growing num- tested adversarial hearings.Those early _ber of foundations. forecasts later proved to be much more ac- curate than those of utilities at the time.Since the late 1980s,Tellus Institute's ac-Tellus Institute is a non- The same was true in the field of power _tivities have expanded to include the Risk profit research and plant economics,where our higher cost and Solid Waste Groups (pollution pre-consulting organization projections for nuclear units also proved vention;waste reduction;recycling;water that has performed over much more accurate.and industrial eco-efficiency)and to host 1,600 studies of energy the Stockholm Environment Institute--and the environment We pioneered the cost-benefit analysis of Boston Center (sustainability;en-since 1976.Tellus energy plans,integrating supply resources ergy/environment;and development).addresses energy,risk, (traditional and renewable)with demand-Tellus remains committed to a growing solid waste,and interna- side resources (load control,conservation).program of high quality technical and tional aspects oftheseWealsostudiedtheemploymentandenvi-policy analyses that can contribute to issues.For more ronmental impacts of energy technologies.sustainable and equitable resource information,contact Dr.Through ratemaking studies,we refined strategies for the next century.Richard Rosen,Director of the Energy Group. Ecological Tax Reform: A Case Study of Carbon Taxes in New York T ellus has completed a study of ecological tax reform in New York State that examines the impacts of carbon taxes at $10,$30,and $50 per ton of CO2 on the state's energy sector and economy.This study,funded by Energy Foundation,John Merck Fund,and Wallace Foundation,explores a novel policy strategy that promises to combine environmental improvement with the maintenance of economic vitality. It has long been argued that pollution taxes,by sending price signals to producers and consumers,can be an effective and economi- cal means of reducing pollution and its harms.By combining pollution taxes with corresponding reductions in other taxes,keeping total tax revenues constant,there would also be a diminution in the disincentives to productive economic activity arguably caused by these taxes.Thus,ecological tax reform combines faxing of "bads,"such as pollution and overuse of natural resources,and reducing taxes on "goods,"such as work,investment,and consumption.Of course,the tax system serves other purposes that must be main- tained,including provision of public goods and services,distributive equity,and a social safety net.Any ecological tax reform must work within the constraints,in magnitude and structure,required to meet these other important societal objectives. continued on page 2... Energy Report Page 2 "Ecological Tax Reform"cont'd from page 1 Issues that would need resolution in a specific tax reform design,rather than the indicative one used here for study,include maintaining progressivity in the overall tax structure,preventing exodus of specific businesses,which might be cost sensitive even at the low cost impacts estimated here,and providing transitional help to businesses,workers and communities through public investments in technologies, education and infrastructure.This might make the tax reform no longer strictly rev- enue neutral,to the extent that additional programs would be created to meet these goals. We have focused on carbon as a candi- date for ecological tax reform because:(1) global climate change poses a serious threat,and thus reduction of carbon diox- ide emissions is an international commit- ment of the U.S.;(2)carbon is a reason- able proxy for other energy-related pollu- tants that affect human health and the en- vironment;(3)it would provide a large, ubiquitous,and relatively stable source of tax revenue;and (4)compared with other pollutants,it is relatively easy to monitor and measure. -Ecological tax reform combines taxing of "bads”such as pollution and overuse of natural resources,and reducing faxes on "goods"such as work, investment,and consumption. ee We have focused on the state level be- cause ecological tax reform can help meet state policy goals:(1)states must meet federal environmental standards through State Implementation Plans,and have en- vironmental goals of their own;(2)deregu- lation of the energy sector could create "stranded benefits,"i.e.,a loss of environ- mental protection with the decreases in utility DSM and renewables requirements, and externalities protocols;(3)states are seeking opportunities for tax reform to compensate for shrinking tax bases and to simplify existing discretionary economic development incentive policies.States can be "laboratories"for innovative policies that can later be adopted at the federal level. States that act early have an opportunity to get ahead of the curve by bringing in new marketable technologies in advance of more stringent regulation. Approximately half of the $30 billion state tax revenue in New York is from personal income taxes;the remainder is from sales, gross receipts,and corporate income taxes.Local taxes provide roughly another $30 billion in revenue,with about two- thirds from property taxes and the rest from sales and personal income taxes. Thus,state personal income,corporate income and sales taxes,along with local property taxes,are candidates for rate reductions in an ecological tax reform package.A carbon tax of $10/ton COz2 would raise approximately $2 billion and a $50/ton CO2 tax approximately $10 billion. Even at the high level tax,only one-sixth of all state taxes would be shifted from businesses and households to carbon. In our scenarios,we reduced household in- come,and sales and business taxes corresponding to the carbon tax revenues. To be sure,the carbon taxes are ultimately borne by businesses and households,but the tax burden would fall on energy and energy intensive goods,rather than on labor and investment.This would entail desirable responses,such as shifts to cleaner,more energy efficient technologies,and less fuel use,as well as leaving a greater share of incomes for the consumption of other goods and services. We found that for a $50 dollar carbon dioxide tax there would be:(1)lower carbon emis- sions by approximately 18 percent by the year 2012 than they would otherwise have been,owing to energy efficiency invest- ments,fuel switching,and reduction in use of energy services;(2)higher overall produc- tion output by approximately three billion dollars (0.5%)per year;(3)higher overall employment by approximately forty thousand jobs (0.5%)per year;(4)no change in overall private production costs.In an alter- native scenario,we shifted one-fourth of the carbon tax revenues into energy efficiency investments,and achieved about 25 percent carbon dioxide reductions with economic impacts virtually unchanged. Of course,there would be important dif- ferences from these statewide averages by industry and region;some would see net cost increases,others net cost de- creases.Likewise,some_industries would increase their output and employ- ment while others would decrease them. But it is noteworthy that even in the high tax case,out of several hundred indus- tries,only a handful would experience cost increases on the order of 5 percent. The large majority of industries would see small cost increases or decreases on the order of less than one percent. We conclude that a CO2-based ecologi- cal tax reform would likely (1)help meet our state and national climate policy goals;(2)contribute to significantly im- proved local,state,and regional envi- ronmental quality and public health;(3) provide opportunity for consistent state economic development policy by creating a wholesome general business climate and by yielding revenues to modernize infrastructure and improve labor skills;(4) cause investment in clean technologies; (5)foster technological progress and the development of niche markets;and (6)assist communities in economic transition. by Dr.Irene Peters &Dr.Steve Bemow Industrial Initiative Takes Off Since Tellus announced its Indus- trial Eco-Efficiency (E2)Initiative, key aspects of the Initiative have moved ahead.Development of our enhanced industrial decision support tool,E2/Finance,is un- derway with the support of U.S. DOE's Climate-Wise program. Tellus staff are presenting E2 case studies at a Denver DOE workshop this Fall.The Region | offices of EPA and DOE are sponsoring Tellus'development of an electronic data-base of fi- nancing resources for E2 projects in industry,to be accessed by New England businesses or by technical assistance agencies working with them.The E2 Initia- tive is a partnership with govern- ment and business to remove the barriers to,and identify the oppor- tunities for,adopting resource productivity practices in industry. For more information,contact Dr. David Nichols. Page 3 Energy Report Natural Gas Growth in the State of Florida: Barriers and Benefits ellus recently completed a report for the Florida Energy Office on the major barriers to incremental growth in gas use in Florida and the benefits that would be derived from such growth. Benefits to the State.Our study found that increased use of natural gas in Florida's commercial,residential,trans- portation,and industrial energy markets would result in net economic and envi- ronmental benefits to the state.The economic benefits would stem from the increase in competition and security as- sociated with incremental gas use.The environmental benefits would arise from the reduction in air emissions and delay in power facilities due to incremental gas use.These benefits would translate into lower consumer energy costs,better air quality and a more competitive state economy. Markets for gas in Florida.In analyz- ing the various markets for natural gas in Florida,we found that all of the end-use energy markets which are,or could be, served by natural gas in Florida are,or could be,competitive.The fact that a single fuel currently holds the dominant share of certain of these end-use markets (for example,electricity in space cooling markets and gasoline in vehicle markets) does not mean that those fuels have a "natural”monopoly in those markets. Barriers to growth and market imper- fections.Our report notes that the op- portunity for gas to capture load in these markets occurs at the time new appli- ances or equipment are purchased. These purchases are made at the time of new construction and when existing equipment is being replaced for opera- tional or economic reasons.Our report also notes that there are a number of barriers to incremental gas growth in Florida's end-use energy markets,includ- ing climate,industry organization and market imperfections.The major market imperfections are related to the pricing of gas service,the value that buyers place on gas service,and the availability of gas service.These market imperfections can be reduced or eliminated through changes in current policies,regulations, and industry practices.The level of in- cremental growth that gas would achieve in various markets will depend on the extent to which current barriers are elimi- nated,as well as on the reaction of Flori- da's gas,electric and oil industries to the elimination of these barriers. Conclusions.Our report concluded that,even with an increase in gas'share of energy markets,for the foreseeable future electricity will continue to dominate residential and commercial energy mar- kets and gasoline will continue to domi- nate the transportation energy market. Our report makes specific recommenda- tions on various changes in current poli- cies,regulations,and industry practices that could enhance the competitive posi- tion of natural gas in Florida: og Reduce the first cost barrier of natural gas equipment 0 Unbundle rates for major gas services and set them close to incremental costs Target marketing to key decision-makers Check the reasonableness of electricity rates Increase access to gas service For information,contact Rick Hornby, Manager of the Natural Gas Program. Measuring Market Power in Electric Utility Mergers issSJ : n testimony recently filed before the Maryland Public Service Commis- sion and the Federal Energy Regu- latory Commission (FERC)on behalf of the Maryland Office of People's Counsel, Tellus recommended that the proposed Baltimore Gas &Electric and Potomac Electric Power Company merger be de- nied in the absence of an adequate hori- zontal market power analysis.Three major issues were raised concerning the Applicants'market power analysis:(1) the need to properly define the relevant product and geographic markets;(2)the need to account for likely future changes to the electricity industry such as retail competition and the establishment of a PJM poolco;and (3)the limitations of applying the conventional Herfindahl- Hirschman Index (HHI)test to measure market power in the electricity industry. Consistent with the Department of Jus- tice (DOJ)and Federal Trade Commis- sion (FTC)Guidelines on Horizontal Market Power (1992),an analysis of market power should require that the rel- evant product and geographic markets be properly identified.Special consideration must be given to defining electricity gen- erating markets,since these markets dif- fer from markets for other products in a number of critical and fundamental ways: (1)electricity cannot generally be stored in significant quantities;(2)it cannot easily be substituted for in the short term; and (3)it can only be transported along existing transmission lines that cannot easily be expanded. In addition,electric generating systems typically comprise different types of gen- erating units (e.g.,baseload,cycling, peaking)which are designed to operate over different time intervals and with dif- ferent capacity factors in order to provide different electricity products.These dif- ferent generating technologies form the basis for different sub-product markets (baseload,cycling,peaking)which can be further subdivided into short-,medium-, and long-term markets.Thus,a market continued on page 4... TURNING INDUSTRY VISIONS NTO REALITY US Y mi OFFICE OF INDUSTRIAL TECHNOLOGIES CIT POSIUM FEBRUARY 24-27,1997 HYATT REGENCY CRYSTAL CITY ARLINGTON,VIRGINIA. w Learn how to boost America's manufacturing muscle by remaining competitive in increasingly tighter global markets. w Share ideas with experts from across the country with focus on seven energy-intensive industries: aluminum,chemicals,forest products,glass,metal- casting,petroleum refining,and steel. =Come hear Dr.Vincent Barabba,author of Meeting of the Minds-Creating the Market-Based Enterprise,give the keynote address at Tuesday night's banquet.Dr Barabba is general manager of the Strategic Decision Center at General Motors. OIT EXPO EVENT SCHEDULE MONDAY,FEBRUARY 24 9:00am-4:00pm 2:00pm-4:00pm 4:00pm-7:00pm Exhibit Hall Set Up Registration/Check-in Reception and Exhibit Hall Opening TUESDAY,FEBRUARY 25 7:30am-8:30am 8:30am-8:45am 8:45am-10:15am 10:15am-10:30am 10:30am-12:00pm 12:00pm-2:00pm 2:00pm-5:30pm 2:00pm-3:30pm 3:30pm-4:00pm 4:00pm-5:30pm 6:00pm-7:00pm 7:00pm WEDNESDAY, 7:30am-8:30am 8:30am -12:00pm 8:30am--10:15am 10:15am-10:30am 10:30am-12:00pm 12:00pm 12:00pm-2:00 pm Continental Breakfast Welcome and Introduction Denise Swink Deputy Assistant Secretary, Office of Industrial Technologies, U.S.Department of Energy Plenary Session Break Concurrent Session 1 «Forest Products «Steel Buffet Lunch in Exhibit Hall Whistle Stops in Exhibit Hall 10-minute Sessions on Inventions and Innova- tions Aluminum Suppliers,ISO 14000,ECO Industrial Parks,Joint Government Partnership Programs,GM Suppliers'Initiative,Alternative Financing/Small Business Concurrent Session 2 +Continuous Fiber Ceramic Components/ Advanced Industrial Materials -Agriculture Break Concurrent Session 3 +Cogeneration ¢Glass »Manufacturing Technologies Reception in Exhibit Hall Banquet and Keynote Address "Creating the Market-Based Enterprise” Dr.Vincent Barabba FEBRUARY 26 Continental Breakfast Whistle Stops in Exhibit Hall Continue See Previous Day Concurrent Session 4 -Metalcasting *U.S.Chemical Industry Break Concurrent Session 5 -Aluminum:Moving America -Petroleum Refining Exhibit Hall closes Luncheon/Recognition and Awards "Now the Real Work Begins:Implementation” Del Raymond Director,Strategic Energy Alternatives, Weyerhaeuser Company HOLD ON! The fun doesn't stop when the Expo is over.Stay and attend a series of informative post conference activities planned by OIT. Read on for the details. WEDNESDAY,FEBRUARY 26 2:15pm-4:00pm Concurrent Sessions Analysis and Evaluation Workshop Come and get an overview of OIT's latest strategic planning,analysis, and evaluation work.Hear presentations on the interrelationship among environmental goals,productivity improvement,and increased energy efficiency;employment impacts;results of industrial tech- nology evaluations by the National Research Council;and many more topics. Aluminum Industry/DOE Partnership-Past,Present,and Future Listen to industry speakers discuss their views on the progress of the OlT-facilitated aluminum roadmap and vision of the future initiative. Give suggestions on how to improve the working relationship . between DOE and the aluminum industry. Sensors and Controls Workshop Hear speakers discuss the progress on the National Academy of Sci- ence working group studying the merits of a DOE Sensors and Con- trols program;results of a DOE study on the impact of improved harsh environment sensing on U.S.industrial energy usage and waste production;and findings of an ISA workshop on needs for nonde- structive evaluation and diagnostics of plant equipment. THURSDAY,FEBRUARY 27 8:30am-12:00pm Concurrent Sessions Financing Industrial Energy Efficiency Technologies Roundtable Learn about financing issues of pollution prevention technologies. Examples of ongoing efforts to help scientists,technologists,and the financing community understand each other's needs as well as inter- national attempts to bridge the financing gap will be reviewed. Energy Efficiency Initiatives in Emerging Markets and Developing Countries Find out how OIT is helping U.S.companies with expertise in energyefficiencytoestablishcooperativeventuresindevelopingcountries.Learn how the energy efficiency action plans for India,Pakistan,China, South Africa,and Ghana will benefit the economy and environment. Glass Oxy-Fuels Oxy-fuel melting is the most rapidly growing technology in the glassindustry.Attend this interactive session on developing issues,such as present and future oxygen generation technologies,oxy-fuel burner attributes and future needs,refractory application issues,furnace design issues,and furnace operating and control practice,evolution, and future needs.Contact Rolf Butters (202)586-0984. Technology Transfer Opportunities in Separations Panelists from five industries will present industry-specific technol- ogy transfer opportunities for separations technologies. 1:00pm-3:30pm Glass Refractories In this session,hear about and discuss the need for new materials to withstand increased temperatures resulting from oxy-fuel firing of glass tanks.Contact Rolf Butters (202)586-0984. STOP IN AT THE ELECTRONIC CAFE _ Put your hands to work on some of OIT's electronic tools.Skilled experts will be there to guide you Zz ZB 208,these resources.: _a MotorMaster software _m Industrial Assessment Center database u Adjustable Speed Drive Master software a National Industrial Competitiveness through Energy,Environ-ment,and Economics (NICE?)solicitation software -g OIT's Web site oo nies _m Industrial Projects locatoroe HOTEL AND TRAVEL INFORMATION A block of rooms has been reserved at the Hyatt Regency Crystal City in Arlington,Virginia.Call the hotel directly at (703)418-1234 to reserve your rooms.To receive the special group rate,call before Feb- ruary 2,1997,and mention that you are attending the OIT Expo. After February 2,reservations will be on a space-available basis only. Group rate:$139 plus tax (9.75%)per night for single/double occu- pancy Government rate:$124 including tax per night for single/double occupancy.Government ID must be presented at check-in. Hospitality Suites:$375 plus tax (9.75%)per night for one-bedroom Regency suite. Hotel reservation requests will be confirmed if guaranteed with a major credit card or accompanied by one night's room deposit.Other- wise,reservations are subject to cancellation. REQUEST FOR REGISTRATION MATERIALS Travel:The hotel offers complementary shuttle service from National Airport and Crystal City Metro.The hotel is conveniently located about a half-mile from the airport.Hotel parking is available at $10 per day.Cab fare from the airport is about $7. REGISTRATION DEADLINE:FEBRUARY 3,1997 For additional information,please fill out the form below and mail or fax to: Energetics,Incorporated 7164 Gateway Drive Columbia,Maryland 21046 Attention:Conference Services Fax:(301)621-3329 Phone:(410)290-0370 [_}I would like to receive registration materials Name Title for the 2nd Industrial Energy Efficiency Symposium and Exposition Company [_)I am interested in co-sponsoring the event {J I am interested in exhibit space Address City State Zip ees)fiT Telephone Fax OFFICE OF INDUSTRIAL TECHNOLOGIES U.S.DOE SEATTLE REGIONAL SUPPORT OFFICE CONTACT LIST STAFF CONTACT Been,Rich Brown,Laurie Cockrill,Chris Chun,Clara Dempsey,Roxanne Dwyer,Molly Ellis,Gayle Framel!,Curtis Gates,Carole Huffman,Lois James,Jeff James,Reggie Jhaver,Arun Johnson,Paul Lottier,Michael McCraney,Ellen Oliver,Julia Putnam,Richard Riel,Riel Rios,Emest Sayer,Cheri Vega,Kathy Yoshinaka,Ejleen* _02/26/97 PHONE#INTERNET ADDRESS 510-637-1543 206-553-2158 .816-861-2133 510-637-1943 206-553-2155 206-553-7837 206-553-2157 206-553-7841 206-553-1165 206-553-2174 206-553-2079 206-553-7693 206-553-2152 206-553-2154 206-553-2156 206-553-2167 510-637-1952 206-553-2165 206-553-2875 510-637-1950 206-553-7838 206-553-1132 808-541-2564 rich.been@oak.doe.gov laurie.brown@hq.doe.gov chris.cockrill@hq.doe.gov clara.chun@oak.doe.gov roxanne.dempsey@hq.doe.gov molly.dwyer@hq.doe.gov 'gayle.ellis@hq.doe.gov curtis.framel@hq.doe.gov carole.gates@hq.doe.gov lois.huffman@hq.doe.gov jeffrey.james@hq.doe.gov reggie james@hq.doe.gov arun.jnaveri@hq.doe.gov paul.johnson@hq.doe.gov michael.lottier@hq.doe.gov ellen.mccraney@hq.doe.gov julia.oliver@oak.doe.gov richard.putnam@hq.doe.gov julie.riel@hq.doe.gov emest.rios@oak.doe.gov cheri.sayer@hq.doe.gov kathy.vega@hq.doe.gov no internet connection POSITION/FUNCTION Motor Challenge (Reg.Prog.Mgr.) SEP (Prog.Mgr.) Public Information Account Representative -AK,ID Climate Challenge (Reg.Prog.Mgr.) Motor Challenge (Kansas City) Clean Cities/Alt.Fuels (CA Only) Clean Cities/Alt.Fuels (Reg.Prog.Mgr. Pollution Prevention Climate Wise ° NICE3 (Reg.Prog.Mgr.) Program Assistant Business Assistant _FEMP (Regional Coordinator) Account Representative -AZ,OR Bldg.Codes &Standards Rebuild America WAP Program Assistant SAGA Manager Reg.Bioenergy Program (Reg.Mgr.) SEP (Reg.Prog.Mar.) Account Representative -NV Prog.&Technology (Renewables) Contract Administration/Procurement Grant Administration FEMP (Engineer) Rebuild America (Reg.Prog.Mar.) Marketing &Outreach Customer Focus Advocate Empower.Zones (Reg.Prog.Mgr.) Account Representative -CA Bldg.Codes and Stand.Prog.Coord. ICP Grants Specialist Administrative Officer Motor Challenge (Oakland) HERS/EEM (Reg.Prog.Mgr.) Account Representative -Navajo,WA WAP (Reg.Prog.Mgr.) Program Analysis Officer FEMP (Oakland) FEMP (Financial) Director Account Representative -Guam,HI, N.Mariana Isl.,Palau,A.Samoa *Eileen Yoshinaka is the Pacific Uaison for programs/projects administered in Amer.Samoa,Guam,Hawaii,N.Mariana Is!.,and Palau. SEATTLE REGIONAL SUPPORT OFFICE FUNCTIONAL DIRECTORY 02/26/97 OSs!/F fe) Director. Program Analysis Officer Account Representative -AK Account Representative -Amer.Somoa Account Representative -AZ Account Representative -CA Account Representative -Guam Account Representative -Hl Account Representative -1D Account Representative -Navajo Account Representative -NV Account Representative -N.Mariana Isl. Account Representative -OR Account Representative -Palau Account Representative -WA Administrative Officer Clean Cities (Regional Prog.Mgr.) Clean Cities (CA only) Climate Challenge (Regional Prog..Mar.) Climate Wise (Regional Prog.Mgr.). Bidg.Standards &Guidelines Prog.Coordinator Bidg.Standards &Guidelines Business Assistant Contract Administration/Procurement Customer Focus Advocate Empower.Zones (Regional Prog.Mgr.) FEMP -Financial FEMP -Regional Coordinator FEMP -Engineer FEMP (Oakland) Grant Administration HERS/EEM (Regional Prog.Mar.) ICP Grants Specialist Marketing &Outreach Motor Challenge (Regional Prog.Mgr.) Motor Challenge (Info.Clearinghouse) Motor Challenge (Oakland) Motor Challenge (Kansas City) NICE3 (Regional Prog.Mgr.) Pollution Prevention Program Assistant Program Assistant Programs &Technology (Renewables) Public Information Rebuild America (Regional Prog.Mgr.) Regional Bioenergy Program (Regional Mgr.) SECP (Regional Prog.Mgr.) SEP (Regional Prog.Mgr.) WAP (Regional Prog.Mar.) WAP STAFF CONTACT Kathy Vega Julie Riel Laurie Brown Eileen Yoshinaka* Carole Gates Paul Johnson Eileen Yoshinaka Eileen Yoshinaka Laurie Brown Richard Putnam Jeff James Eileen Yoshinaka Carole Gates Eileen Yoshinaka Richard Putnam Ellen McCraney Roxanne Dempsey Clara Chun Laurie Brown ;Carole Gates.WJ DenpPaulJohnsonLAKE 4 Carole Gates Gayle Ellis Reggie James Paul Johnson Paul Johnson Cheri Sayer Curtis Framel Arun Jhaveri Ernest Rios Reggie James Richard Putnam Michael Lottier Paul Johnson Rich Been Laurie Brown Julia Oliver Chris Cockrill Roxanne Dempsey Roxanne Dempsey Molly Dwyer Lois Huffman Jeff James Laurie Brown Paul Johnson Jeff James Laurie Brown Jeff James Richard Putnam Carole Gates *Eileen Yoshinaka is the Pacific Liaison for programs/projects administered in American Samoa,Guam,Hawaii,Northern Mariana Islands,and Palau. e ated (lotus)4/73/08 -=7 Dowd lockers December 2,1997 Potential Participants of the 1998/99 UCETF Program The Urban Consortium Energy Task Force (UCETF)is pleased to invite you to participate in its applied energy research and technology transfer grant program. The UCETF,one of the specially focused task forces of PTI's Urban Consortium, is the nation's most extensive network of urban officials with daily responsibilities for energy program management and policy decisions.Over the years,the UCETF has functioned as an application laboratory in developing local government strategies to meet national energy and environmental challenges.It has also worked to develop the capabilities of local government staffs in urban areas to identify and respond to pressing energy and environmental needs. The UCETF has long recognized that local jurisdictions play an instrumental role in enhancing the country's overall energy efficiency and supply stability.As owners,operators,and managers of buildings and land tracts;overseers of diverse transportation fleets and mass transit systems;and designers,planners, financiers and operators of major water,wastewater and,solid waste systems, etc.,local governments are uniquely qualified to identify and resolve our nation's energy issues. With funding from USDOE's Municipal Energy Management Program,UCETF identifies annua!program categories in response to the nation's top ranking energy concerns.UCETF also emphasizes the need for local governments to partner with industry,academia,states,labs,community and other organizations in leveraging funds available to UCETF for use in the development,dissemination and replication of energy technologies and policy tools. Through the participation of this solicitation,UCETF encourages you to join our efforts in leading the national exchange of ideas,insights,practices and innovations.PLEASE DISTRIBUTE THE CARDS IN YOUR PACKAGE TO INTERESTED PARTIES TO ANNOUNCE THE PROGRAM. Sincerely,Bu&-Vice President Research and Membership Encl.Vn ro*wey 7 asv(Vision for,the Future5SolutionsforToday9”Sux _ Yet YEARS oF °°"""* PROGRESS " PUBLIC TECHNOLOGY, INC. 1301 Pennsylvania Ave.NW Washington,DC 20004-1793 202.626.2400 800.852.4934 FAX 202.626.2498 INTERNET http://pti.nw.dc.us Printed on recycled paper THE URBAN CONSORTIUM ENERGY TASK FORCE 1999 REQUEST FOR PROPOSALS An Opportunity to Participate in an Applied Energy Program for the Cities and Counties all over the United States Vision for the Future Solutions for Today PUBLIC TECHNOLOGY, INC. 1301 Pennsylvania Ave.NW Washington,DC 20004-1793 202.626.2400 800.852.4934 FAX 202.626.2498 INTERNET http://pti.nw.dc.us Printed on recycled paper UCETF 1999 SOLICITATION 1999 MUNICIPAL ENERGY MANAGEMENT PROGRAM Overall Program Description Urban Consortium Energy Task Force 1999 Program Year INTRODUCTION The Urban Consortium Energy Task Force(UCETF)is pleased to issue this RequestorProposal(RFP)to local governmentsforthe1999MunicipalEnergyManagementprogramyear. The UCETF is one of the several task forces of the Urban Consortium (UC),anorganizationofthenation's largest citiesandcountiesjoinedtogethertoidentify,develop and deploy innovative approachesandtechnologicalsolutionstosharedurbanproblems.The UC is a creation ofPublicTechnology,Inc.,a non-profittechnologyorganizationoftheNationalLeagueofCities,the InternationalCity/County Management Association,and the National Association of Counties. The UCETF's guiding objective is todefine,demonstrate and apply innovativeenergytechnologies,strategies andmethodsthatenablelocalgovernments toincreasesustainableandefficientenergyuse.With primary funding through theU.S.Department of Energy's (USDOE)Municipal Energy Management Program(MEMP),UCETF funds energytechnologyresearchanddeploymentprojectsbylocaljurisdictions.UCETFworkstotransfertheresultsfromthese rojects that contribute to energy andinancialsavings,economic developmentopportunities,and environmentalimprovementstolocalgovernments acrossthenation. The UCETF contributes to increasing thecapabilitiesoflocalgovernmentstodevelopandimplementeneroypoliciesandprograms.The annual TF workprogramisdefinedbylocalgovernmentenergyofficialsinordertoberesponsivetolocalenergypriorities.Thematic"priority areas”of the greatest commoninterestamonglocalgovernmentsareidentified,and research proposals toaddresstheseareasarecompetitivelyevaluatedandselectedforunding.Coupled with the emphasis on technologytransfer,the program seeks to build thebaseofknowledge,technology and hands on experience available to assist localgovernmentsindealingwithenergy issues. ELIGIBILITY Submission -Projects must be submitted by a U.S.local government. Funding Applied Energy Research &Demonstration project (maximum request$75,000)Technology Transfer project (maximumrequest$25,000) Partnerships Local jurisdictions are required tomaximizeprojectsuccessbyformingpartnershipswithinterestedpublicandprivateentitiessuchasprivateindustries,utilities,research institutes,federallaboratories,other cities and counties, state governments,and/or other public orrivatesectorentities. ulti-jurisdiction submissions areencouragedandweightedaccordingly inprojectselection.Project partners mustprovidesignedlettersofcommitment. Cost Sharing -the project must leveragepublicandprivatesectorcontributionsofinancialorin-kind services (e.g.,technical support).Financial leveraging isencouragedandweightedaccordingly inprojectselection. Prior Participation -any jurisdictionthathasfailedtocompleteapreviousUCETFfundedproject,includingfailuretocompleteafinalreport,willbeineligibleforfundinguntilalloutstandingworkhasbeen satisfactorily completed. SCHEDULE Deadline -Proposals must be received byMarch31,1998.Award notification - early June 1998. UCETF 1999 SOLICITATION Contract period -Grantees are expected tocommenceprojectsinOctober1998andcompleteprojectsbyDecember31,1999.Meetings -Grantee must attend a kick-offmeeting(fall,1998),and 2 project updatemeetings,Unit Meetings,(winter /spring1999andsummer/fall 1999).Meetingssitesareinvariousurbansettingsacrossthecountry. AVAILABLE FUNDING USDOE's Municipal Energy ManagementProgram(MEMP)exists to improveenergypolicyandprogramimplementationatthelocalgovernmentlevel.MEMP seeks to demonstrate innovative and realistic technologies,strategies,and methods that help urbanAmericabecomemoreenergyefficientandenvironmentallyresponsible.Duringthe1997-98 program1 year,18 grants wereawardedatatotalMEMPfundinglevelof$1.4 million. PROPOSAL SUBMISSION Send cover letter,original and 14 copies to: Ama Frim ongPublicTechnology Inc.1301 Pennsylvania Ave.,NW,Suite 800Washington,DC 20004 Submission Guidelines Proposals will be evaluated and funded onacompetitivebasis,and must beconsistentwiththefollowingguidelines: ¢identify a local government energychallenge; *identify appropriate benchmarks againstwhichtoevaluateprojectsuccess; ¢identify at least one partner,indicate thepartner'(s)proposed contribution (cash,in-kind technical support,etc.),androvideawrittenletterofcommitment rom each partner; ¢describe project transferability; *identify applicable economic andenvironmentalobjectives; ¢indicate any interest in working with aDOEorotherlaboratory. FORMAT Proposals should be formatted accordingtotheenclosedform(see page 7).Pleaserefrainfromsubmittinglengthyproposals.with extensive documentation, attachments,etc. Each local government is invited tosubmitnomorethantwo(2)responses inanycombinationofappliedresearchanddemonstration,and technology transferproposals.Please rank proposals indescendingorderofpriority(i.e.,firstchoiceas#1 and second choice as #2). Continuation Projects:1997 projects thatwereoriginallyscheduledfortermsbeyondthe15monthperiodcanbesubmittedforconsiderationforfurther funding in the 98-99 program year.Applicants in this category must mark"CONTINUATION PROPOSAL”on the cover sheet.Prior selection does not guarantee selection for the 1999 program year. BUDGET INFORMATION «All enclosed budget forms must becompleted.Applicants must provide aprojectbudget,including cost sharingcontributions,and indirect and/or overhead costs. ¢Funding categories -estimated projectfundingamountsandsource(s)for eachmajortaskmustbeclearlystatedontheBudgetSummarypageoftheproposalform.Funding categories include: --DOE (UCETF)fundin--Local government funding--Partnership funding ¢Participation of staff from theparticipatingjurisdictionwillbe requiredattwounitmeetingsduringthetermoftheproject.Budget at least $1,200 pertripfortravelexpenses. ¢Work performed in accordance with aUCETFapprovedbudgetwillbefunded on a reimbursable basis. ¢Grantees are required to completereportingrequirementsandproducea finalprojectreportforuseintecnologytransfer.Please note that 25%of projectfundingwillbewithhelduntilallworkhasbeensatisfactorilycompleted. UCETF 1999 SOLICITATION ¢Indirect costs shall not exceed 20%of total project costs;and¢Costs for equipment and consultantsshallnotexceed20%each of total project costs. PRIORITY FUNDING AREAS The following provides a brief descriptionofthetopicsidentifiedbytheUCETFasareasofthegreatestneedforlocalgovernmentsthroughoutthenation,roject proposals addressing the followingurbanenergytopicswillbegivenfundingpriority: ELECTRICITY RESTRUCTURING The interest and need for information on the local impacts of electricity industryrestructuringisanationwideconcern.Local governments will be affected by themovetowardindustryrestructuringandtheimplementationofcompetitionandcustomerchoiceingenerationandsupply. Illustrative project examples: e Projects addressing residential andlow-income customer needs e Market aggregation methodseDistributedgenerationtechnologies(e.g.,fuel cells,photovoltaic panels)e Analysis of service provider options(e.g.,municipalization versusrivatization) e Electric measurement technologiesand/or techniques (e.g.,advancedmeteringdevices)e Preservation of energy efficiency,DSM in a competitive environment ENERGY USE AND SUPPLY Cities and counties will bear the ultimateresponsibilityforimplementingmanynationalenergyandenergy-relatedenvironmentalpolicies(e.g.,the EnergyPolicyAct,the Clean Air Act,voluntaryprogramsundertheClimateChangeActionPlan,etc.).Local governments alsofacecontinuingrequirementstoreduceenergyusageandcosts.Strategies toachievetheseobjectivesincludenewtechnologiessuitedtolocalclimaticconditions,utilization of local energyresources,particularly non-fossil ;resources,waste and wastewater practices,and the use of additional supply options,such as fuel from biomass. Illustrative project examples: e Novel applications of existingenergytechnology,focusing onbuildingenergysystems,management and controls; °Financing strategies for emergingtechnologies; °Innovative transportation and fueloptions; °Renewable energy sources in thesupplyofpower; °Energy efficient technologies. ENERGYAS A TOOL FOR ECONOMICDEVELOPMENT Cities and counties face energy,environmental and economic challengesbydesigning,testing and applyinginnovativetechnologies,policies andenergymanagementstrategiesthatmeetlocalneeds. The UCETF has a continuing interest inpromotingalong-term urban energysustainabilityandinthedevelopment ofrenewableenergyresourcesandsystems.It seeks to help local jurisdictionundertakeandcompletecreative energysolutionsandexportthosesolutionsto help other jurisdictions realize energysavingsandemissionreductions.To this end,UCETF supports energy R&Dprojectsthatlocalgovernmentsbelievecanmakesignificantcontributionsinthelocalcommunity. Illustrative project examples °Energy technology for use insustainablecommunityprojects; °Energy technology aimed at jobcreation; e Code revision projects that supportsustainablebuildingdesigns; e Removal of barriers to the use of renewable energy in local governments TECHNOLOGY TRANSFER UCETF places a high priority on thetransferofpreviousprojectresultsto thewideraudienceoflocalgovernments.Products and methods to transfer the essential elements of the project to otherjurisdictionsorlocalgovernmentdepartmentsmayincludetechnicalfactsheetsorarticles,slide presentations orotheraudio-visual products,computersoftware,workshops,guidebooks,etc. UCETF 1999 SOLICITATION Transfer methods may include meetings,response to technical inquiries,interactiveon-line networking,reports and the like.Generally,a transfer project should bedesignedtoupdateoradaptpastwork toimproveprojectcurrencyandusefulnesstoothercitiesandcounties. Transfer projects may be proposed totransferyourjurisdiction's past work toanothercityorcounty,or to transferanotherjurisdiction's past work to yourcityorcounty.Joint application byoriginatingandrecipientjurisdictions arewelcome.Projects qualifying under thissectionarenotlimitedtopastUCETFprojects;appropriate non-UCETF projectsmayalsoqualify. Illustrative transfer project examples: e Expansion of local governmentproductresearchtoanationalaudience; °"Body of research”studies whichcapturethecomprehensiveworkdoneonaparticulartechnology;e Summaries of evaluation or testingofatechnologyortechnique. Prior UCETE Projects Under the auspices of the UCETFprogram,nearly 300 applied energyprojectshavebeencompletedinalmost 50jurisdictionsaroundthecountry.Pleasecontacttheindividualslistedbelowfora list and description of these projects.Thislistingshouldbecarefullyreviewedtoavoidduplicationofpriorworkinyourprojectproposals.A complete listing canalsobefoundonPTI's home page:http://pti.nw.dc.us SELECTION CRITERIA (%age points) Concept (0 -30 %) Scope,Objectives and Innovation Methodology (0 -20%) Proposed Tasks,Management Plan andleveloflocalgovernmentinvolvement,Timeline Partnership (0 -15%) Nature and level of involvement,support(financial,in-kind),evidence ofcommitment Performance Measures (0 -15%) Means of evaluating project during andaftercompletion Technology Transfer (0 -10%) Demonstration of aspects of the programthatwillbetransferabletootherjurisdictions Budget (0 -10%) Justification of Costs &Matchingcontributions ADDITIONAL GUIDANCE Roger DuncanDirector,Planning,Env.,&Cons.Svcs.206 E 9th Street,17th Floor Austin,TX 78701Tel:512/499-3575,Fax:512/499-2859 E-mail:70621.3477@compuserve.com Maureen Sullivan Director of Project ManagementPublicUtilities600MunicipalBuilding600FourthAvenue Seattle,WA 98104-1879206/684-8552;Fax:206/684-8581 maureen.sullivan@ci.seattle.wa.us For assistance in the development of aproposalorpartnershipapproach: Ama FrimponPublicTechnology,Inc.1301 Pennsylvania Ave.,NW,Ste.800Washington,DC 20004-1793 Tel:202/626-2400,Fax:202/626-2498E-mail:frimpong@pti.nw.dc.us The UCETF members listed below,serveasthetechnicalcontactsforthefollowing issue areas: Electricity Restructuring Dwight Bailey,Dir.of EnergyManagementDepartmentoftheEnvironment 30 N LaSalle Street,Suite 2500Chicago,IL 60602 Tel:312/744-8901,Fax:312/744-6451 e-mail:dbailey@ci.chi.il.us UCETF 1999 SOLICITATION Energy Usage &Supply Steve Foute,Director Department of Environmental Health 1391 Speer Blvd,Suite 700Denver,CO 80204-2558 303/285-4055;Fax 303/285-5621 e-mail:sfoute@ worldnet.att.net Energy as a Tool for Economic Development Larry Blackstad,Principal PlannerTrainingandEmploymentAssistanceGovernmentCenter,Lower Level South 300 South Sixth Street Minneapolis,MN 55487Tel:612/348-5859,Fax:612/348-3932 e-mail: larry.blackstad@co.hennepin.mn.us Technology Transfer Glenn Coontz,Assistant DirectorParksandGeneralServicesDept.1801 4th Street,NW Albuquerque,NM 87102 Tel:505/768-5300,Fax:505/768-5305 e-mail:coontz@cabq.gov Budget preparation assistance: Linda Davis,Business Officer Department of EnvironmentCityofChicago 30 N LaSalle Street,Suite 2500Chicago,IL 60602 Tel:312/744-3637;Fax 312/744-6451e-mail:environment@ci.chi.il.us UCETF 1999 SOLICITATION 6 PROPOSAL SUBMISSION FORM Project Title Jurisdiction Contact Name Address Phone &Fax Number Proposal Type: Applied Research and Development Project Technology Transfer Project Total number of proposals submitted by jurisdiction:maximum of 2 proposals Applied Research and Demonstration Technology Transfer Note:Separate submission forms must be filled out for each proposal.If more than one proposal has been submitted,this ranks ,out of a maximum of 2 proposals. SUBMISSION INFORMATION Name and Title of Person Submitting Proposal Tel:# Signature and Date Name and Title of Department Head Signature and Date UCETF 1999 SOLICITATION DETAILED PROPOSAL I. Il. II. IV. General Concept. Describe an innovative approach to the presented topic.Include a clearly written statement of the project scope and objectives,and describe an effective management structure Methodology and Anticipated Results Describe the activities to be conducted in meeting stated goals/objectives and identify activities suited for adaptation,transfer and/or replication in other jurisdictions A.Major Activities:(include a draft outline of the final report) B.Management Plan and Organization: (Attach a simple description and/or an organizational chart .) C.Phasing and Timeframe: (List major tasks and attach timeline.) D Anticipated results and/or products:(e.g.software package and users guide; guidebook;videos;etc.) Partnerships Identify key public and private sector partners and specify their contributions to the project.Translate in-kind to $$ A.Quantify the leveraging of private and public-sector partners including cost- sharing arrangements.[Example:$x of non-federal investment (cash-in-hand)for every $y of UCETF/DOE investment] B.Identify partner involvement by major activity Evaluation Describe the evaluation tools which will be used to measure and quantify the results of project activities and track progress made in meeting stated goals/objectives.Refer to Appendix C for a list of applicable output indicators or "metrics” Deployment,Transfer and Economic Development capabilities Describe the technology replication and transfer objectives,and project the energy and economic impacts. A.State uses and applications of project activities and/or results B.Identify items capable of being transferred probable rate of adoption to other jurisdictions C.Reductions in energy use and costs ¢Potential for expanded energy savings: UCETF 1999 SOLICITATION D.Impacts on emissions «Methane (CH,) «Nitrogen Oxides (No,) ¢Chloroflourhydrocarbons (CFCs) ¢Volatile Organic Compounds (VOCs) ¢Reductions in soil erosion or water contamination E.Potential to support local economic growth and job creation/retention: VI.Budget Justification A.List costs and cost components for each major task in the proposed project and indicate partnership supported activities (specify cash versus in-kind support) B.Describe the nature and costs of project equipment and consultant services.Cost for each of these items cannot exceed 20%of UCETF/DOE-MEMP project funding. VUl.Identification of Indirect Cost and Overhead Rates If an indirect cost or overhead rate will be applied to the direct costs for your project,please state the rate and to what direct cost it will be applied.Please provide written justification to accompany this submission. UCETF 1999 SOLICITATION Vu.Budget Summary Project Title and Jurisdiction: Cost Category DOE (UCETF)Local Gov't*Partner*Total Cost Personnel Professional Clerical Subtotal Labor Direct Costs Postage Printing Telephone Technical Mtgs. [within jurisdiction] Unit Mtgs. Equipment Supplies Consultants Subscriptions/Dues = Subtotal ODC Indirect Costs Fringe Benefits Overhead G&A Subtotal Indirect TOTAL COSTS Please translate in-kind contributions to $$ e Submitted by:Tel.No: (Name and Title) UCETF 1999 SOLICITATION 10 Partnership Opportunities Partners can range from other local jurisdictions to private industry.Based upon the nature ofyourproject,you may also want to consider partnership opportunities with the followingentities: Electric Power Research Institute (EPRI)--EPRI's Customer Systems Group,and EPRI's Community Technology Solutions Program work to establish and coordinate collaborative efforts between EPRI members and the communities they serve to find new ways to address mutual concerns. For the purpose of this RFP,EPRI would be interested in partnering with city and county governments in the following research areas: e Sustainable Technologies for Energy Efficiency and Improved Building Environmental Quality Electro-technologies for Drinking Water and Wastewater management and treatment Building &Infrastructure Performance,Power Quality,&Airport Vehicle Electrification Disaster Planning &Mitigation Technologies Community Energy,Environmental &Economic Sustainability GIS applications. Contact Michael Tinkleman,Manager Washington Relations,Customer Systems Group, EPRI at 1-202-872-9222,or via the Internet at mptinkle@eprinet.epri.com. American Public Power Association (APPA)-local jurisdictions with municipal electric utilities may find partnership opportunities through APPA's Demonstration of Energy Efficient Development (DEED)grant program.For more information call 202-467-2960 or address e- mail inquires to 102607.1770@compuserv.com. Federal Laboratories -Federal government laboratories represent valuable technology resource information and expertise.Examples of federal laboratory topics of particular interest to UCETF include technologies for electricity production,integrated resource planning,district heating and cooling,revised building energy guidelines,and the uses of renewable energy. Other USDOE Programs and Contacts:Please contact your regional USDOE Offices for a complete list of other programs for local governments. UCETF 1999 SOLICITATION I UCETF Performance Measures UCETF applies DOE's MEMP performance measures in monitoring grantee performance. Proposals should identify the evaluation tools which will be used to measure and quantify the results of project activities and track progress made in meeting stated goals/objectives.The following output indicators (wherever applicable to specific projects)should be incorporated into the project work plan. PERFORMANCE MEASURES Cost sharing/leveraging ($4 to $1 ratio of Federal/non-Federal funds) Primary energy displaced/energy savings Primary oil displaced (for transportation programs) Energy cost savings/local government budget savings Reductions in CO2 or other emissions Reduction in energy consumption (measured in quads) Reduction in energy intensity (BTUs pr household per year) Market penetration of new energy efficiency technologies Number and nature of partners participating in a program For programs involving energy audits:number of audits to be provided;energy savings identified per audit;number of audit recommendations acted upon Number of showcase demonstration projects completed Number of people to whom information is provided annually Number of homes/businesses addressed Number of jobs created or supported Amount of private sector investment in government projects Further Description of Performance Measures Involvement of the Private Sector:documentation on the number of private sector participants in funded projects,possibly including the number of individuals attending seminars,the number requesting and receiving information;the number of "hits"on a bulletin board or other information-sharing tool; Transfer to the Public Sector:Estimate of number of communities to which research is transferable;actual requests for documentation;extent of distribution of materials regarding the program;number of conference attendees;follow-up requests for information;number of jurisdictions/states represented at conferences/serminars; Issues Resolved/Explored:number of questions answered (e.g.,project begins with 7 unresolved questions and provides definitive answers to 6 of them);number of options identified and explained to decision-makers; Potential for Future Application of Technologies/Program Results:e.g.,number of buildings similarly situated to a demonstration facility for which technology might be suitable;number of local governments with comparable franchise powers to which information regarding exercise of the franchise power in the era of restructuring might be relevant;number of municipal utilities UCETF 1999 SOLICITATION 12 that could benefit from lessons learned in development of local distribution rates; Expansion of Market for Renewable Energy Resources:size/number of contracts executed for purchase of electricity generated by renewable resources;number of customers/customer classes to which opportunity to purchase renewable resources is extended; Demonstration of New Energy Technology:cost savings estimates;estimates of "effectiveness,"i.e.,does the technology work as well as the technology being replaced;impacts on power plant usage/emissions;number of applications for which the technology would be suitable;institutional/operational barriers identified/resolved;estimate of potential maximum penetration of the technology; New Energy Efficiency Delivery Mechanisms/Analysis Tools:value of energy improvements contracted for;savings to participating businesses;reductions in energy usage,translated into emissions reductions if possible;estimates of the energy savings benefit of applying some or all of the energy efficiency tools;estimates of the number of facilities (local government;private sector)to which the energy efficiency tools/delivery mechanisms would potentially be applicable. 7_Additional ResourcesFornmoreinformationontheseandother pprograms:|*Contact the Directot of your Regional Departmeit of Energy SuppoOficeice (seebale)__oryOur State Energy Office (see fol lowing page)'mi OD Tak.ee*Access the Energy Efficiency and Renewable Energy Network (FREN}onateWat WieWedathttp:/Amww.eren.doe.gov*Call the Energy Eficiency and Fete Cine)stn ant ren2.' Regional Support Gitices i Seatile Atlanta Support Office.James Powell,Director 703 Peachtree St.NE,Ste.876 Atlanta,GA 30308. 404-347-2696- Boston Support OtticeHughSaussy,Director One Congress Street,11th Floor;Boston,MA 02114 *647-565-9700 Denver Chicago Support Office Val Jensen,Director One South Wacker Drive,Ste.2380 .Chicago,IL 60606312-353-6749 Denver Support Office Bill Becker,Ditector 1617 Cole Bivd.-Golden,CO 80401 303-275-4800 Boston Philadelphia Atlanta: Philadelphia Support Offlce Charles Baxter,Director 1880 JFK Bivd.,Ste.501.'Philadelphia,PA 19103i5-656-6950SeattleSupportOfficeKathyVega,Director.->800 Fifth Avenue,Ste.3950.-Seattle,WA 98104| -”206-553-1004 How Will the Initiative Work? The Million Solar Roofs Initiative will encourage all projects across the United States that produce solar energy installations on the roofs of residential,com- mercial,institutional,and government buildings.By working with all interested partners,the Initiative will increase the market for solar energy and assist in pro- moting these projects.It will also provide a central point of coordination for the many diverse efforts at the national,state,regional,and Soca!levels. Solar Energy Works TodayManyeffortsaroundthecountryare already under way to remove barriers and provide incentives to fos- ter the widespread use of solar energy.The Initiativewillhelpothersfollowtheseexamples:° The Sacramento Municipal Utility District (SMUD)developed a program that builds local demand for ' solar energy systems.The PV Pioneer program has put photovoltaic (PV)systems on 420 roofs,and another 10 megawatts of PV systems are planned forinstallationfrom1998to2002. Wisconsin Public Service Company is conducting the "SolarWise”program.Twelve-kilowatt PV systems were installed on each of three schools in Wisconsin. This program provides an opportunity for teachers - and students to learn about renewable energy while the system is providing electricity to the building. SolarWise will soon be expanding to include commu- nity businesses and residential buildings. The first major commercial application of building- integrated PV energy in the United States will be on the Durst 48-story skyscraper in New York City.The15-kilowatt system of advanced,thin-film PV panels will replace the building's glass cladding. on, -Produced for the U.S.Department of Energy's (DOE)Office i ' How can 1 Find Out More?.wy By Phone:Energy Efficiency and Renewable Energy Clearinghouse (EREC),1-800-363-3732 "Capturing the sun's warmth can help us to turn down the Earth's temperature.” -President Clinton On'the Internet:!,Million Solar Roofs Website,'www.w-MillionSolarRoofs.orgSolarEnergyIndustriesAssociation,www.seia.org DOE/GO-10097-504 ' lg October 1997 of Energy Efficiency and Renewable Energy by the NationalRenewableEnergyLaboratory,a DOE national laboratory.Seter Derign Aueciates,inc. Office of Energy Elficiency and Renewable EnergyU.S.Department'ol Energytx)Printed with renewable-"source Ink on paper containing at leasi 50%wastepapor,Including 20%postconsumer waste. 4 seats The President's Million Solar Roofs Initiative On June 26,1997,President Clinton announced the Million Solar Roofs Initiative.The goal is to install one million solar energy systems on buildings across the United States by the year 2010.The U.S. Department of Energy (DOE)is supporting teams from the building industry,local governments,state agencies,the solar industry,electric utilities,and other organizations to remove market barriers, foster incentives,and strengthen the grassrootsdemandforsolarenergytechnologies.4he Why Is the Initiative Important? ¢It will create high-tech Jobs.By 2010, approximately 70,000 new Jobs will be created by the demand for solar energy technologies. *It will slow greenhouse gas emissions by using clean energy from the sun.By 2010, solar energy technologies will reduce carbon dioxide emissions equal to the amount producéd by 850,000 automobiles. *It will keep U.S.companies competitive. Increased demand will drive the cost of solarenergy'systems down,strengthening U.S.competitiveness in a world market expected to -reach the multi-billion-dollar range by the next decade. '"yO, The Initiative's Solar Technologies - The Millions Solar Roofs tnitlative will include photo-voltaic and solar water heating systems that provideenergytohomesorcommercialorgovernmentbuild-ings.The systems must be located on or,adjacent to thebuildings.|. Photovoltaics.Often called "solar electricity,"photo-voltaics convert sunlight directly to electricity.It is an attractive alternative to conventional sources of elec- tricity for many reasons:it ts silent,non-polluting,and renewable;it requires no special training to operate:it is modular and versatile;it is extremely reliable and vir- tually maintenance free (with no moving parts);and it can be installed almost anywhere,The customer pays only for the system;the fuel is free. - ra ne Ont oes*eeMee Be 5 *."4 i Stow atig *fo wsttg SOs, lium (ees|fansBagg :a seem ii :PUTT aus +:"J ::eaas +GBEn rr Photovoltaic cells are made of a semiconductor material, usually silicon.They are photosensitive and produce an electrical currént in the presence of light.Individual solar cells are combined to create modules that produce a spe- cific amount of power,These modules,in turn,can be com- bined to create arrays that produce larger amounts of power.The arrays can be sized to meet the power require- ments of the building. Solar Water Heating.Solar water heaters use the sun to heat either water or a heat-transfer fluid, such as an antifreeze mixture,in collectors usuallymountedonaroof:The heated water is then stored in a tank similar to a conventional gas or electric water-heater tank.Some systems use an electric pump to circulate the fluid through the collectors. These environmentally friendly systems can be cost competitive for providing domestic hot water and heating swimming pools. W Grete CR Energy-Efficient Buildings.Ideally,solar energy systems should be installed on efficient buildings. DOE advocates a whole-building approach to energy efficiency through Buildings for the 21st Century.By integrating the latest in energy-efficient design,con- struction,and equipment with solar energy tech- nologies,we can significantly reduce energy use in buildings-and enjoy the benefits to the environ- ment and our wallets. Page 12,Energy Update,January 1998 Division of Energy,DORA 333 W.4th Ave.,Suite 220 Anchorage,AK 99501-2341 (907)269-4500 FAX (907)269-4645 Bulk Rate U.S.Postage PAID Anchorage,AK Permit No.1058 Energy Conservation Tips Eight of the 10 graduates of the Jan.6-Feb.28,1997,Power Plant Operations Course at the Alaska Vocational Technical Center in Seward were sponsored by the Division of Energy.Graduating from the eight-week course were (from left)Ivan J.Maxie,Napaskiak; Glenn J.Coffin,Buckland;Orville Ahkinga Jr.,Diomede;Bryan W. Joseph,Chalkyitsik;Mike A.Akaran,Kotlik;Christopher J.Knowles, Larsen Bay;Wassillie J.Gregory Sr.,Sleetmute;David Philip,Tuluk- sak;Kirk McCormick,and John Ekada.McCormick and Ekada were not sponsored by the Division.At the far right is course instructor Dave Vial.All Division students were employed following their certifi- cation as either Diesel Plant Operators or Assistant Diesel Plant Operators. e Turn off all lights that are not in use. e Clean lighting fixture lenses and dif- fusers to increase light levels. ©Keep doors and windows closed during the heating season. e Repair and weatherstrip doors,win- dows and other building components that allow excessive air to enter the building. e Add storm windows to any single-pane windows. ©Set thermostats to 70 and 60 degrees during occupied and unoccupied periods, respectively. @ Seal all leaks in ductwork,particularly in unheated spaces (attics,srawlspaces, etc.) ©Insulate all uninsulated domestic hot water and hydronic pipes. e Clean out domestic hot water heater at regular intervals and adjust burners. e Turn off vending machines,printers, computers,copiers,etc.,when building is unoccupied. Volume 2,Issue 1 Department of Community &Regional Affairs January 1998 Buying fuel on area-wide basis can save money oryuying in bulk almost alwaysBe==money and this is nomoretruethaninruralAlaska when it comes to purchasing a win- ter's supply of heating fuel and gaso- line. Preliminary figures for calendar year 1997 indicate total electric util- ity fuel purchases in rural Alaska totaled about 29.7 million gallons. Roughly one-third of that -9.5 mil- lion gallons -was bought by re- gional utilities such as Alaska Village Electric Cooperative,Alaska Power &Telephone,the North Slope Bor- ough and the Tlingit-Haida Regional Electrical Authority. Regional electricity providers as well as rural school districts,known as Rural Education Attendance Ar- eas,typically buy fuel in bulk for all locations in one request for bids. Quotes may be specific for each community or may cover all commu- nities in a service or attendance area. However,the price paid for fuel is almost invariably much lower than that paid by individual entities in the same area. The Division maintains statistics on fuel consumption by electric utili- ties in rural Alaska by way of the reporting requirements of the Power Cost Equalization (PCE)program and on fuel purchases made through its Bulk Fuel Revolving Loan Fund. It also has fuel price information on Price of Diesel Fuel for Rural Power Generation July 1995 to June 1996 9,000,000 8,000,000 7,000,000 6,000,000 5,000,000 4,000,000 3,000,000 2,000,000 1,000,000Gallons SP ge 9 O 9we9SYgt sgh ol Price per Gallon Average price of fuel reported by utilities participating in the Power Cost Equal- ization Program in Fiscal Year 1995.A total of 27.5 million gallons of fuel were consumed at an average price of $1.01 per gallon. In This Issue Director's M@SSAGe..........:c0ecceccseeees 2 Bulk Fuel Tank Farms .........cess 3 Electric River Crossing ..........sses00 4 Programs OVErview .v....ccceeesveceee 5-8 Power Project FUN vceecesessesceeseeseees 9 Alternative Energy...........:.0000 10-11 the REAAs. "It is a priority of the Division to assist isolated rural electric utilities to join a regional or consolidated utility organization,”Energy director Percy Frisby said."Consolidation of bulk fuel tank farms in a community offers an opportunity for the partici- pants in the tank farm to go together in bulk fuel purchases.Both of these help cut fuel costs.The Division can assist with both.” A cross-section of Division data bases turned up seven REAA com- munities which are served by a re- gional electric utility and which also have a current bulk fuel loan. Both the rural school districts and the utilities were able to purchase fuel area-wide for a number of loca- tions,whereas the bulk fuel loans were used for purchases of fuel for the individual communities involved. The results,community-by- community,are: Savoonga:the Bering Straits School District,with storage capac- ity of 151,000 gallons,bought fuel wholesale at $1.1625 per gallon. The utility,with storage capacity of 133,500 gallons,bought its fuel for $1.2529/gallon;while the fuel pur- chased with the bulk fuel loan cost $1.58/gallon. Unalakleet:the Bering Straits School District,with storage capac- ity of 113,900 gallons,bought fuel wholesale at $1.0925 per gallon. The utility,with storage capacity of 359,000,bought its fuel for 84.68 cents/gallon;while the fuel pur- (Continued on page 2) Page 2,Energy Update,January 1998 From the Director ...Percy E.Frisby Energy Update,January 1998,Page 11 Wood residue resources assessed in Southeast enues,state funding to the Divi- sion of Energy for assisting rural Alaska to deal with pressing prob- lems such as badly deteriorating bulk fuel tank farms has dropped signifi- cantly. A lack of money,however,does not have to mean a lack of ability or resolve in tackling these problems. The Division did not just fold its tent and walk away from bulk fuel prob- lems when faced with less and less dollars. Instead,we initiated an effort to build partnerships with the federal agencies involved with bulk fuel in rural Alaska,primarily the U.S.Coast Guard and the Environmental Protec- tion Agency (EPA),and the commu- nities needing assistance. @ We have accompanied the Coast Guard on its inspection trips in rural Alaska,and we have responded to Coast Guard citations on below-code fuel pipe systems with immediate re- pairs. ©We have worked closely with the EPA to develop a construction pro- gram to rebuild existing systems and construct new tank farms throughout rural Alaska (see Page 3).EPA has contributed substantial funding to I n a time of declining State rev-this program. ©We have also worked on behalf of rural communities to submit grant applications to other federal agencies -notably the U.S.Department of Housing and Urban Development - for funds to construct bulk fuel tank farms. The goals is to leverage available state funds with federal dollars to the greatest extent possible. We have been successful because all the affected parties are at the table,and because the results meet community needs and fulfill State and Federal requirements -a win/ win situation for all. Continued success will depend on keeping on course and making sure all involved are kept up to date. There is no reason this can't continue to be done and we look forward to carrying it through. This is not the only way that the Division has worked to maximize the effectiveness of State funds.We have also successfully privatized many of our activities.In fact,about 90 percent of what our predecessor agency -the Alaska Energy Author- ity --did in-house is now performed by the private sector. Multi-discipline contractors pro- vide engineering services.Private contractors perform our energy audits and our bulk fuel assessments.A contractor provides bookkeeping and trustee services to communities for payroll and other expenses associated with energy projects.We have term contracts to provide equipment for emergency response.And,we intend to continue to privatize as much as possible. e Buying fuel in bulk Energy Update Energy Update is published quarterly in January,April,July and October by the Division of Energy,Alaska Department of Community and Regional Affairs.Energy Update is supported by funding from the State of Alaska and the U.S.Department of Energy. For more information,contact (907)269-4625; fax (907)269-4645. Tony Knowles,Governor State of Alaska Mike Irwin,Commissioner Community &Regional Affairs Percy Frisby,Director Division of Energy This publication is available on the Internet at the State of Alaska homepage.Printed at a cost of 50 cents per issue.Send address changes to:Division of Energy,333 W.4th Ave.,Ste.220,Anchorage,AK 99501-2341. The State of Alaska is an Equal Opportunity Employer.Printed on recycled paper. (Continuedfrom page 1) chased with the bulk fuel loan cost $1.239/gallon. Wales:the Bering Straits School District,with storage capacity of 40,000 gallons,bought fuel whole- sale at $1.1625 per gallon.The util- ity,with storage capacity of 51,500 gallons,bought its fuel for $1.2377/gallon;while the fuel pur- chased with the bulk fuel loan cost $1.399/gallon. Mountain Village:the Lower Yukon School District,with storage capacity of 183,775 gallons,bought fuel wholesale at $1.19 per gallon. The utility,with storage capacity of 194,700 gallons,bought its fuel for $1.1994/gallon;while the fuel pur- chased with the bulk fuel loan cost $1.51/gallon. Toksook Bay:the Lower Kuskokwim School District,with storage capacity of 34,460 gallons, bought fuel wholesale at $1.1714 per gallon.The utility,with storage ca- pacity of 147,475 gallons,bought its fuel for $1.1793/gallon;while the fuel purchased with the bulk fuel loan cost $1.24/gallon. Aniak:the Kuspuk School Dis- trict,with storage capacity of 124,700 gallons,bought fuel whole- sale at $1.275 per gallon.The utility, with storage capacity of 143,000 gal- lons,bought its fuel for $1.165/gallon;while the fuel pur- chased with the bulk fuel loan cost $1.61/gallon. Upper Kalskag:the Kuspuk School District,with storage capacity of 41,200 gallons,bought fuel whole- sale at $1.275 per gallon.The utility bought its fuel for $1.2035/gallon; while the fuel purchased with the bulk fuel loan cost $1.40/gallon. "The difference in fuel costs from least expensive to most expen- sive fuel in each community ranged from 7 cents per gallon (Toksook Bay)up to 45 cents per gallon (Aniak),”Frisby said."When you are dealing with a bulk fuel purchase of 100,000 gallons for example,the ability to buy in bulk can mean a savings of from $7,000 to $45,000.” major assessment of sawmill waste,logging residue,and other low value woody mate- rial is being conducted by Sealaska Corporation with the assistance of the Division of Energy. Sealaska is working with the Na- tional Renewable Energy Laboratory to study feasibility of establishing a facility which would convert much of the region's bark,sawdust,chips,and other material into ethanol. Disposal of wood waste remains a major issue for wood processing developers and local communities in Southeast Alaska.Landfill space is limited and options for disposal are expensive. Early results indicate availability of over 630,000 green tons per year of wood residue.NREL estimates that a 16 million gallon per year fa- cility would require around 402,000 green tons of wood residue per year. In addition to wood residue,an- other 782,000 green tons per year of clean wood chips are also potentially available;however chips also supply a volatile fiber market outside the state. An important market for the ethanol is Anchorage,where a 10% ethanol blend is used as an oxygenate for gasoline during the winter months as part of a plan to meet air quality standards for carbon monoxide. Last spring the Alaska Legisla- ture voted to retain a tax exemption of 8 cents per gallon of blended "gasohol”year-round if the ethanol was derived from wood in the first five years of a facility's production. Gasohol not meeting these criteria receives a 6 cent per gallon tax ex- emption only during the months that it is required. Work will result in updated in- formation on the quantity,quality, cost,and long-term availability of wood waste and fiber in the area of Ketchikan,Metlakatla,Wrangell, Craig-Klawock,and Thorne Bay. Information generated by the as- sessment will be available to devel- opers of potential projects in south- east Alaska which would use the ma- terial for energy production,ethanol feedstock,densified wood fuels, composted soil amendment,and other products. The project is consistent with the State's overall goals of promoting value-added timber processing to maximize statewide and local eco- nomic benefits.The model and sup- porting documentation were prepared under contract by Standberg Engi- neering of Anchorage. oe Economics and 'Ogden Beeman and Ass«rile Consultiig eroup.Contact,Shoo:Garrett, Rural Hydroelectric Assessment and Development Study,Report.Identifies 131 potential hydroelectric sites in Alaska likely to becost-effective and technically/environmentally feasible.Includes MSAccess™database containinginformation on 1,144 potential sites|Prepared by Locher Interests Ltd.for Division of Energy.Contact,RebeccaGarrett,907-269-4631 at the Division of Energy,333 West aeAVAnchorage;K 99501 Page 10,Energy Update,January 1998 Team seeks niches for small coal-fired power ork continues on identify- ing the technology,fuel costs,energy markets,and other factors which make small coal- fired power production feasible in rural Alaska. With its partner,the Energy and Environmental Research Center,the Division is sponsoring the develop- ment of a computer model which can be used as a tool to "screen”possible coal power development sites. The effort follows up earlier work,completed last spring with Doyon Ltd.and McGrath Light and Power,which assessed the feasibility of a 595 kW coal-fired power plant in McGrath. Fueled by coal that would be trucked over winter roads from Doyon's Little Tonzona Mine,the system was designed to include a fluid bed combustor,a steam turbine- generator set,heated coal storage, and air pollution control equipment. A major expansion of the com- munity's district heating system would allow utilization of the sub- stantial heat produced by coal com- bustion and increase system effi- ciency.Given a high capital cost of the coal-fired system ($7.8 million without the district heating system) and operating costs similar to the existing diesel system,however,team members decided against a demon- stration project in McGrath. Although the McGrath feasibility analysis yielded much useful infor- mation on small coal systems,it was clear that a more general approach was needed to screen potential sites before detailed feasibility analysis was conducted. The current model estimates in- stallation and operation/maintenance costs for a range of sizes based on the McGrath analysis and on proposals which were received from 13 private firms for a 2-3 megawatt coal-fired power plant in Tok. Early results suggest that a small coal energy facility compares well with diesel power where the electri- cal load is greater than 2 megawatts, a substantial thermal load exists,and $0.30 PN coal cost $50/ton $0.25 4 re -coal cost $40/toni, - =$0.20 4 e.ee=-ee -- -._!_3 i eeeeB$0.15 4 3° ho oa 3a $0.10 | $0.05 1 $- 600 800 1,000 1,200 1,400 1,600 1,800 2,000 Busbar Power Generation Capacity (KW) Assumptions in above graph: Power cost not adjusted by Power Cost Equalization funds. Peak heating load at 9.62 mmBTU/hr.up to 1,000 kilowatt capacity,and 15 mmBTU/hr.above 1,000 kilowatt capacity.Average load is 50%of peak. Heat sells for 7.63 per mmBTU. Coal energy content at 8,700 Btu/pound. General and administrative cost at 33%of operation and maintenance cost. Installed facility cost at 30%greater than Anchorage basis. 30-year facility life at 8%debt service. there is inexpensive access to coal. An early "beta”version of a com- puter model is now available (see graph)for energy planning.Depend- ing on the results of the initial analy- sis and utility interest,support for further detailed analysis is available from EERC and the Division. EERC is the Alaska representa- tive of the Federal Energy Technol- ogy Center in the area of fossil fuel development. Audits result in lighting retrofits Energy Audits of rural commu- nity and school buildings are showing early results. The Galena and Ruby schools, visited during Phase 1 of the Divi- sion's Rebuild America Program, have already started changing over to high efficiency lights out of their cur- rent operating budgets. With efficient lighting products, these schools can expect to save up to 30%of their lighting bills.The Re- build America auditor in Ruby also made a potentially life-saving recom- mendation about a hazardous boiler that has since been repaired. Up to date information on the most efficient lighting products is available to all rural communities from the Lighting Design Lab in Seattle.Randy Smith (randy.smith @ci.seattle.wa.us)is the contact per- sion,800-354-3864.This service is sponsored by the Division. A new web page,www.north westlighting.com <http://www.north westlighting.com>provides a wide range of Lighting Design Lab publi- cations,the up-to-date ballast list, and extensive hotlinks to inter Light, information on new lighting products and quality lighting. Energy Update,January 1998,Page 3 EPA/Division tank farm projects are underway ("sme on will begin thissummeronconsolidatedbulk fuel tank farms in six rural communities as part of a partnership between the Division of Energy and the U.S.Environmental Protection Agency (EPA). The projects are planned for An- vik,Grayling and Kaltag as part of the initial demonstration project and for Beaver,Chignik Lake and Manokotak as part of the follow-on project. Total cost of all six projects is expected to be approximately $5.2 million with EPA contributing about three-fourths of the cost and the Divi- sion about one-fourth. The Division began efforts to seek alternative funding sources for tank farm construction in 1995 in light of declining state revenue.The partnership with EPA was formalized with a grant agreement in 1996. Anvik,Grayling and Kaltag are located on the middle Yukon River while Beaver is on the upper Yukon River.Chignik Lake is located on the Alaska Peninsula and Manokotak is near Bristol Bay west of Dillingham. The Anvik project,expected to cost $675,000,will consolidate City of Anvik,Iditarod Area School Dis- trict and washeteria fuel tanks,and will include a new retail fuel facility. One of the existing,non-code compliant tank farms in the Community of Anvik. The Grayling and Kaltag pro- jects,budgeted at about $1.1 million each,also will consolidate City,Idi- tarod Area School District and washeteria tanks into a single,code- compliant facility.Both will include new retail fuel systems. Completion of conceptual design for the new tank farms in the remain- ing three communities is expected shortly.Estimated construction costs are about $770,000 for Beaver, $360,000 for Chignik Lake and about $1.2 million for Manokotak. Typical components of each are: e Obtaining regulatory permits, including a Corps of Engineers Wet- lands Permit,State Fire Marshall ap- proval,rights-of-way and site con- The use of old railroad cars to store fuel is common in rural Alaska;however, such tanks do not meet current codes.This tank farm is in Kaltag. trol; e Constructing the facility with secondary containment dike and chain link fence; e Preparing as-built drawings of the completed project;and, e Installing welded steel piping to and within the new tank farm. As part of constructing tank farms that meet Federal and State codes and regulations,the following plans/manuals will be prepared: e Spill Prevention Control and Countermeasure (SPCC)Plan; e U.S.Coast Guard Operations Manual;and, e EPA Oil Spill Response Plan. The Division also hopes to have three other tank farms under con- struction this summer,funded either primarily or in part by Community Development Block Grants (CDBG). The CDBG program is funded by the Federal government and adminis- tered by DCRA's Division of Munic- ipal and Regional Assistance. The City of Elim,on the Seward Peninsula,and the Alaska Native In- dustries Cooperative Association (ANICA)want to consolidate their tanks into a single facility.Estimated cost is $711,000.Design is underway for a new tank farm in Koyuk,also on the Seward Peninsula. A new tank farm to consolidate facilities of the City of Marshall,lo- cated on the lower Yukon River,and Maserculiq Corp.,the Native Village Corporation,is in progress.Esti- mated cost is $500,000. Page 4,Energy Update,January 1998 River crossing provides more reliable power hat started out as an emer- gency response to a disas- trous flood has resulted in more reliable energy and system management for Alatna and Al- lakaket,both in hardware and relia- bility terms. The two villages,about 190 miles northwest of Fairbanks,are across the Koyukuk River from each other with Alatna,population 32,to the north and Allakaket,population 182,to the south. Prior to the flood,Allakaket had provided energy to Alatna with a small generator situated in Alatna, which is within the municipal bound- aries of the City of Allakaket. The diesel generator set couldn't meet load requirements,was not up to National Electrical Code (NEC) standards,and presented fuel trans- port problems from Allakaket across river during break-up and freeze-up. The flood brought the situation to a head when it swept away,along with residences and communities fa- cilities,the electrical generation and the distribution system. The Division of Energy provided the funds and project oversight to construct an overhead electrical line across the Koyukuk River to connect the Alatna system to Allakaket,as well as other distribution system work.The old diesel gen-set was also replaced with a new,more efficient gen-set to be used as emergency back-up. During the process,residents ex- pressed an interest in joining a re- gional electrical system to provide greater system reliability and man- agement skills. The Division contacted Alaska Power and Telephone,an investor- owned utility with operations in nearby Bettles.AP&T also provides electric service to nine communities in the Tok area and to Skagway and Prince of Wales Island communities in Southeast Alaska. cana cg fit sao Energy Update,January 1998,Page 9 Power Project Fund applications due Jan.30 Power and Telephone. Pictured above is the back-up/energency generator for Alatna.The com- munity currently received power from Allakaket through a new overhead electrical line across the Koyukuk River.The system is owned by Alaska The City of Allakaket and Alatna agreed to join AP&T and the utility accepted ownership of the electrical system upon completion of the elec- tric line across the river. System reliability has been en- hanced both by the intertie/emer- gency gen-set and because of AP&T's economies of scale and its parts/supplies inventory. Focus Is on efficiency improvements Shaving fuel consumption by 100 gallons a day in one community and reducing line loss by 60%in another are examples of a new focus by the Division for its Rural Power System Upgrades (RPSU)program. Declining state revenue means the Division is less able to replace or construct distribution or generation systems;but has shifted the emphasis to efficiency improvements. Kwethluk Inc/Kuiggluum Kallugvia requested assistance to purchase a new 250 kW diesel gener- ator set to replace one of its existing gen-sets which was 15 years old and could no longer be repaired. With Kwethluk Inc.providing 50%of the project cost of $60,000, the old 250 kW generator was re- placed with a new Cummins gen-set which operates at 1,200 rpm instead of the previous unit's 1,800 rpm. The lower engine speed not only means less maintenance require- ments,but also consumes about 100 gallons of fuel less per day than its predecessor.At the $1.37/gallon the utility is paying for diesel fuel,the savings could amount to more than $63,000 per year. In Kipnuk,automatic generator paralleling switchgear was added as part of a project to construct a new power house. The switchgear automatically 'fits'the appropriate size generator to the electric load at a given time.This means the smaller gen-set is used to meet overnight loads while other units (either singly or together)meet the load requirements during high demand times. Matching the the generator with the load automatically instead of manually not only reduces fuel con- sumption but produces less wear and tear on the diesel engines. As is typical with Division- support powerhouse upgrades,a waste heat system was installed to recover thermal energy from the en- gine and use it to heat the Kipnuk Community Building. Pedro Bay has a unique electrical system:about 7.5 miles of electric line is installed directly in Lake I- iamna.Line losses are up to 50%. Replacing the system with a new overhead/underground distribution line and including new low-loss transformers means a 60%drop in line-losses -a considerable savings to the community. pplications for new loansAmtheDivisionofEnergy'sPowerProjectFund(PPF) will be accepted through 4 p.m.,Jan. 30,1998,in the Anchorage office, 333 West 4th Ave.,Suite 220.A total of $3 million will be available for new loans in this solicitation. Projects that can be considered under the PPF program include small-scale electrical power produc- tion facilities,conservation,bulk fuel storage,electrical transmission and distribution,waste heat facilities and potable water projects. Eligible borrowers are electric utilities,municipalities,regional and village corporations,village councils, and independent power producers. Once applications have been re- ceived,a technical and financial eval- uation will be performed for each applicant by Division staff.Upon completion of the analysis,recom- mendations are made to the Division Director who forwards all favorable recommendations to the Power Pro- ject Fund Loan Committee. Projects supported by previous Division PPF loans include: Tuntutuliak:Qinarmiut Corp., the Native Village Corporation,re- ceived a zero interest,$275,000 loan to assist in the construction of a new, code-compliant,bulk fuel tank farm. Term of the loan is 15 years. The current tank farm is in poor condition and recently suffered a sig- nificant gasoline spill.The PPF loan is being used to leverage additional funding sources.The Division cur- rently is engaged in design of the Pictured above is the Qinarmiut Corp.bulk fuel tank farm near Tuntutuliak.Qin- armiut has a Power Project Fund loan to assist in constructing a consolidated, code-compliant tank farm for the community. Weights,Measures and Conversions British Thermal Unit (Btu)Equivalents* Type of fuel Amount Number of Btu's Diesel Fuel 1 barrel (42 gallons)5,825,000 Gasoline 1 barrel (42 gallons)5,235,000 Aviation Gasoline 1 barre!(42 gallons)5,048,000 Coal (Alaskan)1 ton (2,000 Ibs.)16,440,000 Natural Gas 1,000 cubic feet (1 MCF)1,020,000 Wood (Sitka Spruce)]cord (128 cubic feet)17,100,000 *A Btu is the quantity of heat energy required to raise the temperature of one pound of water 1 degree farenheit at sea level. project. Wrangell:The City of Wrangell received a 2%interest,$350,000 loan to extend electric distribution to a new area of town that was previously unserved.The term of the loan is 15 years.The loan also filled an eco- nomic need because construction funded by the loan occurred when Wrangell faced tough times because of closure of its timber mill. Cordova:Cordova Electric Corp.received a zero interest,$1 million loan to fund preconstruction costs of the Power Creek Hydroelec- tric Project.The term of the loan is 15 years. Cordova's electricity is gener- ated 95%by diesel and 5%by the Humpback Creek Hydro project.Its electric rates are about double those of the Railbelt at about 20 cents/ kWh.The city issued a Request for Proposal (RFP)for a power supplier and chose a proposal that suggested tapping the hydroelectric potential of nearby Power Creek. The city then applied for the PPF loan to support its effort to develop the project and secure federal financ- ing.Cordova recently received its Federal Energy Regulatory Commis- sion license for the project,antici- pated to cost about $15 million. The project will not only stabi- lize electric rates for residential cus- tomers;it also will promote eco- nomic development by providing low cost energy to such businesses as fish processors. Saint Paul:The City of Saint Paul received a zero interest,$2.25 million loan to construct a new pow- erhouse.The loan term is 25 years. The existing powerplant was constructed by the National Marine Fisheries Service.NMFS left the is- land in 1982 and its facilities were transferred to the city.Although the city has upgraded system compo- nents,the existing powerhouse build- ing is old and clearly in need of replacement.The new powerplant will be sized for existing and guaran- teed loads but expandable at a moder- ate cost as growth dictates. Page 8,Energy Update,January 1998 Loans may be made to an organized municipality or an unincorporated village with a population under 2,000, or to a private individual who has a written endorsement from the governing body of the community. The loan must be repaid within one year.There is no interest on the first BFRLF loan.The second loan carries 5%interest.An interest rate based on the average weekly bond rates applies to subsequent loans. Rural Electrification Revolving Loan Fund:- 42.45.020 This loan fund is inactive except for the collection of the outstanding notes.The fund provided for loans to ex- tend electric service in areas previously not served. For more information on these programs,call 269- 4644 or 269-4628. OTHER PROGRAMS The Division administers several programs designed to provide training,technical assistance and capacity building.Specific program elements provide for: e Circuit Rider --Provides maintenance assessment and response service for emergency work needed on rural electrical systems.This program is intended to be an in- terim fix until long-term planning can address the prob- lems. e Power Project Planning:--Provides engineering,envi- ronmental,economic and financial assessment of power projects proposed for development by legislators,utilities and communities. e Rural Utility Training --Provides formal technical training of rural utility operators.To meet this need,em- phasis is placed on adapting and expanding existing pro- grams such as those provided by the Seward Skills Cen- ter,the University of Alaska,and the Job Training Part- nership Act. e Meter Installation and Data Acquisition --Provides for adequate metering of rural utilities and trains operators to accurately read and record meter data.This program also provides for installation of monitoring devices to record and transmit time-coded data necessary for planning pur- poses. e Rural Utility Business Management --Works toward the goal of creating self-supporting utilities in rural Alaska,to be achieved through: 1)the development of voluntary partnerships be- tween utilities,i.e.,private ownership,a cooperative or an operations and maintenance agreement with a larger utility, 2)utilities joining a regional utility entity;and, 3)the training of utility business managers and oper- ators. For more information on these programs call 269- 4625. ENERGY FUNDS The Division of Energy has statutory responsibilities for a number of other programs,including: Four Dam Pool Transfer Fund:-AS 42.45.050 This fund is the holder of the State loan to the Alaska Energy Authority for partial financing of the hydroelec- tric projects commonly known as the Four Dam Pool. When available the debt service on the loan is deposited in the fund and,subject to appropriation,is transferred to the following statutory funds for energy programs: e 40%--Power Cost Equalization and Rural Electric Capitalization Fund; e 40%--Southeast Energy Fund;and, ©20%--Power Project Fund. Utility Improvements Grant Program:-AS 42.45.180 Funded by the Power Cost Equalization and Rural Electric Capitalization Fund,this program provides for matching grants (75/25)to rural electric utilities that are eligible for Power Cost Equalization.The grants are for small projects to improve generation,distribution and bulk fuel facilities. This program was not active in FY 1997 because of funding limitations. Southeast Energy Fund:-AS 42.45.040 Utilities participating in the power transmission inter- tie between the Swan Lake and Tyee Lake hydroelectric projects are eligible for this grant fund. Electric Service Extension Fund:-AS 42.45.200 Provides for matching grants (60/40)to electric utili- ties as a first priority to extend service to private resi- dences and small businesses not currently served,and as a second priority for improvements to the existing utility system. This program was last funded in FY 1994.Current activities are limited to the completion and close-out of projects. For more information on the above programs,please call 269-4642 Energy Auditor Geoff Feiler discusses energy conserva- tion with elementary school children in Haines as part of the Division's Rebuild America program. Energy Update,January 1998,Page 5 _Department of Community &Regional Affairs |Division of Energy PROGRAMS OVERVIEW 333 West 4th Avenue,Suite 220;Anchorage,AK 99501-2341 Phone (907)269-4625 *Fax (907)269-4645 MISSION STATEMENT The Mission of the Division of Energy,DCRA,is to assist in the development of safe,reliable and efficient energy systems throughout Alaska that are financially viable and environmentally sound. BACKGROUND The Division is the link between the State Administration and about 200 rural communities regarding their energy and bulk fuel acquisition and storage needs.These are basic elements of the health,safety and economic base of those com- munities.The Division is the lead State agency regarding energy programs that affect rural Alaska and maintains ongo- ing contacts with the U.S.Department of Energy,U.S.Environmental Protection Agency and the U.S.Coast Guard. BULK FUEL ABOVEGROUND STORAGE TANK (AST)UPGRADES The Bulk Fuel AST Upgrades program provides as- sistance to communities in rural parts of Alaska.It cre- ates incentives and mechanisms to repair bulk fuel sys- tems before a crisis develops.This includes emergency repairs to storage and handling systems. Priority is given to communities whose fuel vendors or regulating agencies have threatened to halt delivery offuel,or where conditions have become a life,health and safety matter,or the environment is threatened. The program assists communities in recognizing the need to meet minimum standards and to develop consoli- dated facilities. In rural Alaska communities,fuel is needed to elec- trical generation,space heating and local transportation. Ninety-five percent of all the communities that the Divi- sion of Energy works with are not on the road system. Fuel can be delivered only once or twice a year,usually by barge to communities that are located in coastal areas or that are accessible by river when the waters are ice- free and navigable. To comply with current codes,almost all communi- ties in rural Alaska need to upgrade or rebuild the exist- ing above-ground bulk fuel storage systems.Deficiencies are associated with tank conditions,lack of protection for containing potential spills,as well as the piping systems to,and within,tank farms,etc. These types of deficiencies have been noted by fed- eral authorities such as the U.S.Coast Guard and the En- vironmental Protection Agency. Specific program elements provide for: e Rehabilitation or construction of new bulk fuel tank farms to meet State and Federal codes; ©Consolidation of tank farms; The Gambell bulk fuel tank farm. ©Reconstruction or replacement of piping at tank farms; e Spill prevention by assisting communities in re- sponse to regulatory actions that result in citations.This includes funding of needed repairs and preparation of Fa- cility Operations Manuals and Spill Prevention,Control and Countermeasure (SPCC)plans;and, e Assessments of bulk fuel facilities in rural Alaska. The Division maintains a bulk fuel data base for use in determining and pursuing future upgrade and repair pro- jects. For additional information on bulk fuel AST up- grades,please contact 269-4684. RURAL POWER SYSTEM UPGRADES The Rural Power Systems Upgrade program provides funding for systems upgrades that have been identified through technical assistance,Circuit Rider,the local Page 6,Energy Update,January 1998 community or the Legislature. Upgrades might include efficiency improvements, line assessments,lines to new customers,demand side improvements,and other repairs to generation and distri- bution systems. In rural communities throughout the state,electricity is generated by a local small system using diesel fuel at a Interior of the new powerhouse in Napaskiak show- ing new diesel generator units. cost this is three to five times higher than in the more ur- ban parts of the state. Out of 200 rural communities,about 120 are served by cooperatives or other from of utility that performs un- der a well-established organization.The other communi- ties,about 80,are served by very small entities,many of which experience technical and administrative problems due lack of economy of scale,lack of specialized skills in the community,etc. Electricity provides for lighting,communications and for power necessary to operate infrastructure that sup- ports all other elements needed in any community to per- mit safe and healthy living conditions. Specific programs elements provide for: e rebuilding or replacement of worn-out diesel gen- erator units; e rebuilding or replacement of old and hazardous dis- tribution systems; ©construction of new power generation systems that meet State and Federal codes; e inclusion of waste heat recovery systems,where possible,in new powerhouses; ©experience in rural construction,force account la- bor and technical assistance to rural communities through Division personnel and/or contractors; ®capital improvements to eliminate safety hazards and enhance efficiency; ®technical assistance to assess system deficiencies and design solutions;and, ©emergency response. For more information on the Rural Power Systems Upgrade program,please call 269-4697. ALTERNATIVE ENERGY The Alternative Energy Development program pro- vides for the evaluation and development of rural energy alternatives to oil-fired systems including small hydro- electric projects,electrical interties between villages,en- ergy conservation and,energy supply based on wood,municipal solid waste,wind,coal and natural gas.Specific program elements are: e Alaska Bioenergy Program provides technical and funding assistance for the use of biomass for heat and power production. The program is jointly funded by the U.S. Department of Energy and the State of Alaska. The program focuses on developing cost-effective demonstration projects.In Alaska,biomass includes wood,sawmill wastes,agricultural crops and municipal and industrial wastes. Current projects include wood-fired district heating system development in the Interior,wood waste fuel as- sessment in Southeast and feasibility studies for biomass- fired power production. e Rebuild America provides seed money to promote reductions in energy costs. The Rebuild program in Alaska is jointly funded by the U.S.Department of o™ne Energy and the State of =: Alaska.The Rebuild om America program isa part "ew |.of the Alaska State Energy Rebuild AmericaProgram(SEP).Other components of SEP are energy efficiency demonstration projects and technical support. Rebuild America funds are being used to provide contractual services for energy auditors and trainers to perform community building energy efficiency assess- ments in rural Alaska,including schools,community of- fices and clinics or washeterias.Training in no-cost or low-cost energy savings techniques are provided. ¢The Division is working with local utilities and the U.S.Department of Energy to develop wind energy re- sources in coastal areas.The wind program includes a major project in Kotzebue aimed at avaluating wind tech- nology alternatives and providing training,a smaller wind-diesel hybrid project in Wales,and wind resource monitoring in promising locations.nee Hydroelectric power generation is a renewable re- source ideal to replace fuel dependency.While the cost of operating and maintaining this type of project is low,the cost of constructing it is generally beyond the financial means of a rural community.Therefore,the Di- vision provides support to communities for project development.A hydroelectric project was recently completed in II- jamna and projects are underway or be- ing considered in Cordova,Unalaska and Old Harbor. In addition,the Division has recently updated its database on rural location where other hydroelectric pro- ject may be feasible and its database on where two or more communities can be connected by electric interties. Other elements of the Alternative Energy program in- clude: e Assessing feasibility of small coal-fired facilities to generate electricity and provide space heating for rural communities.Currently the Division is working with the U.S.Department of energy to develop a computer model to screen potential development sites. e Support for eventual development of the huge Northwest Arctic coal deposits; e Evaluation of shallow natural gas development and for the production and use of natural gas from Alaska's coal deposits;and, e An assessment of the feasibility of developing local electrical interties between communities in rural Alaska. For more information on Alternative Energy Devel- opment,please call 269-4631.For information on the Rebuild America program,call 269-4624.ooO0 00%ofaM POWER COST EQUALIZATION Power Cost Equalization (AS 42.45.100)reduces electric rates paid by consumers in rural communities where diesel-fired generators provide most of the local electricity. The program aims to roughly equalize the power cost per kilowatt hour (kWh)statewide at a cost close to the average cost per kilowatt hour in Anchorage,Fairbanks and Juneau. PCE is the core element that ensures the financial vi- ability of centralized power production in rural communi- ties.It thereby increases the standard of living through the availability of communications,lighting and the oper- ation of a variety of infrastructure including water and sewer systems,washeterias,incinerators,airports and ports and harbors. Up to 190 rural communities participate in the pro- gram with a total population of more than 76,000 people. PCE provides relief to more than 30,000 electric cus- tomers of the approximate 96 utilities involved. Program statutes exclude state and federal offices and facilities from PCE.Public schools and all other util- ity customers are generally eligible to receive PCE cred- its,as follows: ¢residential or commercial customers are eligible for Energy Update,January 1998,Page 7 PCE up to 700 kWh per month per customer;and, ®community facilities,as a group,can receive PCE credit for 70 kWh per month multiplied by the number of residents in the community. (_UTILITY costs \\ Costs NOT covered by PCE Costs up to *9 S¢/kwh PCE pays 95% of the verifiableCostsbetween *9.5¢/kwh and 52.5¢/kwh and reasonable costs in this bracket yy *Base may very on annual basis,per AS 42.45.110(c)(2). Costs NOT covered \U by PCE Costs up to *9.S¢/fkwh The program also provides training to bookkeepers, clerks and managers of rural electric utilities in running the utility in an efficient manner to meet Division and Alaska Public Utility Commission requirements for PCE participants. For more information on the PCE program and on utility training,please call 269-4630. LOAN PROGRAMS The Division administers three statutory funds which provide for energy projects and bulk fuel supplies:the Power Project Fund,Bulk Fuel Revolving Loan Fund, and the Rural Electrification Revolving Loan Fund. Power Project Fund:-AS 42.45.010 ¢Provides loans to local utilities,local governments or independent power producers for the development or upgrade of electric power facilities including conserva- tion,bulk fuel storage and waste energy conversion,or potable water supplies. The loan term is related to the life of the project.The interest rate is not less than zero and must be the lesser of the average weekly yield of municipal bonds for the 12 months preceding the date of the loan,or a rate the Divi- sion determines will allow the project to be financially feasible. Bulk Fuel Revolving Loan Fund:-AS 42.45.250 e Program assists ru- ral communities in pur- chasing annual bulk fuel supplies.The loan amount may not exceed 90%of the wholesale price of the fuel being purchased.The maxi- mum loan amount is $100,000. Page 8,Energy Update,April 1998 Division of Energy,DORA 333 W.4th Ave.,Suite 220 Anchorage,AK 99501-2341 (907)269-4500 FAX (907)269-4645 a a al i a eTALASICAPIVISION.Of, Volume 2,Issue 2 Department of Community &Regional Affairs April 1998 Study begins on possible 5 megawatt tidal energy system Free information available on high efficiency lights The Division of Energy sponsored three graduates of the May 5-June 27, 1997 Power Plant Operations Course at the Alaska Vocational Technical Center in Seward.Graduating from the eight-week course were (from left)David R.Nikolai of Kongiganak,Brian E.Apokedak Sr.of Levelock and James M.Manumik of Sheldon Point.Instructor for the course was Darrel Deeter.All Division students were employed following their certi- fication as either Diesel Plant Operators or Assistant Diesel Plant Opera- tors. The Division of Energy is spon- soring 800 number and e-mail access for Alaskans to call for free informa- tion on high efficiency lighting prod- ucts. The company providing the ser- vice is Design Lighting Lab of Seat- tle.Just dial 800-354-3864 and ask for Randy Smith or e-mail him at: randy.smith @ci.seattle.wa.us. Design Lighting Lab is neither owned nor sponsored by any one electric or electronics-related com- pany. Information ranges from new lighting systems to retrofits and in- cludes particulars on which lighting products work best in extreme weather conditions. ork has begun on a $600,000 feasibility study for a 5 megawatt tidal energy facility being considered in Cordova. Conducted by Tidal Energy of Alaska Inc.(TEA),the year-long study is financed jointly by TEA par- ent company Tidal Electric Inc.,the Alaska Science and Technology Foundation,and the Division of En- ergy. Tidal ranges in Bristol Bay,Cook Inlet,and Southeast Alaska average between 10 to 35 feet,making the south coast of the state a promising area for demonstrating Tidal Elec- tric's patented technology. Unlike earlier barrage systems, which are connected to land and may restrict fish migration,Tidal En- ergy's design impounds water off- shore. Three chambers of an impound- ment structure are sited on the ocean's bottom.At high tide the structure is filled with water.After the tide recedes,water is drained from a chamber and power is gener- ated using conventional hydroelectric equipment. As the tide floods,water is blocked from entering the chamber, thus allowing power to be generated using the head developed at high tide. The three-chamber design allows the operator to vary timing of power gen- eration to best meet load require- ments. In This IssueBulkFuelLoans.......sen 2NoatakPiping...vetecnecbucseenctneets OTananaLightingREOen4StreamGauging..5 6PowerhouseUpgrades........cecescceceee Supplanting Diesel Fuel .......2:.avaceeens 7 Artist's rendering of a potential tidal energy project. TEA has provided an_initial rough cost of $14 million for a 5 mW project in Cordova--$3 million for equipment and $11 million for im- poundment.The area enclosed by the impoundment would be approxi- major part of the feasibility work. Participants in the study include Cordova Electric Cooperative, Golder Associates and R&M Consul- tants of Anchorage,the Prince William Sound Science Center,ABB mately one square mile.Power Generation of Colorado,Ener- Refining the design and cost esti--getics of Washington D.C.,and Yalematefortheimpoundmentwillbea-_University. Division responds to Port Graham emergency he Division responded to its first bulk fuel emergency this year by replacing a fill pipeline in Port Graham that was damaged when the cannery under which it was placed was destroyed by fire in January.Port Graham is located on the Kenai Peninsula southwest of Seldovia. The Division sent a welder in February to replace two 350-foot threaded pipelines that ran from the marine fill point to the Port Graham Corporation tank farm.The project cost about $20,000. The work was done in close consultation with Greg McMullan of the Native Village of Port Graham and Pat Norman,president of Port Graham Corporation,created under the Alaska Native Claims Settlement Act of 1971. Most rural communities receive fuel shipments via barge or other water- borne transport.The fuel typically is off-loaded from the barge and transferred to storage tanks thorugh small pipelines. Most transfer systems have two pipes:one for heating fuel and one for gasoline.The diameter of fill pipe usually is three inches. The Division bulk fuel emergency response program makes funds avail- able to respond to bulk fuel emergencies in the event of disasters such as fires, floods or environmental hazards to the community. Page 2,Energy Update,April 1998 From the Director ...Percy E.Frisby he mission of the Division of Energy is to assist in the devel- opment of safe,reliable and efficient energy systems and bulk fuel storage systems throughout Alaska.There are about 200 rural communities in our state and their energy and bulk fuel needs are great. The Division's response to these needs begins at the community level. A community starts the process by writing a letter which outlines the need and provides a description of the project which should have strong support within the community. The letter should come from the parties involved such as the electric utility,tank farm owner or the gov- ering body -municipal govern- ment or tribal council.Once we have the letter,the Division can respond to the request. Funding limitations are such that the Division is hard pressed to fund a project in its entirety.It is important that the community bring something to the table -cash,in-kind services and equipment,land on which to con- struct a facility,etc. A combination of Division assis- tance in the form of grants and loans and a community contribution can be used to secure alternative funding for an energy project. Cooperation from the beginning and consensus between all parties on what needs to be done is absolutely necessary to develop a successful project. Plan early for bulk fuel loan applications pril means warmer weather, longer days and breakup is un- derway for much of rural Alaska.It also is the month when applications for loans under the Division's Bulk Fuel Revolving Loan Fund (BFRLF) start coming in. Communities with less than 2,000 residents can apply for loans of up to $100,000 per fiscal year to purchase bulk fuel supplies.Loans usually are made to community gov- ering bodies although individuals and private companies can apply if they have an endorsement from the community. During the 1997/1998 heating season,the Division received appli- cations and approved loans for about 45 communities.The size of the average loan was $60,000.As of this month,the total outstanding amount for all loans was about $1.3 million. BFRLF staff advise prospective applicants to submit their applica- tions 45 days in advance of the antici- pated delivery date.This allows for the loan to be processed and ap- proved before delivery of fuel. This is important because loans cannot be made for fuel that is al- ready consumed.The fuel that is pur- chased with the loan is the asset which will be used to repay it. The loan pays up to 90%of total fuel cost.The borrower must pay for 10%of the total amount of fuel pur- chased.Loans must be repaid in nine months with a limit of one loan per fiscal year.A borrower will remain ineligible to receive another loan un- til all prior loans are repaid. Interest rates are 0%for the first loan,5%for the second loan and an average municipal bond yield for subsequent loans.Currently that rate is about 5.72%. As a revolving loan fund,money becomes available for new loans only as repayments are made on existing loans.The fund started with an initial balance of $2,752,700.The amount that can be borrowed was increased from $50,000 to $100,000 in 1993. Division staff also urge prospec- tive applicants to think in terms of annual purchases and not just the amount that will get the community through the winter.Bulk buys,for example,can be made in spring for summer demand and again in the fall to top off the tanks for winter. For more information on the Bulk Fuel Revolving Loan Fund,please call 269-4628 in Anchorage. Weights,Measures and Conversions Rural Building Construction Costs* Number of Square Feet 500 to 1,500 Square Feet 1,500 to 2,500 Square Feet 2,500 to 3,500 Square Feet 3,500 to 5,000 Square Feet Cost Per Square Foot $175 to $150 per Square Foot $150 to $135 per Square Foot $135 to $125 per Square Foot $125 to $100 per Square Foot *Building only;does not include specialized equipment or applications.Assume 40%for materials,30%labor,20%freight &10%administration. Energy Update Energy Update is published quarterly in January,April,July and October by the Division of Energy,Alaska Department of Community and Regional Affairs.Energy Update is supported by funding from the State of Alaska and the U.S.Department of Energy. For more information,contact (907)269-4625; fax (907)269-4645. Tony Knowles,Governor State of Alaska Mike Irwin,Commissioner Community &Regional Affairs Percy Frisby,Director Division of Energy This publication is available on the Intemet at the State of Alaska homepage.Printed at a cost of 50 cents per issue.Send address changes to:Division of Energy,333 W.4th Ave.,Ste.220,Anchorage,AK 99501-2341. The State of Alaska is an Equal Opportunity Employer.Printed on recycled paper. Energy Update,April 1998,Page 7 New boilers supplant use of diesel fuel Arnie which added new The Iliamna-Newhalen-Non- electric-powered boilers to the -_dalton Electric Cooperative (INNEC)Newhalen and Nondalton schoolshas __used part of a Division of EnergyenabledtheLakeandPeninsulaBor-_Utility Improvement Grant to installoughSchoolDistricttoconsiderably_the electric boilers. reduce its heating costs.The boilers use electricity pro- Peninsula School Borough Nondalton facility.The boiler uses off-peak power produced by the Tazimina Hydroelectric Project. Above center is the new electric-powered boiler installed in the Lake and New burner available for waste oil Disposing of waste oil and rages may become less of a problem in rural Alaska with the introduction or a new,portable waste burner. The "Smart Ash”system meets U.S.Environmental Protection Agency and Alaska Department of Environmental Conservation regulations as an accepted method of on-site disposal of combustible waste including used lube oil,oily rags,absorbent materials,used filters,paper and wood by-products. The Smart Ash unit,which sells for about $3,000,attaches to a 55-gallon open-head drum.Once the unit is plugged in and lit,a pair of blowers create a cyclone of air which fans the fire to white hot temperatures. The unit's design eliminates smoke and traps fly ash for easy disposal.The manufacturer claims there is no other residue,half-burned material or smolder- ing cake. The Smart Ash can also be used in conjunction with the "Smart Heat Energy Recovery Furnace”to capture waste heat for use in space heating. Spill Shield International has the statewide distribution rights for both the burner and heat recovery units.The company can be reached in Anchorage at 561-6033 for more information and for the names of companies currently using the equipment in Alaska. The Division of Energy,from time to time,provides information on new products and equipment which may be of interest to rural communities on energy and bulk fuel-related matters.Providing such information in no way represents an endorsement of the products or equipment by the Division. duced by the Tazimina Hydroelectric Project during off-peak hours.The Tazimina hydro project went on line in May 1997. INNEC energy generated by the project during off-peak periods is made available to the school district at a cost of 27 cents per kilowatt hour instead of the normal 47 cents per kWh day time rate. The electric cooperative man- aged the design,construction and in- stallation of all equipment for the project.The Division,in addition to providing grant funding,reviewed the design an performed a final in- spection upon completion of the pro- ject. Using the lower cost,off-peak electricity allows the school district to shut down its existing diesel-fired boilers during evening and night hours. Off- set- ting the use of fuel can amou nt to significant savings because diesel fuel in the area is not cheap -aver- aging between $1.10 and $1.15 per gallon. The new boilers are part of an overall project which will also pur- chase and install new time-of-day metering equipment.The new meters will replace existing meters which cannot distinguish what time during the day that power is being used. The meters will enable electric utility customers to shift some of their demand to off-peak hours to take advantage of the lower rates. This should,in turn,stimulate new electrical demand that would have been provided -for the most part - by more costly fuel oil and propane. The new demand will be met - as with the electric boilers -by surplus power generated by the Taz- imina hydro project. Page 6,Energy Update,April 1998 Energy Update,April 1998,Page 3 Powerhouse projects completed in 3 communities owerhouse upgrade projects have been recently completed by the Division of Energy in the communi- ties of Atmautluak,Levelock and Diomede. The Atmautluak Joint Utilities project,which was completed at a cost of about $200,000,replaced ex- isting diesel generator units that were in poor condition with new units. The work included: e purchasing and installing two, 150 kilowatt diesel generator units and an optional 60 kW unit complete with new exhaust systems; e installing new switchgear,aux- iliaries,miscellaneous electrical equipment and a grounding system; and. e modifying the fuel system and installing new radiators,a new dia- mond floor and new interior paint. The Levelock electric Coopera- tive Inc.project overhauled an exist- ing gen set engine and installed a complete fire protection system in the powerhouse. The work also corrected a sag- ging problem with the distribution system and installed new electrical poles where existing poles could not longer be used.Total cost of the project was about $200,000. The Diomede Joint Utilities pro- ject included design and construction of a new powerhouse including a new 205 kilowatt generator set to replace Piping system runs from airport to tank farm Pictured above are the two new 150 kW diesel generator units and a 60 kW gen set in the refurbished Atmautluak powerhouse.Also installed were new Switch gear,auxiliaries and a grounding system. an existing temporary facility. The original powerhouse had been destroyed by fire several years earlier and was replaced with the temporary emergency metal power- house shortly thereafter. The new 20-foot by 34-foot pan- elized powerhouse,which also in- cludes two gen sets from the tempo- rary structure,is located away from ocean salt water spray the beach head which is subject to erosion. Total cost of the project,which was constructed under the Utility Im- provement Grant program,was about $156,000 with the Division con- tributing $116,771 and the utility contributing $32,924. Caution urged with tritium exit signs _ he Division recently completed a major piping project in Noatak which enables heating fuel to be safely transferred from the airport to bulk fuel tank farms in town. The tank farms are owned by the Northwest Arctic School District, Native Village of Noatak IRA Coun- cil and Alaska Village Electric Coop- erative Inc. For a number of years,fuel was barged to the community on the Noatak River.However,the river is no longer of adequate depth permit barge service.This means heating fuel must now be flown in,off loaded at the airport and transferred to the tank farms. Before the piping project,the fuel was hauled from the airport into town.With every filling and empty- ing of the transfer tank came another opportunity for a fuel spill which was of great concern to residents. The project's scope of work en- tailed constructing a new fill pipeline of welded steel pipe from the airport to the IRA tank farm.A "T”connec- tion was made to connect the fill line with the school district tank farm. This part of the project cost about $100,000. The AVEC tank farm also was connected to the system.This part of the project also cost about $100,000 Atmautluak powerhouse operators are,from left:Ralph Pavilla and Harry Gilman. Exit signs powered by tritium, which is a radioactive gas,were in- stalled in a number of rural schools in the late 1980s.The gas is encapsu- lated in a glass tube within the sign. Under normal conditions,these pose no threat to life. Tritium has a half life of 12 years,so these exit signs are going out and need to be disposed of in a proper manner. The problem was reported to the Division of Energy by contractors hired to perform energy audits on community buildings,including schools in rural areas.In most in- stances,school district personnel al- ready knew the signs were in use. The U.S.Environmental Protec- tion Agency strongly recommends that the signs be disposed of in con- trolled municipal landfills such as those found in Anchorage and Fair- banks.They should be packaged carefully for shipping to avoid break- age. The danger of disposing of tri- tium exit signs in local land fills is that if the glass tube is broken,tritium gas will be released into the atmo- sphere.Children playing with the signs,for example,could be exposed to a serious hazard. For more information in dealing with tritium-powered exit signs, please contact Cristina Klein,Divi- sion of Energy,at 269-4624. with both the Division and AVEC contributing. The manifold system -the pip- ing and valves within the tank farms -in all three tank farms was re- placed with steel pipes and stainless steel valves. The work brought the fuel deliv- ery system up to applicable State and Federal codes and regulations. The new manifold piping for the Northwest Arctic School District tank farm in Noatak includes a pressure relief device which can be seen as a small conduit on the tank at left. Bulk fuel assessments underway soon Pictured above is the new fill point located near Noatak's airport. he final phase of a three-year effort to survey bulk fuel tank farms in rural Alaska gets underway this spring as soon as retreating snow and ice permit close-up inspection of tank farm facilities. This summer,Division contrac- tors will perform assessments in a total of 81 communities.That num- ber includes 20 communities held over from last year when deteriorat- ing weather conditions prevented completion of the work. The purpose of the assessments is to acquire essential data on all bulk fuel storage facilities in a community and the condition of each tank farm. Clusters of 1-10 communities are used to maximize efficiency in data collection. Prior to the field investigation, existing data on bulk fuel facilities in each community is researched from Division files and other sources. Aerial view maps and other sketches of CAD (computer aided drafting) drawings are also collected. The contractor will then prepare field sketches of existing tank farms showing tanks,pipes,dikes,fencing and other appurtenances as well as proximity to roads,buildings,water- ways,wells,etc.These sketches will be completed as CAD drawings. Detailed field notes describing tank size,foundations and condition; and electrical systems,among others, will be made.This information will then be entered into the Division's Bulk Fuel Data Base. The data base provides recent and accurate information to the Divi- sion which it uses in its process of developing bulk fuel tank farm repair and upgrade projects. This year's survey will bring to 161 the number of communities in which tank farms have been in- spected.This accounts for virtually all smaller communities in rural Alaska that are off the road/rail sys- tem. Page 4,Energy Update,April 1998 Energy Update,April 1998,Page 5 Tanana school receives complete lighting retrofit Stream gauging leads to small hydroelectric project Division of Energy contractor recently completed a total light- ing retrofit for the Tanana City School buildings.This demonstration project is expected to reduce lighting costs in the school by up to 33%. The project,which was com- pleted by Alaska Commercial Light- ing of Anchorage at a cost of about $22,000,was funded with $17,000 in USDoE State Energy Program (SEP) money and a $5,000 contribution from the Tanana School District. Alaska Commercial Lighting won the contract over other bidders. The Tanana school was selected for a demonstration project based on: ®recommendations from Divi- sion of Energy Rebuild America con- tractors assessing energy use in rural community and school buildings. e ahigh local electric rate -42 cents per kilowatt hour compared to 9 cents per kWh in Anchorage;and, e the Tanana School District's willingness to provide matching funds and to collect follow-up data on energy savings over the next year. Both former Tanana Schools Su- perintendent Ron DeLay and current Superintendent Dick Curtis helped to bring this project to completion. Lighting retrofits can be espe- Above are two examples of light emitting diodes which replace reg- ular bulbs in exit signs. cially beneficial in rural community and school facilities where electrical rates are high and where the long nights and short winter days increase lighting demands.Tanana,for exam- ple is located about 100 miles south of the Arctic Circle and northwest of Fairbanks. The Division's State Energy Pro- gram (SEP)is funded by the U.S. Department of Energy.Demonstra- tion projects are aimed at promoting information about the savings that high efficiency lighting and equip- ment can yield. Throughout the school,older T- 12 fluorescent tubes were replaced with higher efficiency T-8s (the num- bers relate to tube width).Older magnetic ballasts were replaced with high efficiency electronic ballasts.A ballast is a device that regulates the electric energy going into the tube. High efficiency compact fluores- cent bulbs,which are four times more efficient than incandescent bulbs,and exit signs using light-emitting diodes (LED)were also installed.LEDs reduce energy consumption from 30- 40 watts to 1.8 watts,a 90%reduc- tion,said Mike McGrath,owner of Alaska Commercial Lighting. Motion sensors (both infrared and ultrasonic)were installed in the bathrooms so lights would turn off when the spaces are not occupied. Infrared motion sensors turn lights on and off by sensing a moving source of heat;ultrasonic sensors control lighting through the use of ultra high frequency sound.The use of motion sensors have been found to cut light bills by 50%in restrooms and confer- ence rooms,30%in corridors and offices and 60%in store rooms,ac- cording to contractor Mike McGrath. In the school gym,used for daily athletic events and community pro- grams,250 watt super metal halide lights were installed in place of the older 400 watt mercury vapor lamps. The amount of light produced has increased by 60%,with a decrease in electricity use. To comply with EPA regulations, 852 pounds of old ballasts containing Compact flourescents,such as the one above,were installed through- out the Tanana school. hazardous PCBs were shipped by the contractor to an Environmental Pro- tection Agency (EPA)approved dis- posal site in Arizona. Each year,the Division hopes to fund two or three energy saving demonstration projects,according to Cristina Klein,Rebuild America Pro- gram Manager and SEP coordinator for the Division.These projects are expected to demonstrate to rural building managers the dramatic sav- ings that can be gained by converting to high efficiency products like light- ing.Paybacks are so short,generally under two years,that retrofits can usually be paid for out of current operating budgets,or phased in over a couple of years. Contractor McGrath expects the savings in Tanana to be substantial. He recently convinced his condo- minium association in Anchorage to retrofit lighting and install motion sensors in the garages.The associa- tion spent $4,000 to do the work.In the first year of use,the electric bill for the garages went from $16,000 to $9,100,a payback of just over half a year. For more information on energy saving products and retrofits,please contract Cristina Klein @ 269-4624. multi-year stream gauging effort on Goat Lake has resulted in a small hydroelectric project by Alaska Power and Telephone (AP&T)that currently provides for 100%of Skag- way's electricity needs. The project includes a small lake tap which generates power using wa- ter that would normally drain from the lake in a steep stream bed.The glacial lake does not support salmon or other fish species. Goat Lake is part of a quintet of stream gauging projects either under- way or recently completed by the Division of Energy. No state money is involved in the projects.Roughly one-half of the cost of each stream gauging project is paid for by the U.S.Geological Sur- vey with the remainder paid for by the utility or company which origi- nally requested the stream survey. The USGS cannot grant funds directly to private entities.The Divi- sion served to both manage the pro- jects and to act as a conduit for the USGS share of the projects.This was true of all five projects.All stream flow data has been or will be available to the public. In addition to Goat Lake,the Di- vision supported stream gauging at the outlet of Wolf Lake in the Skag- way vicinity for AP&T.That project concluded when the decision was made to press on with the Goat Lake hydro project. And the Division provided sup- port for an Upper Chilkoot Lake gauging project on behalf of USGS and Haines Light and Power.That project was completed in June 1997. Two projects remain active. Work is proceeding at Dorothy Lake on behalf of Alaska Electric Light & Power of Juneau.Dorothy Lake is located 17 miles southeast of Juneau south of Taku Inlet.This project is to run through FY 2001. The Greens Creek stream gaug- ing project is located 19 miles south- west of Juneau on Admiralty Island and is being performed with Ken- necott Minerals.Kennecott indicated it will use the information for an environmental assessment. Stream flow records will be pub- lished for public use.This project also runs through FY 2001. Stream outlet at Goat Lake in Southeast. Stream gauging equip- ment measured water flow to determine feasi- bility of a small hydro- electric project. Forest Expo May 9-11,Prince George,BC.Largest forestry trade show in North America. Expo,ph:604-563-8833 or Web www.forestnet.com/ log&saw/feb/expo.htm. Contact Forest wind monitoring program.Sponsored by Division of En- ergy.Contact Dennis Meiners,ph:907-465-4632,fax: 907-465-5867,email:dmeiners @comregaf.state.ak.us. x ke & North American Waste-to-Energy Conference May 11-13,Miami,FL.Sponsored by Solid Waste Association of North America.Ph:503-778-1029,email techni- cal_services@swana.org,web:http:/Awww.swana.org. Renewable Energy Technologies in Cold Climates '98 May 4-6,Montreal,Quebec.Sponsored by the Solar Energy Society of Canada.Phone 613-234-7004,Fax 613-234-2988,Email retccc.98@sympatico.ca,Web www.newenergy.org/newenergy/scsci.html. Wind Resource Assessment Workshop May 27-28, Anchorage.Fundamentals of conducting a successful Publications Energy Efficiency and Renewable Energy Clearing- house provides free information in response to phone, mail,and email inquiries..Supported by U.S.Department of Energy.Ph:800-363-3732.Web:http:// www.eren.doe.gov/ zk *«* MotorMaster+2.0.Recently updated software for select- ing energy efficient motors and analyzing cost and energy savings.Distributed through the U.S.Department of Energy's Motor Challenge program.Web:_http:// www.motor.doe.gov/.For technical support contact David Lockard 907-269-4541 at the Division of Energy,333West4”Ave.,Anchorage,AK 99501. DOE F 1600.5 (06-94) OMB Control No.1910-0400 All Other Editions Are Obsolete U.S.Department of Energy Assurance of Compliance Nondiscrimination In Federally Assisted Programs a OMB Burden Disclosure Statement Public reporting burden for this collection of information is estimated to average 15 minutes per response,including the time for reviewing instructions,searching existing data sources,gathering and maintaining the data needed,and completing and reviewing the collection of information.Send comments regarding this burden estimate or any other aspect of this collection of information,including suggestions for reducing this burden,to Office of Information Resources Management Policy,Plans,and Oversight,HR-4.3,Paperwork Reduction Project (1910-0400),U.S. Department of Energy,1000 Independence Avenue,S.W.,Washington,DC 20585;and to the Office of Management and Budget (OMB),Paperwork Reduction Project (1910-0400),Washington,DC 20503. (Hereinafter called the "Applicant") HEREBY AGREES to comply with Title VI of the Civil Rights Act of 1964 (Pub.L.88-352),Section 16 of the Federal Energy Administration Act of 1974 (Pub.L.93-275),Section 401 of the Energy Reorganization Act of 1974 (Pub.L.93-438),Title 1X of the Education Amendments of 1972,as amended,(Pub.L.92-318,Pub.L.93-568,and Pub.L.94-482),Section 504 of the Rehabilitation Act of 1973 (Pub.L.93-112),the Age Discrimination Act of 1975 (Pub.L.94-135),Title VII!of the Civil Rights Act of 1968 (Pub.L.90-284),the Department of Energy Organization Act of 1977 (Pub.L.95-91),the Energy Conservation and Production Act of 1976,as amended,(Pub.L.94-385)and Title 10,Code of Federal Regulations,Part 1040.In accordance with the above laws and regulations issued pursuant thereto,the Applicant agrees to assure that no person in the United States shall,on the ground of race, color,national origin,sex,age,or disability,be excluded from participation in,be denied the benefits of,or be otherwise subjected to discrimination under any program or activity in which the Applicant receives Federal assistance from the Department of Energy. Applicability and Period of Obligation In the case of any service,financial aid,covered employment,equipment,property,or structure provided, leased,or improved with Federal assistance extended to the Applicant by the Department of Energy,this assurance obligates the Applicant for the period during which Federal assistance is extended.In the case of any transfer of such service,financial aid,equipment,property,or structure,this assurance obligates the transferee for the period during which Federal assistance is extended.If any personal property is so provided,this assurance obligates the Applicant for the period during which it retains ownership or possession of the property.In all other cases,this assurance obligates the Applicant for the period during which the Federal assistance is extended to the Applicant by the Department of Energy. Employment Practices Where a primary objective of the Federal assistance is to provide employment or where the Applicant's employment practices affect the delivery of services in programs or activities resulting from Federal assistance extended by the Department,the Applicant agrees not to discriminate on the ground of race, color,national origin,sex,age,or disability,in its employment practices.Such employment practices may include,but are not limited to,recruitment,advertising,hiring,layoff or termination,promotion,demotion, transfer,rates of pay,training and participation in upward mobility programs;or other forms of compensation and use of facilities. Subrecipient Assurance The Applicant shall require any individual,organization,or other entity with whom it subcontracts, subgrants,or subleases for the purpose of providing any service,financial aid,equipment,property,or structure to comply with laws and regulations cited above.To this end,the subrecipient shall be required to sign a written assurance form;however,the obligation of both recipient and subrecipient to ensurecomplianceisnotrelievedbythecollectionorsubmissionofwrittenassuranceforms. Data Collection and Access to Records The Applicant agrees to compile and maintain information pertaining to programs or activities developed as a result of the Applicant's receipt of Federal assistance from the Department of Energy.Such information shall include,but is not limited to the following:(1)the manner in which services are or will be provided and related data necessary for determining whether any persons are or will be denied such services on the basis of prohibited discrimination;(2)the population eligible to be served by race,color, national origin,sex,age,and disability;(3)data regarding covered employment including use or planned use of bilingual public contact employees serving beneficiaries of the program where necessary to permit effective participation by beneficiaries unable to speak or understand English;(4)the location of existing or proposed facilities connected with the program and related information adequate for determining We.Marylencl Uris \Gter \Puug RESPONSIBILITY MATTERS;AND DRUG-FREE WORKPLACE REQUIREMENTSApplicantsshouldrefertotheregulationscitedbelowtodeterminethecertificationtowhichtheyarerequired to_attest.Applicants should also review the instructions for certification included in the regulations before completing this form.Signature of this form provides for compliance with certification requirements under 10 CFR Part 601 and 10 CFR Part 1036.The certifications shall be treated as a material representation of fact upon which reliance will beplacedwhentheDepartmentofEnergydeterminestoawardthecoveredtransaction,grant,or cooperativeagreement. 1.Lobbying :,-- The undersigned certifies,to the best of his or her knowledge and belief,that: (1)No Federal appropriated funds have been paid or will be paid,by or on behalf of the undersigned,to any person for influencing or attempting to influence an officer or employee of any agency,a Member of Congress,an officer oremployeeofCongress,or an employee of a Member of Congressin connection with the awarding of any Federal contract,the making of any Federal grant,the making of any Federal loan,the entering into of any cooperative agreement,and the extension,continuation,renewal,amendment,or modification of any Federal contract,grant,loan, or cooperative agreement. (2)If any funds other than Federal appropriated funds have been paid or will be paid to any person for influencing or attempting to influence an officer or employee of any agency,a Member of Congress,an officer or employee of Congress,or an employee of a Member of Congress in connection with this Federal contract,grant,loan,or cooperative agreement,the undersigned shall complete and submit Standard Form-LLL,"Disclosure Form to Report Lobbying,”in accordance with its instructions. (3)The undersigned shall require that the language of this certification be included in the award documents for all subawards at all tiers (including subcontracts,subgrants,and contracts under grants,loans,and cooperative agreements) and that all subrecipients shall certify and disclose accordingly. This certification is a material representation of fact upon which reliance was placed when this transaction was made or entered into.Submission of this certification is a prerequisite for making or entering into this transaction imposed by section 1352,title 31,U.S.Code.Any person who fails to file the required certification shall be subject to a civil penalty of not less than $10,000 and not more than $100,000 for each such failure. AASAASASAAAR AAAS=DEBARMENT,SUSPENSION,AND OTHER RESPONSIBILITY MATTERS :eee” (1)The prospective primary participant certifies to the best ofits knowledge and belief,that it and its principals: (a)Are not presently debarred,suspended,proposed for debarment,declared ineligible,or voluntarily excluded from covered transactions by any Federal department or agency; (b)Have not within a three-year period preceding this proposal been convicted of or had a civil judgment rendered against them for commission of fraud or a criminal offense in connection with obtaining,attempting to obtain,or performing a public (Federal,State or local)transaction or contract under a public transaction; violation of Federal or State antitrust statutes or commission of embezzlement,theft,forgery,bribery. falsification or destruction of records,making false statements,or receiving stolen property; (c)Are not presently indicted for or otherwise criminally or civilly charged by a governmental entity (Federal,State or local)with commission of any of the offenses enumerated in paragraph (1 Xb)of this certification;and (d)Have not within a three-year period preceding this application/proposal had one or more public transactions (Federal,State or local)terminated for cause or default. (2)Where the prospective primary participant is unable to certify to any of the statements in this certification,such prospective participant shall attach an explanation to this proposal. 3°DRUG-FREE WORKPLACEThiscertificationisrequiredbythe Drug-Free Workplace Act of 1988 (Pub.L.100-690,Title V,Subtitle D)and iis implemented through additions to the Debarment and Suspension regulations,publishedin the Federal Register on January 31,1989,and May 25,1990. ALTERNATE I (GRANTEES OTHER THAN INDIVIDUALS) (1)The grantee certifies that it will or will continue to provide a drug-free workplace by: (a)Publishing a statement notifying employees that the unlawful manufacture,distribution,dispensing,possession,or use of a controlled substance is prohibited in the grantee's workplace and specifying the actions that will be taken against employees for violation of such prohibition; DISCLOSURE OF LOBBYING ACTIVITIES .Complete this form to disclose lobbying activities pursuant to 31 U.S.C.1352(See for publicb ApprovedbyOMB dit ) 1.T of Federal Action:Cle contract f.loan insurance 2.Status of Federal Action: [__]a.bid/offer/application b.grant initial award c.cooperative agreement c.post-award d.loan e.loan guarantee 3.Report Type:Cie initial filing b.material change For Material Change Only: year quarter date of last report 4.Name and Address of Reporting Entity: [J Prime [___]subawardee Tier _if known. Congressional!District,if known: 5.If Reporting Entity in No.4 is Subawardee,Enter Name and Address of Prime: Congressional District,if known: 6.Federal Department/Agency: U.S.Department of Energy 7.Federal Program Name/Description: CFDA Number,ff applicable:81-078 8.Federal Action Number,if known:9.Award Amount,if known: $ 10.a.Name and Address of Lobbying Registrant (if individual,last name,first name,MI): b.Individuals Performing Services (including address if different from No.10a) (last name,first name,MI): tems 11 through 15 are deleted. 16 iWformation requested through thie form is authorized by tite 31 U.S.C.section1352.ThisGscioeureoflobbyingactivitiesisamaterialrepresentationoffactuponwhichredancewasplacedbytheterabovewhenthistransactionwasmadeorenteredinto.This decioeure is requiredpursuantto31U.S.C.1352.This information wil be reported to the Congress semi-annunily andwillbeavailableforpubicinepection.Any person who fais to file the requred disclosure shall betubjecttoacivilpenaltyofnotlessthen$10,000 and not more than $100,000 for each euch fulure. =SS SereROR Signature: Print Name: Title: Telephone No.:Date: Authorized for Local ReproductionooENStandardForm-LLL EPACT REPRESENTATION Section 2306 of the Energy Policy Act of 1992,Pub.L.102-486 establishes eligibility requirements for companies to participate in certain financial assistance programs covered under Titles XX through XXIII of the EPAct.For this purpose,"company"means any business entity other than an organization of the type described in section 501(c)(3)of the Internal Revenue Code of 1954 (26 U.S.C.Section 501(c)(3)}].In order for the Department of Energy (DOE)to make an award to a company under a covered program, DOE must determine that the company's participation will be in the economic interest of the United States and,if the company is not a United States-owned company,that the parent company is incorporated in a foreign country that:affords national treatment to United States-owned companies with regard to access to Government-supported joint ventures in energy research and development;affords national treatment to United States-owned companies with regard to general investment opportunities;and affords protection to intellectual property rights owned by United States-owned companies.To assist DOE in making these determinations,the applicant must answer the following questions and make the representation provided therein.In the event the information submitted is inadequate for DOE to make a determination,DOE will request such additional information as may be required. Company Ownership Information: (Include this information for each participant in a joint venture.) 1.Is your company a United States-owned company?Yes No (U.S.-owned company means (1)a company that has majority ownership by individuals who are citizens of the United States,or (2)a company organized under the laws of a State that either has no parent company or has a parent company organized under the laws of a State.) 2.If no,identify the place in which the parent company is incorporated or organized. Economic Interest Information: 1.Will this project result in investments in the U.S.in research and development?Yes__.Ss No__- If the answer is yes,what percentage of the total estimated cost of the project will be expended in the U.S.?(Contractor and supplier costs are to be included in total estimated costs.)Also, express in terms of dollars.%ao---$ 2.Will this project result in investments in U.S.in manufacturing?Yes No If the answer is yes,what percentage of the total estimated cost of the project including contractor and supplier costs will be expended in U.S.manufacturing?Also,express in terms of dollars. %--$ 3.Will this project contribute to U.S.employment?Yes__s-No If the answer is yes,briefly describe how. 4.Does the applicant agree that it will promote the manufacture within the U.S.of products resulting from any resultant technology and competitively procure parts and materials?Yes No Briefly describe plans,if any,for any manufacturing of products arising from the program supported research and development,including the location where such manufacturing is expected to occur. if your answer is no,please explain. 5.What other benefits to the U.S.will result from this project? To the best of its current knowledge and belief,the applicant represents that the informationprovidediscurrent,accurate,and complete and will advise DOE of any changes priorto award. Applicant Title Signature Date Simpson-Craig Amendment Representation bac Applicant organizations which are described in section 501(c)(4)of the Internal Revenue Code of 1986 and engage in lobbying activities after December 31,1995,shall not be eligible for the receipt of Federal funds constituting an award,grant,or loan.Section 501(c)(4)of the Internal Revenue Code of 1986 covers: "Civic leagues or organizations not organized for profit but operated exclusively for the promotion of social welfare,or local associations of employees,the membership of which is limited to the employees of a designated person or persons in a particular municipality, and the net earnings of which are devoted exclusively to charitable,educational or recreational purposes.” As set forth in Section 3 of the Lobbying Disclosure Act of 1995,as amended,(2 U.S.C.1602), lobbying activities are defined broadly to include,among other things,contacts on behalf of an organization with specified employees of the Executive Branch and Congress with regard to Federal legislative,regulatory and program administrative matters. Representation: 1,The applicant represents that it is or is not an organization described in Section 501(c)(4)of the Internal Revenue Code of 1986;and 2.Applicants that are a 501(c)(4)organizations,further represent,that after December 31,1995,it has or has not engaged in any lobbying activities as defined in the Lobbying Disclosure Act of 1995. Applicant Title Signature Date